QC162648 | Cefprozil Impurity 48 CAS# NA M.F.: C26H26N2O5S M.W.: 478.56 |
| |
QL011488 | Landiolol Impurity 88 CAS# NA M.F.: C12H14O4 M.W.: 222.24 |
| |
QL011483 | Landiolol Impurity 83 CAS# NA M.F.: C16H23N3O4 M.W.: 321.38 |
| |
QD030485 | Diclofenac sodium Impurity 85 CAS# NA M.F.: C28H20Cl4N2O4 M.W.: 590.28 |
| |
QD030484 | Diclofenac sodium Impurity 84 CAS# NA M.F.: C15H13Cl2NO2 M.W.: 310.17 |
| |
QD030483 | Diclofenac sodium Nitroso Impurity 1 CAS# NA M.F.: C12H8Cl2N2O M.W.: 267.11 |
| |
QC013126 | Carbazochrome Impurity 26 CAS# NA M.F.: C10H14N4O8S2 M.W.: 382.36 |
| |
QO243100 | Oxantel pamoate CAS# 68813-55-8 M.F.: C13H16N2O.C23H16O6 M.W.: 216.28 388.38 |
| |
QD192046 | Dasatinib Impurity 46 CAS# NA M.F.: C12H14ClNO2 M.W.: 239.70 |
| |
QG052802 | Geranyl acetate CAS# 105-87-3 M.F.: C12H20O2 M.W.: 196.29 |
| |
QD098700 | Diphemanil Methylsulfate CAS# 62-97-5 M.F.: C21H27NO4S M.W.: 389.51 |
| |
QA690301 | (+)-Abscisic Acid Glucose Ester-d6 CAS# NA M.F.: C21H25D5O9 M.W.: 431.49 |
| |
QO132091 | N-Nitroso Olmesartan Medoxomil CAS# NA M.F.: C29H29N7O7 M.W.: 587.59 |
| |
QD150308 | Docusate sodium Impurity 8 CAS# 7423-42-9 M.F.: C12H20O4 M.W.: 228.29 |
| |
QB011559 | Baloxavir marboxil Impurity 59 CAS# NA M.F.: C24H19F2N3O4S M.W.: 483.49 |
| |
QB011558 | Baloxavir marboxil Impurity 58 CAS# NA M.F.: C24H19F2N3O4S M.W.: 483.49 |
| |
QB011557 | Baloxavir marboxil Impurity 57 CAS# NA M.F.: C21H16F2O3S2 M.W.: 418.47 |
| |
QB011556 | Baloxavir marboxil Impurity 56 CAS# NA M.F.: C15H12F2O3S2 M.W.: 342.37 |
| |
QB011555 | Baloxavir marboxil Impurity 55 CAS# NA M.F.: C30H31F2N3O4S M.W.: 567.65 |
| |
QB011554 | Baloxavir marboxil Impurity 54 CAS# NA M.F.: C30H31F2N3O4S M.W.: 567.65 |
| |
QB011553 | Baloxavir marboxil Impurity 53 CAS# NA M.F.: C14H10F2O3S M.W.: 296.29 |
| |
QB011552 | Baloxavir marboxil Impurity 52 CAS# NA M.F.: C14H10F2O2S M.W.: 280.29 |
| |
QB011551 | Baloxavir marboxil Impurity 51 CAS# NA M.F.: C10H11N3O4 M.W.: 237.22 |
| |
QB011550 | Baloxavir marboxil Impurity 50 CAS# 1745-46-6 M.F.: C14H12OS M.W.: 228.31 |
| |
QB011549 | Baloxavir marboxil Impurity 49 CAS# 1820001-80-6 M.F.: C14H11FOS M.W.: 246.30 |
| |
QD091009 | Dicloxacillin sodium Impurity 9 CAS# NA M.F.: C21H21Cl2N3O7S M.W.: 530.37 |
| |
QB031813 | Bromocriptine mesilate Impurity 13 CAS# NA M.F.: C33H42BrN5O5S M.W.: 700.69 |
| |
QD091008 | Dicloxacillin sodium Impurity 8 CAS# 934986-84-2 M.F.: C21H21Cl2N3O7S M.W.: 530.37 |
| |
QD091007 | Dicloxacillin sodium Impurity 7 CAS# 883225-99-8 M.F.: C13H10Cl2N2O4 M.W.: 329.13 |
| |
QI151623 | Ioversol Impurity 5 CAS# NA M.F.: C13H14I3N3O6 M.W.: 688.98 |
| |
QB011548 | Baloxavir marboxil Impurity 48 CAS# 2826217-70-1 M.F.: C24H19F2N3O4S M.W.: 483.49 |
| |
QB011547 | Baloxavir marboxil Impurity 47 CAS# 2136287-88-0 M.F.: C30H31F2N3O4S M.W.: 567.65 |
| |
QF120807 | Flecainide acetate Nitroso Impurity 2 CAS# NA M.F.: C17H19F6N3O4 M.W.: 443.35 |
| |
QT142434 | Tranexamic Acid Impurity 34 CAS# NA M.F.: C10H17NO3 M.W.: 199.25 |
| |
QC1825125 | Canagliflozin Impurity 125 CAS# NA M.F.: C12H14O8 M.W.: 286.24 |
| |
QR091133 | Rimegepant Impurity 33 CAS# 1452167-10-0 M.F.: C25H32FNO3Si M.W.: 441.62 |
| |
QR091129 | Rimegepant Impurity 29 CAS# 1397526-11-2 M.F.: C25H33F2NO2Si M.W.: 445.63 |
| |
QB052525 | Benzylpenicillin sodium Impurity 25 CAS# NA M.F.: C32H38N4O9S2 M.W.: 686.80 |
| |
QT080305 | Thiocolchicoside Hydrate EP Impurity E CAS# 219547-29-2 M.F.: C26H31NO10S M.W.: 549.59 |
| |
QT010628 | Tafluprost Impurity 28 CAS# 2065-23-8 M.F.: C9H10O3 M.W.: 166.18 |
| |
QT092616 | Tizanidine Impurity 16 CAS# 767-64-6 M.F.: C6H5N3S M.W.: 151.19 |
| |
QC061879 | Cefuroxime Axetil Impurity 79 CAS# 65866-86-6 M.F.: C7H7NO4 M.W.: 169.14 |
| |
QT090310 | Thioctic Acid Impurity 10 CAS# 97023-76-2 M.F.: C13H16O2 M.W.: 204.27 |
| |
QT090309 | Thioctic Acid Impurity 9 CAS# NA M.F.: C13H16O2 M.W.: 204.27 |
| |
QC155700 | Corosolic acid CAS# 4547-24-4 M.F.: C30H48O4 M.W.: 472.71 |
| |
QC132676 | Cefmetazole sodium Impurity 76 CAS# NA M.F.: C28H27N7O5S3 M.W.: 637.75 |
| |
QD030482 | Diclofenac sodium Impurity 82 CAS# 1470584-30-5 M.F.: C11H12Cl2O2 M.W.: 247.12 |
| |
QI142602 | Insulin icodec B-FVNQHLCGSHLVEALHLVCGERGFHYTPK CAS# NA M.F.: NA M.W.: NA |
| |
QI142601 | Insulin icodec A-GIVEQCCTSICSLEQLENYCN CAS# NA M.F.: NA M.W.: NA |
| |
QB053308 | Belumosudil Impurity 8 CAS# NA M.F.: C36H41N7O5 M.W.: 651.77 |
| |
QG121824 | Glycyrrhizic acid methyl ester CAS# 104191-95-9 M.F.: C43H64O16 M.W.: 836.97 |
| |
QA181901 | Aristolochic acid CAS# 313-67-7 M.F.: C17H11NO7 M.W.: 341.28 |
| |
QP090343 | Sodium Picosulfate Impurity 43 CAS# NA M.F.: C18H13NNa2O12S3 M.W.: 577.46 |
| |
QP090342 | Sodium Picosulfate Impurity 42 CAS# NA M.F.: C18H15NO6S M.W.: 373.38 |
| |
QP090341 | Sodium Picosulfate Impurity 41 CAS# NA M.F.: C19H15NNa2O11S3 M.W.: 575.48 |
| |
QP090340 | Sodium Picosulfate Impurity 40 CAS# NA M.F.: C19H17NO5S M.W.: 371.41 |
| |
QB051340 | Bempedoic acid Impurity 40 CAS# 2127387-65-7 M.F.: C19H34O4 M.W.: 326.48 |
| |
QB051339 | Bempedoic acid Impurity 39 CAS# NA M.F.: C19H38O4 M.W.: 330.51 |
| |
QB051338 | Bempedoic acid Impurity 38 CAS# NA M.F.: C10H20O3 M.W.: 188.27 |
| |
QB051337 | Bempedoic acid Impurity 37 CAS# 14250-73-8 M.F.: C9H18O2 M.W.: 158.24 |
| |
QB051336 | Bempedoic acid Impurity 36 CAS# NA M.F.: C21H36O10 M.W.: 448.51 |
| |
QP160204 | Prednisolone Sodium Phosphate USP Impurity F CAS# NA M.F.: C21H27O7P M.W.: 422.41 |
| |
QP160203 | Prednisolone Sodium Phosphate Impurity 3 CAS# NA M.F.: C21H29O8P M.W.: 440.43 |
| |
QP160202 | Prednisolone Sodium Phosphate Impurity 2 CAS# NA M.F.: C21H29O8P M.W.: 440.43 |
| |
QP160201 | Prednisolone Sodium Phosphate Impurity 1 CAS# NA M.F.: C21H29O8P M.W.: 440.43 |
| |
QP160200 | Prednisolone Sodium Phosphate CAS# 125-02-0 M.F.: C21H27Na2O8P M.W.: 484.39 |
| |
QM041516 | Medroxyprogesterone Acetate Impurity 16 CAS# NA M.F.: C25H36O4 M.W.: 400.56 |
| |
QM041515 | Medroxyprogesterone Acetate Impurity 15 CAS# 136803-81-1 M.F.: C25H32O4 M.W.: 396.53 |
| |
QM041514 | Medroxyprogesterone Acetate Impurity 14 CAS# 2128317-86-0 M.F.: C31H41NO4 M.W.: 491.67 |
| |
QO240125 | Oxacillin sodium Impurity 25 CAS# NA M.F.: C19H18ClN3O5S M.W.: 435.88 |
| |
QH041834 | Cholesterol 5beta,6beta-Epoxide CAS# 4025-59-6 M.F.: C27H46O2 M.W.: 402.66 |
| |
QH041833 | Cholesterol 5alpha,6alpha-Epoxide CAS# 1250-95-9 M.F.: C27H46O2 M.W.: 402.66 |
| |
QO022047 | Obeticholic Acid Impurity 47 CAS# NA M.F.: C27H44O4 M.W.: 432.65 |
| |
QT142433 | Tranexamic Acid Impurity 33 CAS# NA M.F.: C10H17NO3 M.W.: 199.25 |
| |
QT142432 | Tranexamic Acid Impurity 32 CAS# 10473-24-2 M.F.: C10H17NO3 M.W.: 199.25 |
| |
QT260437 | Trazodone hydrochloride Impurity 37 CAS# NA M.F.: C16H25ClN2O M.W.: 296.84 |
| |
QT260436 | Trazodone hydrochloride Impurity 36 CAS# NA M.F.: C19H22ClN5O M.W.: 371.87 |
| |
QC061621 | Cefpodoxime Proxetil EP Impurity A-d3 Sodium Salt CAS# NA M.F.: C15H13D3N5NaO6S2 M.W.: 452.45 |
| |
QE042888 | Edoxaban Impurity 88 CAS# 141354-54-3 M.F.: C9H9BrN2O3 M.W.: 273.09 |
| |
QD052604 | Dexchlorpheniramine maleate Impurity 4 CAS# NA M.F.: C16H19ClN2O2 M.W.: 306.79 |
| |
QB151300 | Bongkrekic acid CAS# 11076-19-0 M.F.: C28H38O7 M.W.: 486.61 |
| |
QE070600 | E7766 diammonium salt CAS# 2242635-03-4 M.F.: C24H32F2N12O8P2S2 M.W.: 780.66 |
| |
QP092721 | Pinaverium Bromide Impurity 21 CAS# NA M.F.: C17H31NO2 M.W.: 281.44 |
| |
QP081212 | Glycerol Phenylbutyrate Impurity 12 CAS# NA M.F.: C33H36O7 M.W.: 544.64 |
| |
QP081211 | Glycerol Phenylbutyrate Impurity 11 CAS# NA M.F.: C33H36O7 M.W.: 544.64 |
| |
QB011545 | Baloxavir marboxil Impurity 45 CAS# NA M.F.: C25H21F2N3O6S2 M.W.: 561.57 |
| |
QB011544 | Baloxavir marboxil Impurity 44 CAS# NA M.F.: C27H22ClF2N3O7S M.W.: 605.99 |
| |
QP081210 | Glycerol Phenylbutyrate Impurity 10 CAS# NA M.F.: C46H54O9 M.W.: 750.93 |
| |
QP081209 | Glycerol Phenylbutyrate Impurity 9 CAS# NA M.F.: C46H54O9 M.W.: 750.93 |
| |
QP081208 | Glycerol Phenylbutyrate Impurity 8 CAS# NA M.F.: C33H36O7 M.W.: 544.64 |
| |
QP081207 | Glycerol Phenylbutyrate Impurity 7 CAS# NA M.F.: C13H18O4 M.W.: 238.28 |
| |
QP081206 | Glycerol Phenylbutyrate Impurity 6 CAS# 1292210-87-7 M.F.: C13H18O4 M.W.: 238.28 |
| |
QP081205 | Glycerol Phenylbutyrate Impurity 5 CAS# 864811-35-8 M.F.: C23H28O5 M.W.: 384.47 |
| |
QP081204 | Glycerol Phenylbutyrate Impurity 4 CAS# 1443417-10-4 M.F.: C23H28O5 M.W.: 384.47 |
| |
QP010701 | Paederosidic acid methyl ester CAS# 122413-01-8 M.F.: C19H26O12S M.W.: 478.47 |
| |
QT142430 | N-Nitroso Tranexamic Acid EP Impurity A CAS# NA M.F.: C16H26N2O5 M.W.: 326.39 |
| |
QM050114 | Metamizole sodium Impurity 14 CAS# NA M.F.: C13H17N3O7S2 M.W.: 391.41 |
| |
QO240124 | Oxacillin sodium Impurity 24 CAS# NA M.F.: C19H20N4O4S M.W.: 400.45 |
| |
QD150100 | Domoic acid CAS# 14277-97-5 M.F.: C15H21NO6 M.W.: 311.33 |
| |
QB051335 | Bempedoic acid Impurity 35 CAS# 2511500-14-2 M.F.: C21H40O5 M.W.: 372.55 |
| |
QC061878 | Cefuroxime Axetil Impurity 78 CAS# NA M.F.: C19H21N3O8S M.W.: 451.45 |
| |
QC061877 | Cefuroxime Axetil Impurity 77 CAS# NA M.F.: C21H23N3O10S M.W.: 509.49 |
| |
QF181653 | Faropenem Impurity 53 CAS# NA M.F.: C24H28N2O10S2 M.W.: 568.61 |
| |
QO022046 | Obeticholic Acid Impurity 46 CAS# 1516887-32-3 M.F.: C27H42O4 M.W.: 430.63 |
| |
QO022045 | Obeticholic Acid Impurity 45 CAS# NA M.F.: C28H48O4Si M.W.: 476.77 |
| |
QO022044 | Obeticholic Acid Impurity 44 CAS# 77341-09-4 M.F.: C28H48O4Si M.W.: 476.77 |
| |
QO022043 | Obeticholic Acid Impurity 43 CAS# NA M.F.: C30H54O4Si2 M.W.: 534.93 |
| |
QO022042 | Obeticholic Acid Impurity 42 CAS# 14773-00-3 M.F.: C25H40O4 M.W.: 404.59 |
| |
QO022041 | Obeticholic Acid Impurity 41 CAS# 7753-72-2 M.F.: C25H38O4 M.W.: 402.58 |
| |
QP185402 | Prulifloxacin hydrochloride Impurity 2 CAS# NA M.F.: C37H36F2N6O9S2 M.W.: 810.84 |
| |
QP185401 | Prulifloxacin hydrochloride Impurity 1 CAS# NA M.F.: C16H16FN3O3S M.W.: 349.38 |
| |
QS050709 | Selegiline hydrochloride Impurity 9 CAS# NA M.F.: C13H18ClN M.W.: 223.74 |
| |
QS050708 | Selegiline hydrochloride Impurity 8 CAS# NA M.F.: C11H17N.HCl M.W.: 163.26 36.46 |
| |
QB054800 | Betulinic acid CAS# 472-15-1 M.F.: C30H48O3 M.W.: 456.71 |
| |
QP1824114 | Parecoxib Sodium Impurity 114 CAS# NA M.F.: C19H18N2O5S M.W.: 386.42 |
| |
QP080513 | Phenytoin Sodium Impurity 13 CAS# NA M.F.: C17H14Cl2N2O2 M.W.: 349.21 |
| |
QR0512104 | Relugolix Impurity 104 CAS# NA M.F.: C29H27F2N7O5S M.W.: 623.64 |
| |
QA190218 | L-Isoascorbic acid CAS# 26094-91-7 M.F.: C6H8O6 M.W.: 176.12 |
| |
QC042044 | Cefditoren pivoxil Impurity 44 CAS# NA M.F.: C26H30N6O8S3 M.W.: 650.74 |
| |
QA190217 | D-Ascorbic acid CAS# 10504-35-5 M.F.: C6H8O6 M.W.: 176.12 |
| |
QP052209 | Pentoxyverine hydrogen citrate Impurity 9 CAS# 5296-89-9 M.F.: C12H15NO M.W.: 189.26 |
| |
QP052208 | Pentoxyverine hydrogen citrate Impurity 8 CAS# 103-80-0 M.F.: C8H7ClO M.W.: 154.59 |
| |
QP052207 | Pentoxyverine hydrogen citrate Impurity 7 CAS# 103-81-1 M.F.: C8H9NO M.W.: 135.17 |
| |
QM041853 | Minodronic Acid Impurity 53 CAS# 21801-86-5 M.F.: C9H9N3O M.W.: 175.19 |
| |
QM041852 | Minodronic Acid Impurity 52 CAS# 2717-95-5 M.F.: C10H13N3 M.W.: 175.24 |
| |
QB210302 | Bucladesine sodium Impurity 2 CAS# 70253-67-7 M.F.: C14H17N5NaO7P M.W.: 421.28 |
| |
QB210301 | Bucladesine sodium Impurity 1 CAS# 55443-13-5 M.F.: C14H17N5NaO7P M.W.: 421.28 |
| |
QF151406 | Fondaparinux Sodium Impurity 6 CAS# 348625-84-3 M.F.: C13H21NO19S3 M.W.: 591.48 |
| |
QG122729 | Glycopyrronium Bromide Impurity 29 CAS# 64471-43-8 M.F.: C13H16O3 M.W.: 220.27 |
| |
QD030480 | Diclofenac sodium Impurity 80 CAS# NA M.F.: C13H11Cl2NO2 M.W.: 284.14 |
| |
QD030481 | Diclofenac sodium Impurity 81 CAS# NA M.F.: C14H7Cl2NO3 M.W.: 308.11 |
| |
QD030479 | Diclofenac sodium Impurity 79 CAS# NA M.F.: C22H18Cl2N2O4 M.W.: 445.30 |
| |
QB091302 | Bismuth subcitrate-d8 CAS# NA M.F.: C12H2D8BiK3O14 M.W.: 712.52 |
| |
QP090339 | Sodium Picosulfate Impurity 39 CAS# 1122-72-1 M.F.: C7H7NO M.W.: 121.14 |
| |
QD0207110 | Dabigatran Etexilate Impurity 110 CAS# NA M.F.: C21H22N6O2 M.W.: 390.45 |
| |
QP090338 | Sodium Picosulfate Impurity 38 CAS# 599-64-4 M.F.: C15H16O M.W.: 212.29 |
| |
QP090337 | Sodium Picosulfate Impurity 37 CAS# 586-98-1 M.F.: C6H7NO M.W.: 109.13 |
| |
QA181903 | Aristolochic acid C CAS# 4849-90-5 M.F.: C16H9NO7 M.W.: 327.25 |
| |
QF120377 | Folic Acid Impurity 77 CAS# NA M.F.: C38H40N14O11 M.W.: 868.83 |
| |
QI142518 | Indocyanine Green Impurity 18 CAS# NA M.F.: C18H21NO4S M.W.: 347.43 |
| |
QM093100 | Midecamycin Acetate CAS# 55881-07-7 M.F.: C45H71NO17 M.W.: 898.05 |
| |
QE151701 | Etoposide Phosphate Impurity 1 CAS# NA M.F.: C27H31O16P M.W.: 642.50 |
| |
QE151700 | Etoposide Phosphate CAS# 117091-64-2 M.F.: C29H33O16P M.W.: 668.54 |
| |
QP010301 | Dehydropachymic acid CAS# 77012-31-8 M.F.: C33H50O6 M.W.: 542.76 |
| |
QL140338 | Lincomycin Hydrochloride Impurity 38 CAS# NA M.F.: C17H32N2O7 M.W.: 376.45 |
| |
QL140337 | Lincomycin Hydrochloride Impurity 37 CAS# NA M.F.: C18H34N2O6S M.W.: 406.54 |
| |
QC-P181579 | Piscidic acid CAS# 469-65-8 M.F.: C11H12O7 M.W.: 256.21 |
| |
QP052206 | Pentoxyverine hydrogen citrate Impurity 6 CAS# 17380-62-0 M.F.: C12H13ClO M.W.: 208.69 |
| |
QT130618 | Tamoxifen Citrate Impurity 18 CAS# NA M.F.: C18H20 M.W.: 236.36 |
| |
QT031893 | DL-α-Tocopherol acetate CAS# 52225-20-4 M.F.: C31H52O3 M.W.: 472.75 |
| |
QV3077135 | Vitamin K1 Impurity 135 CAS# NA M.F.: C31H46O4 M.W.: 482.71 |
| |
QT011509 | Tauroursodeoxycholic Acid Impurity 9 CAS# NA M.F.: C29H51NO6S M.W.: 541.79 |
| |
QT011508 | Tauroursodeoxycholic Acid Impurity 8 CAS# NA M.F.: C29H51NO6S M.W.: 541.79 |
| |
QT011507 | Tauroursodeoxycholic Acid Impurity 7 CAS# NA M.F.: C29H50N2O10S2 M.W.: 650.84 |
| |
QT011506 | Tauroursodeoxycholic Acid Impurity 6 CAS# NA M.F.: C29H50N2O10S2 M.W.: 650.84 |
| |
QT011505 | Tauroursodeoxycholic Acid Impurity 5 CAS# NA M.F.: C27H46O4 M.W.: 434.66 |
| |
QT011503 | Tauroursodeoxycholic Acid Impurity 3 CAS# NA M.F.: C26H45NO7S M.W.: 515.71 |
| |
QA220194 | Avatrombopag Nitroso Impurity 2 CAS# NA M.F.: C8H14N2O3 M.W.: 186.21 |
| |
QD171225 | Dequalinium chloride Impurity 25 CAS# NA M.F.: C30H39Cl2N3O M.W.: 528.56 |
| |
QD171224 | Dequalinium chloride Impurity 24 CAS# NA M.F.: C20H31ClN2O M.W.: 350.93 |
| |
QD171223 | Dequalinium chloride Impurity 23 CAS# NA M.F.: C20H17N3 M.W.: 299.38 |
| |
QD171222 | Dequalinium chloride Impurity 22 CAS# 27063-27-0 M.F.: C10H10N2 M.W.: 158.20 |
| |
QD171221 | Dequalinium chloride Impurity 21 CAS# NA M.F.: C18H18N2O M.W.: 278.36 |
| |
QD171220 | Dequalinium chloride Impurity 20 CAS# NA M.F.: C18H16N2O M.W.: 276.34 |
| |
QD171219 | Dequalinium chloride Impurity 19 CAS# NA M.F.: C28H26N4O M.W.: 434.54 |
| |
QD171218 | Dequalinium chloride Impurity 18 CAS# 634-47-9 M.F.: C10H8ClN M.W.: 177.63 |
| |
QD171217 | Dequalinium chloride Impurity 17 CAS# 112-47-0 M.F.: C10H22O2 M.W.: 174.28 |
| |
QD171216 | Dequalinium chloride Impurity 16 CAS# 2162-98-3 M.F.: C10H20Cl2 M.W.: 211.17 |
| |
QD171215 | Dequalinium chloride Impurity 15 CAS# 607-66-9 M.F.: C10H9NO M.W.: 159.19 |
| |
QD171214 | Dequalinium chloride Impurity 14 CAS# NA M.F.: C12H15NO2 M.W.: 205.26 |
| |
QT022056 | Terbutaline Impurity 56 CAS# 27628-06-4 M.F.: C22H20O3 M.W.: 332.40 |
| |
QB201362 | Betamethasone Acetate Impurity 62 CAS# 18769-18-1 M.F.: C24H32O6 M.W.: 416.51 |
| |
QB180810 | Brompheniramine maleate Impurity 10 CAS# 18453-10-6 M.F.: C15H17BrN2 M.W.: 305.22 |
| |
QC180301 | Carbodenafil Impurity 1 CAS# 2196244-90-1 M.F.: C25H34N6OS2 M.W.: 498.71 |
| |
QN010617 | Nafamostat Impurity 17 CAS# NA M.F.: C10H12N2O2S M.W.: 224.28 |
| |
QP092720 | Pinaverium Bromide Impurity 20 CAS# NA M.F.: C26H43Br2NO5 M.W.: 609.44 |
| |
QP092719 | Pinaverium Bromide Impurity 19 CAS# NA M.F.: C27H44BrNO5 M.W.: 542.56 |
| |
QS150410 | Alendronic Acid Impurity 10 CAS# NA M.F.: C16H33NO17P2 M.W.: 573.38 |
| |
QG122124 | Glucuronic acid 3-sulfate CAS# 110231-93-1 M.F.: C6H10O10S M.W.: 274.20 |
| |
QG122123 | Glucuronic acid 2-sulfate CAS# 98517-62-5 M.F.: C6H10O10S M.W.: 274.20 |
| |
QB030512 | 10-Deacetyl-10-Triethylsiloxybaccatin III CAS# 207680-15-7 M.F.: C35H50O10Si M.W.: 658.86 |
| |
QB030511 | 7-Triethylsilyl-10-Deacetylbaccatin III CAS# 115437-18-8 M.F.: C35H50O10Si M.W.: 658.86 |
| |
QB030510 | 13-Oxobaccatin III CAS# 32981-89-8 M.F.: C31H36O11 M.W.: 584.62 |
| |
QU130509 | Umeclidinium bromide Impurity 9 CAS# 2253743-40-5 M.F.: C35H38BrNO2 M.W.: 584.60 |
| |
QU130508 | Umeclidinium bromide Impurity 8 CAS# 2253743-38-1 M.F.: C35H38BrNO2 M.W.: 584.60 |
| |
QU130507 | Umeclidinium bromide Impurity 7 CAS# 2253743-36-9 M.F.: C35H38BrNO2 M.W.: 584.6 |
| |
QT211501 | Taurochenodeoxycholic Acid-2,2,4,4-d4 Sodium Salt CAS# 2410279-85-3 M.F.: C26H40D4NNaO6S M.W.: 525.71 |
| |
QF122925 | Fluocinolone acetonide Impurity 25 CAS# NA M.F.: C24H32F2O9S M.W.: 534.57 |
| |
QL140336 | Lincomycin Hydrochloride Nitroso Impurity 1 CAS# NA M.F.: C17H31N3O7S M.W.: 421.51 |
| |
QS180649 | Sorafenib tosylate Impurity 49 CAS# 284461-74-1 M.F.: C20H14ClF3N4O3 M.W.: 450.80 |
| |
QV3077134 | Vitamin K1 Impurity 134 CAS# NA M.F.: C31H46O2 M.W.: 450.71 |
| |
QH042511 | Hydrocortisone acetate Impurity 11 CAS# 50733-54-5 M.F.: C23H31BrO6 M.W.: 483.40 |
| |
QB200112 | 6-Bromo-betamethasone-17,21-dipropionate CAS# 1186048-34-9 M.F.: C28H36BrFO7 M.W.: 583.49 |
| |
QC651211 | Cloxacillin Sodium Impurity 11 CAS# NA M.F.: C27H30ClN5O8S2 M.W.: 652.13 |
| |
QC651210 | Cloxacillin Sodium Impurity 10 CAS# NA M.F.: C38H38Cl2N6O11S2 M.W.: 889.77 |
| |
QW011829 | Warfarin sodium Impurity 29 CAS# NA M.F.: C18H20O2 M.W.: 268.36 |
| |
QW011828 | Warfarin sodium Impurity 28 CAS# NA M.F.: C17H16O3 M.W.: 268.31 |
| |
QW011827 | Warfarin sodium Impurity 27 CAS# NA M.F.: C17H16O3 M.W.: 268.31 |
| |
QC061916 | Ceftaroline Fosamil Impurity P CAS# 54639-48-4 M.F.: C28H24N2O5S M.W.: 500.57 |
| |
QC651209 | Cloxacillin Sodium Impurity 9 CAS# NA M.F.: C13H11ClN2O4 M.W.: 294.69 |
| |
QC651208 | Cloxacillin Sodium Impurity 8 CAS# NA M.F.: C27H30ClN5O8S2 M.W.: 652.13 |
| |
QM131933 | Mometasone Furoate Impurity 33 CAS# 151265-36-0 M.F.: C22H27ClO3 M.W.: 374.91 |
| |
QC061875 | Cefuroxime sodium Impurity 75 CAS# NA M.F.: C15H15N3O6S M.W.: 365.36 |
| |
QW011826 | Warfarin sodium Impurity 26 CAS# NA M.F.: C35H24O6 M.W.: 540.57 |
| |
QW011825 | Warfarin sodium Impurity 25 CAS# NA M.F.: C26H20O4 M.W.: 396.44 |
| |
QW011824 | Warfarin sodium Impurity 24 CAS# NA M.F.: C35H26O7 M.W.: 558.59 |
| |
QT211204 | Tulathromycin A Impurity 4 CAS# NA M.F.: C29H56N2O9 M.W.: 576.77 |
| |
QR457061 | Rocuronium bromide Impurity 61 CAS# NA M.F.: C27H44N2O2 M.W.: 428.66 |
| |
QR457060 | Rocuronium bromide Impurity 60 CAS# NA M.F.: C24H41NO3 M.W.: 391.60 |
| |
QR457059 | Rocuronium bromide Impurity 59 CAS# NA M.F.: C23H35NO M.W.: 341.54 |
| |
QR457058 | Rocuronium bromide Impurity 58 CAS# NA M.F.: C23H35NO2 M.W.: 357.54 |
| |
QR457057 | Rocuronium bromide Impurity 57 CAS# NA M.F.: C23H35NO2 M.W.: 357.54 |
| |
QR457056 | Rocuronium bromide Impurity 56 CAS# NA M.F.: C23H37NO2 M.W.: 359.55 |
| |
QR457055 | Rocuronium bromide Impurity 55 CAS# NA M.F.: C23H37NO2 M.W.: 359.55 |
| |
QH042510 | Hydrocortisone acetate Impurity 10 CAS# 33744-76-2 M.F.: C24H32O7 M.W.: 432.51 |
| |
QH042509 | Hydrocortisone acetate Impurity 9 CAS# 115098-60-7 M.F.: C23H28O5 M.W.: 384.47 |
| |
QG121823 | Glycyrrhizic Acid Impurity 23 CAS# NA M.F.: C48H74O16 M.W.: 907.10 |
| |
QG121822 | Glycyrrhizic Acid Impurity 22 CAS# NA M.F.: C46H70O16 M.W.: 879.05 |
| |
QG121821 | Glycyrrhizic Acid Impurity 21 CAS# NA M.F.: C46H70O16 M.W.: 879.05 |
| |
QG121820 | Glycyrrhizic Acid Impurity 20 CAS# NA M.F.: C44H66O16 M.W.: 851.00 |
| |
QG121819 | Glycyrrhizic Acid Impurity 19 CAS# NA M.F.: C44H66O16 M.W.: 851.00 |
| |
QG121818 | Glycyrrhizic Acid Impurity 18 CAS# NA M.F.: C44H66O16 M.W.: 851.00 |
| |
QV200110 | 5,6-Epoxy Vitamin A Palmitate CAS# 3012-64-4 M.F.: C36H60O3 M.W.: 540.87 |
| |
QA190216 | Ascorbic Acid Impurity 16 CAS# NA M.F.: C7H10O7 M.W.: 206.15 |
| |
QB200500 | Bethanechol Chloride CAS# 590-63-6 M.F.: C7H17ClN2O2 M.W.: 196.68 |
| |
QC010333 | [Ser29-O-Acetyl]Calcitonin (salmon) CAS# NA M.F.: C147H242N44O49S2 M.W.: 3473.93 |
| |
QC010332 | [Ser13-O-Acetyl]Calcitonin (salmon) CAS# NA M.F.: C147H242N44O49S2 M.W.: 3473.93 |
| |
QC010331 | [Ser5-O-Acetyl]Calcitonin (salmon) CAS# NA M.F.: C147H242N44O49S2 M.W.: 3473.93 |
| |
QC010330 | [Ser2-O-Acetyl]Calcitonin (salmon) CAS# NA M.F.: C147H242N44O49S2 M.W.: 3473.93 |
| |
QC010329 | [Asp26]Calcitonin (salmon) CAS# NA M.F.: C145H239N43O49S2 M.W.: 3432.88 |
| |
QC010328 | [Asp3]Calcitonin (salmon) CAS# NA M.F.: C145H239N43O49S2 M.W.: 3432.88 |
| |
QC010327 | [Glu14]Calcitonin (salmon) CAS# NA M.F.: C145H239N43O49S2 M.W.: 3432.88 |
| |
QN151878 | Noradrenaline (Norepinephrine) Impurity 78 CAS# NA M.F.: C17H17NO4 M.W.: 299.33 |
| |
QN151877 | Noradrenaline (Norepinephrine) Impurity 77 CAS# NA M.F.: C17H21NO4 M.W.: 303.36 |
| |
QO022040 | Obeticholic Acid Impurity 40 CAS# 1834605-28-5 M.F.: C26H40O4 M.W.: 416.60 |
| |
QC031645 | Cefcapene pivoxil Impurity 45 CAS# NA M.F.: C47H58N10O16S4 M.W.: 1147.28 |
| |
QC031644 | Cefcapene pivoxil Impurity 44 CAS# NA M.F.: C32H38N8O12S3 M.W.: 822.88 |
| |
QC031643 | Cefcapene pivoxil Impurity 43 CAS# NA M.F.: C28H37N5O9S2 M.W.: 651.75 |
| |
QF120376 | Folic Acid Impurity 76 CAS# NA M.F.: C21H27N7O6 M.W.: 473.49 |
| |
QD122065 | Dolutegravir Impurity 65 CAS# NA M.F.: C17H14F2N2O6 M.W.: 380.30 |
| |
QE191837 | Estradiol Valerate Impurity 37 CAS# 182624-54-0 M.F.: C23H32O3 M.W.: 356.50 |
| |
QM050113 | Metamizole sodium Impurity 13 CAS# NA M.F.: C13H19N3O7S2 M.W.: 393.43 |
| |
QF061340 | Fosfomycin Trometamol Impurity 40 CAS# NA M.F.: C5H13O5P M.W.: 184.13 |
| |
QA180267 | Arbidol Impurity 67 CAS# 40945-79-7 M.F.: C15H17NO4 M.W.: 275.30 |
| |
QO022039 | Obeticholic Acid Impurity 39 CAS# 462122-38-9 M.F.: C27H44O4 M.W.: 432.65 |
| |
QO022038 | Obeticholic Acid Impurity 38 CAS# 863239-59-2 M.F.: C27H42O4 M.W.: 430.63 |
| |
QP180806 | Pralidoxime Iodide Impurity 6 CAS# 873-69-8 M.F.: C6H6N2O M.W.: 122.13 |
| |
QP180805 | Pralidoxime Iodide Impurity 5 CAS# 3785-03-3 M.F.: C7H7IN2 M.W.: 246.05 |
| |
QP180804 | Pralidoxime Iodide Impurity 4 CAS# 3313-51-7 M.F.: C7H10INO M.W.: 251.07 |
| |
QP180803 | Pralidoxime Iodide Impurity 3 CAS# 3784-97-2 M.F.: C7H8INO M.W.: 249.05 |
| |
QP180802 | Pralidoxime Iodide Impurity 2 CAS# 45750-74-1(cation form) M.F.: C7H9IN2O M.W.: 264.07 |
| |
QP180801 | Pralidoxime Iodide Impurity 1 CAS# 694-85-9 M.F.: C6H7NO M.W.: 109.13 |
| |
QP186303 | (E)-Pralidoxime Chloride CAS# 14018-50-9 M.F.: C7H9ClN2O M.W.: 172.61 |
| |
QP186302 | (Z)-Pralidoxime Chloride CAS# 13698-37-8 M.F.: C7H9ClN2O M.W.: 172.61 |
| |
QP186300 | Pralidoxime Chloride CAS# 51-15-0 M.F.: C7H9ClN2O M.W.: 172.61 |
| |
QP186301 | Pralidoxime Chloride Impurity 1 CAS# 3697-38-9 M.F.: C7H8ClNO2 M.W.: 173.60 |
| |
QP180800 | Pralidoxime Iodide CAS# 94-63-3 M.F.: C7H9IN2O M.W.: 264.07 |
| |
QP052205 | Pentoxyverine hydrogen citrate Impurity 5 CAS# 4535-96-0 M.F.: C13H16O2 M.W.: 204.27 |
| |
QP052204 | Pentoxyverine hydrogen citrate Impurity 4 CAS# 1421930-96-2 M.F.: C18H27NO3 M.W.: 305.42 |
| |
QP052203 | Pentoxyverine hydrogen citrate Impurity 3 CAS# NA M.F.: C16H21ClO3 M.W.: 296.79 |
| |
QP052202 | Pentoxyverine hydrogen citrate Impurity 2 CAS# 1378312-51-6 M.F.: C16H23NO M.W.: 245.37 |
| |
QS221207 | Sivelestat sodium Impurity G CAS# NA M.F.: C20H22N2O7S M.W.: 434.46 |
| |
QC052013 | Cetrorelix Impurity 13 CAS# NA M.F.: C72H94ClN17O15 M.W.: 1473.10 |
| |
QS150409 | Alendronic Acid Impurity 9 CAS# NA M.F.: C4H13NO8P2 M.W.: 265.09 |
| |
QF120375 | Folic Acid Impurity 75 CAS# 31690-08-1;301298-88-4(Ca salt) M.F.: C20H25N7O6 M.W.: 459.46 |
| |
QL051518 | Calcium Levofolinate Nitroso Impurity 2 CAS# NA M.F.: C21H23N7O8 M.W.: 501.46 |
| |
QL051517 | Calcium Levofolinate Nitroso Impurity 1 CAS# NA M.F.: C20H22N8O8 M.W.: 502.44 |
| |
QL252032 | Lysine aspirin Impurity 32 CAS# NA M.F.: C15H20N2O5 M.W.: 308.33 |
| |
QC022035 | Cabazitaxel Impurity 35 CAS# 949459-78-3 M.F.: C22H25NO6 M.W.: 399.44 |
| |
QF061339 | Fosfomycin Trometamol Impurity 39 CAS# 76274-77-6 M.F.: C3H9O4P M.W.: 140.07 |
| |
QF061338 | Fosfomycin Trometamol Impurity 38 CAS# 53621-85-5 M.F.: C3H9O4P M.W.: 140.07 |
| |
QF061337 | Fosfomycin Trometamol Impurity 37 CAS# NA M.F.: C11H23O3P M.W.: 234.28 |
| |
QH042453 | Hydroxychloroquine sulfate Impurity 53 CAS# NA M.F.: C20H30ClN3O M.W.: 363.93 |
| |
QH042452 | Hydroxychloroquine sulfate Impurity 52 CAS# NA M.F.: C20H30ClN3O M.W.: 363.93 |
| |
QE201634 | Ertapenem Impurity 34 CAS# NA M.F.: C44H48N6O13S2 M.W.: 933.02 |
| |
QH042451 | Hydroxychloroquine sulfate Impurity 51 CAS# 4203-18-3 M.F.: C9H5Cl2N M.W.: 198.05 |
| |
QH042450 | Hydroxychloroquine sulfate Impurity 50 CAS# 23432-43-1 M.F.: C9H6ClNO M.W.: 179.6 |
| |
QH042449 | Hydroxychloroquine sulfate Impurity 49 CAS# 57797-97-4 M.F.: C9H6ClNO M.W.: 179.60 |
| |
QN151876 | Noradrenaline (Norepinephrine) Impurity 76 CAS# NA M.F.: C9H13NO6S M.W.: 263.26 |
| |
QI091642 | Ipratropium Bromide Impurity 42 CAS# NA M.F.: C18H25NO3 M.W.: 303.40 |
| |
QI091641 | Ipratropium Bromide Impurity 41 CAS# NA M.F.: C18H23NO3 M.W.: 301.39 |
| |
QI091640 | Ipratropium Bromide Impurity 40 CAS# NA M.F.: C19H25NO4 M.W.: 331.41 |
| |
QL051302 | Folinic Acid Impurity 2 CAS# NA M.F.: C15H18N6O3 M.W.: 330.35 |
| |
QV051834 | Verapamil Impurity 34 CAS# 114847-42-6 M.F.: C26H36N2O4 M.W.: 440.58 |
| |
QF090570 | Finerenone Impurity 70 CAS# NA M.F.: C25H26N4O4 M.W.: 446.51 |
| |
QG121817 | Glycyrrhizic Acid Impurity 17 CAS# NA M.F.: C44H64O18 M.W.: 880.98 |
| |
QG121816 | Glycyrrhizic Acid Impurity 16 CAS# 2270962-44-0 M.F.: C44H66O16 M.W.: 851.00 |
| |
QB050434 | Bedaquiline Fumarate Impurity 34 CAS# 1972612-60-4+857086-94-3 M.F.: C32H31BrN2O2 M.W.: 555.50 |
| |
QB050433 | Bedaquiline Fumarate Impurity 33 CAS# NA M.F.: C32H29BrN2O M.W.: 537.50 |
| |
QG121815 | Glycyrrhizic Acid Impurity 15 CAS# NA M.F.: C45H68O16 M.W.: 865.02 |
| |
QG121814 | Glycyrrhizic Acid Impurity 14 CAS# NA M.F.: C45H68O16 M.W.: 865.02 |
| |
QG121813 | Glycyrrhizic Acid Impurity 13 CAS# NA M.F.: C42H62O17 M.W.: 838.94 |
| |
QG121812 | Glycyrrhizic Acid Impurity 12 CAS# NA M.F.: C42H62O17 M.W.: 838.94 |
| |
QG121811 | Glycyrrhizic Acid Impurity 11 CAS# NA M.F.: C42H62O17 M.W.: 838.94 |
| |
QI142517 | Indocyanine Green Impurity 17 CAS# 63450-66-8 M.F.: C32H34N2O4S M.W.: 542.69 |
| |
QI142516 | Indocyanine Green Impurity 16 CAS# 41532-84-7 M.F.: C15H15N M.W.: 209.29 |
| |
QL251101 | (+)-Lyoniresinol 3α-O-β-D-glucopyranoside CAS# 87585-32-8 M.F.: C28H38O13 M.W.: 582.60 |
| |
QB050432 | Bedaquiline Fumarate Impurity 32 CAS# 2443970-23-6;2443970-24-7(HCl salt) M.F.: C16H17NO M.W.: 239.32 |
| |
QP156702 | Poricoic acid B CAS# 137551-39-4 M.F.: C30H44O5 M.W.: 484.68 |
| |
QE161264 | Epalrestat Nitroso Impurity 1 CAS# NA M.F.: C2H4N2O3 M.W.: 104.07 |
| |
QE161263 | Epalrestat Impurity 63 CAS# 39486-57-2 M.F.: C5H6N2O2S2 M.W.: 190.24 |
| |
QD0207109 | Dabigatran Etexilate Impurity 109 CAS# 2498-50-2 M.F.: C7H9N3.2HCl M.W.: 135.17 72.92 |
| |
QD0207108 | Dabigatran Etexilate Impurity 108 CAS# 1416446-45-1 M.F.: C33H39N7O5 M.W.: 613.72 |
| |
QD0207107 | Dabigatran Etexilate Impurity 107 CAS# 1349500-09-9 M.F.: C35H43N7O5 M.W.: 641.77 |
| |
QZ151216 | Zoledronic acid Impurity 16 CAS# NA M.F.: C16H32N2O17P2 M.W.: 586.38 |
| |
QR241236 | Ruxolitinib Impurity 36 CAS# NA M.F.: C22H26N6O2 M.W.: 406.49 |
| |
QD0207106 | Dabigatran Etexilate Impurity 106 CAS# 1354892-78-6 M.F.: C29H32N6O4 M.W.: 528.61 |
| |
QR457054 | Rocuronium bromide Impurity 54 CAS# NA M.F.: C32H53BrN2O4 M.W.: 609.69 |
| |
QD030478 | Diclofenac sodium Impurity 78 CAS# NA M.F.: C17H17Cl2NO3 M.W.: 354.23 |
| |
QC061452 | Cefdinir Impurity 52 CAS# NA M.F.: C7H8N4O3S M.W.: 228.23 |
| |
QM050112 | Metamizole sodium Impurity 12 CAS# 92569-10-3 M.F.: C12H15N3O3 M.W.: 249.27 |
| |
QL1412170 | Lenalidomide Impurity 170 CAS# 220514-28-3 M.F.: C9H8BrNO4 M.W.: 274.07 |
| |
QC120211 | Clobetasol Propionate Impurity 11 CAS# 59860-99-0 M.F.: C22H27FO4 M.W.: 374.45 |
| |
QP081868 | Phloroglucinol Impurity 68 CAS# NA M.F.: C10H8O6 M.W.: 224.17 |
| |
QC062148 | Ceftazidime Impurity 48 CAS# 86299-47-0 M.F.: C13H19N3O5S M.W.: 329.37 |
| |
QU180138 | Urapidil Nitroso Impurity 1 CAS# 2219339-64-5 M.F.: C11H15N3O2 M.W.: 221.26 |
| |
QP092106 | Primaquine Diphosphate Nitroso Impurity 2 CAS# NA M.F.: C15H20N4O2 M.W.: 288.35 |
| |
QP092105 | Primaquine Diphosphate Nitroso Impurity 1 CAS# NA M.F.: C15H20N4O2 M.W.: 288.35 |
| |
QO130201 | N-Nitroso Omidenepag Isopropyl CAS# NA M.F.: C26H27N7O5S M.W.: 549.61 |
| |
QO130200 | Omidenepag Isopropyl CAS# 1187451-19-9 M.F.: C26H28N6O4S M.W.: 520.61 |
| |
QL010101 | (E)-Latanoprostene Bunod CAS# 2099033-66-4 M.F.: C27H41NO8 M.W.: 507.62 |
| |
QM161852 | Metoprolol Impurity 52 CAS# NA M.F.: C12H19NO3 M.W.: 225.29 |
| |
QM030501 | N-Nitroso Meclofenamic acid CAS# NA M.F.: C14H10Cl2N2O3 M.W.: 325.15 |
| |
QM030500 | Meclofenamic acid CAS# 644-62-2 M.F.: C14H11Cl2NO2 M.W.: 296.15 |
| |
QP1824113 | Parecoxib Sodium Impurity 113 CAS# 2242749-02-4 M.F.: C19H18N2O4S M.W.: 370.42 |
| |
QM201850 | Metaraminol Impurity 50 CAS# NA M.F.: C13H17NO7 M.W.: 299.28 |
| |
QR052004 | 3,4-Didehydroretinoic acid CAS# 4159-20-0 M.F.: C20H26O2 M.W.: 298.43 |
| |
QI210102 | Ivacaftor Nitroso Impurity 2 CAS# NA M.F.: C24H27N3O4 M.W.: 421.50 |
| |
QB180809 | Brompheniramine maleate Impurity 9 CAS# NA M.F.: C16H19BrN2O2 M.W.: 351.24 |
| |
QB180808 | Brompheniramine maleate Impurity 8 CAS# NA M.F.: C16H19BrN2O M.W.: 335.25 |
| |
QT081303 | 11-Dehydro Thromboxane B2 CAS# 67910-12-7 M.F.: C20H32O6 M.W.: 368.47 |
| |
QI142515 | Indocyanine Green Impurity 15 CAS# NA M.F.: C24H26NNaO4S M.W.: 447.52 |
| |
QI142514 | Indocyanine Green Impurity 14 CAS# NA M.F.: C86H92N4Na2O12S4 M.W.: 1547.92 |
| |
QI142513 | Indocyanine Green Impurity 13 CAS# NA M.F.: C30H32N2O3S M.W.: 500.66 |
| |
QU121609 | N-Nitroso N-Desmethyl Ulipristal Acetate CAS# NA M.F.: C29H34N2O5 M.W.: 490.60 |
| |
QI142512 | Indocyanine Green Impurity 12 CAS# 17432-66-5 M.F.: C11H11NO M.W.: 173.22 |
| |
QP010402 | N-Nitroso N-Desmethyl Padimate O CAS# NA M.F.: C16H24N2O3 M.W.: 292.38 |
| |
QO181459 | Ornidazole Impurity 59 CAS# 13551-86-5 M.F.: C6H8ClN3O3 M.W.: 205.60 |
| |
QM182504 | Maropitant Citrate Impurity 4 CAS# 142035-23-2 M.F.: C20H24N2 M.W.: 292.43 |
| |
QM182503 | Maropitant Citrate Impurity 3 CAS# 155681-48-4 M.F.: C27H30N2 M.W.: 382.55 |
| |
QM200516 | N-Nitroso N-Desmethyl Methylene Blue CAS# NA M.F.: C15H15ClN4OS M.W.: 334.82 |
| |
QM013301 | N-Nitroso N-Desmethyl Maralixibat chloride CAS# NA M.F.: C39H53ClN4O5S M.W.: 725.39 |
| |
QM013300 | Maralixibat chloride CAS# 228113-66-4 M.F.: C40H56ClN3O4S M.W.: 710.42 |
| |
QE182059 | N-Nitroso N-Desmethyl Erythromycin Ethylsuccinate CAS# NA M.F.: C42H72N2O17 M.W.: 877.04 |
| |
QD0207105 | N-Nitroso Dabigatran Etexilate CAS# NA M.F.: C34H40N8O6 M.W.: 656.74 |
| |
QB054701 | Berotralstat Nitroso Impurity 1 CAS# NA M.F.: C30H25F4N7O2 M.W.: 591.57 |
| |
QP051706 | Pentamidine diisetionate Impurity 6 CAS# NA M.F.: C19H22N2O4 M.W.: 342.40 |
| |
QP051705 | Pentamidine diisetionate Impurity 5 CAS# NA M.F.: C21H26N2O4 M.W.: 370.45 |
| |
QP051704 | Pentamidine diisetionate Impurity 4 CAS# 1252-44-4 M.F.: C23H30N2O4 M.W.: 398.50 |
| |
QP051703 | Pentamidine diisetionate Impurity 3 CAS# 7467-71-2 M.F.: C19H18N2O2 M.W.: 306.37 |
| |
QP051702 | Pentamidine diisetionate Impurity 2 CAS# 91945-01-6 M.F.: C12H14BrNO M.W.: 268.15 |
| |
QP120207 | Polymyxin B Sulfate CAS# 1405-20-5 M.F.: C56H98N16O13.H2O4S M.W.: 1203.50 36.46 |
| |
QB200111 | Betamethasone Dipropionate Impurity 11 CAS# NA M.F.: C28H37FO7 M.W.: 504.60 |
| |
QP156701 | Poricoic acid A CAS# 137551-38-3 M.F.: C31H46O5 M.W.: 498.70 |
| |
QA260507 | Azelnidipine Impurity 7 CAS# NA M.F.: C33H34N4O7 M.W.: 598.66 |
| |
QF181958 | Furosemide Impurity 58 CAS# 4818-85-3 M.F.: C12H12N2O5S M.W.: 296.30 |
| |
QG042424 | Gadoxetate Disodium Impurity 24 CAS# NA M.F.: C21H26GdN3O8 M.W.: 605.70 |
| |
QG042423 | Gadoxetate Disodium Impurity 23 CAS# NA M.F.: C21H26GdN3O8 M.W.: 605.70 |
| |
QM142425 | Minoxidil Impurity 25 CAS# 1637646-87-7 M.F.: C5H11NO2 M.W.: 117.15 |
| |
QT260433 | Trazodone hydrochloride Impurity 33 CAS# NA M.F.: C40H46Cl2N10O2 M.W.: 769.78 |
| |
QF121946 | Fulvestrant Impurity 46 CAS# 96045-13-5 M.F.: C14H31BrOSi M.W.: 323.39 |
| |
QV3077131 | Vitamin K1 Impurity 131 CAS# NA M.F.: C31H46O3 M.W.: 466.71 |
| |
QV200109 | all-trans-Retinyl Stearate CAS# 631-87-8 M.F.: C38H64O2 M.W.: 552.93 |
| |
QM092218 | Mivacurium chloride Impurity 18 CAS# NA M.F.: C25H36ClNO6 M.W.: 482.01 |
| |
QV3077130 | Vitamin K1 Impurity 130 CAS# 102608-53-7 M.F.: C20H40O M.W.: 296.54 |
| |
QT142600 | Tanshinone IIA CAS# 568-72-9 M.F.: C19H18O3 M.W.: 294.35 |
| |
QS041924 | Sodium Valproate Impurity 24 CAS# 6967-47-1 M.F.: C8H13NO2 M.W.: 155.20 |
| |
QC042043 | Cefditoren pivoxil Impurity 43 CAS# NA M.F.: C25H28N6O8S3 M.W.: 636.71 |
| |
QP090336 | Sodium Picosulfate Impurity 36 CAS# NA M.F.: C19H15NNa2O8S2 M.W.: 495.43 |
| |
QC061620 | Cefpodoxime Proxetil Impurity 20 CAS# NA M.F.: C44H56N10O18S4 M.W.: 1141.22 |
| |
QP132619 | Promethazine Nitroso Impurity 1 CAS# NA M.F.: C3H7NO2 M.W.: 89.09 |
| |
QV3077129 | Vitamin K1 Impurity 129 CAS# NA M.F.: C31H44O2 M.W.: 448.69 |
| |
QV3077128 | Vitamin K1 Impurity 128 CAS# NA M.F.: C31H44O2 M.W.: 448.69 |
| |
QC061874 | Cefuroxime sodium Impurity 74 CAS# NA M.F.: C16H18N4O9S M.W.: 442.40 |
| |
QN151875 | Noradrenaline (Norepinephrine) Impurity 75 CAS# NA M.F.: C16H19NO6 M.W.: 321.33 |
| |
QN151874 | Noradrenaline (Norepinephrine) Impurity 74 CAS# NA M.F.: C16H19NO6 M.W.: 321.33 |
| |
QN151873 | Noradrenaline (Norepinephrine) Impurity 73 CAS# NA M.F.: C16H15NO6 M.W.: 317.30 |
| |
QN151872 | Noradrenaline (Norepinephrine) Impurity 72 CAS# NA M.F.: C16H15NO6 M.W.: 317.30 |
| |
QF061336 | Fosfomycin Trometamol Impurity 36 CAS# NA M.F.: C7H15O4P M.W.: 194.17 |
| |
QF061335 | Fosfomycin Trometamol Impurity 35 CAS# NA M.F.: C3H6ClO3P M.W.: 156.5 |
| |
QP093300 | Pipecuronium Bromide CAS# 52212-02-9 M.F.: C35H62Br2N4O4 M.W.: 762.71 |
| |
QB053225 | Beraprost Impurity 25 CAS# NA M.F.: C24H29NaO5 M.W.: 420.48 |
| |
QF061334 | Fosfomycin Trometamol Impurity 34 CAS# NA M.F.: C5H11O4P M.W.: 166.11 |
| |
QF061333 | Fosfomycin Trometamol Impurity 33 CAS# 433979-70-5 M.F.: C6H7O4P M.W.: 174.09 |
| |
QF061332 | Fosfomycin Trometamol Impurity 32 CAS# 1416734-33-2 M.F.: C6H14O8P2 M.W.: 276.12 |
| |
QF061331 | Fosfomycin Trometamol Impurity 31 CAS# NA M.F.: C3H6ClO3P M.W.: 156.50 |
| |
QF061330 | Fosfomycin Trometamol Impurity 30 CAS# NA M.F.: C6H7O3P M.W.: 158.09 |
| |
QV3077127 | Vitamin K1 Impurity 127 CAS# NA M.F.: C20H40 M.W.: 280.54 |
| |
QV3077126 | Vitamin K1 Impurity 126 CAS# NA M.F.: C20H40 M.W.: 280.54 |
| |
QF061329 | Fosfomycin Trometamol Impurity 29 CAS# NA M.F.: C3H5O3P M.W.: 120.04 |
| |
QF061328 | Fosfomycin Trometamol Impurity 28 CAS# 55343-62-9 M.F.: C3H5O4P M.W.: 136.04 |
| |
QF061327 | Fosfomycin Trometamol Impurity 27 CAS# NA M.F.: C11H18NO4P M.W.: 259.24 |
| |
QM150925 | Morinidazole Impurity 25 CAS# NA M.F.: C15H25N5O4 M.W.: 339.40 |
| |
QE191347 | Esmolol Impurity 47 CAS# NA M.F.: C16H14O5 M.W.: 286.28 |
| |
QE191346 | Esmolol Impurity 46 CAS# 69098-04-0 M.F.: C9H10O4 M.W.: 182.18 |
| |
QB191635 | Bisoprolol Impurity 35 CAS# NA M.F.: C10H12O3 M.W.: 180.20 |
| |
QP092718 | Pinaverium Bromide Impurity 18 CAS# NA M.F.: C9H9Br3O2 M.W.: 388.88 |
| |
QA190215 | 6-O-Acetylascorbic acid CAS# 20229-76-9 M.F.: C8H10O7 M.W.: 218.16 |
| |
QM131932 | Mometasone Furoate Impurity 32 CAS# NA M.F.: C32H32Cl2O8 M.W.: 615.50 |
| |
QC031642 | Cefcapene pivoxil Impurity 42 CAS# NA M.F.: C27H37N5O8S2 M.W.: 623.74 |
| |
QO120501 | Oleanolic acid 3-acetate CAS# 4339-72-4 M.F.: C32H50O4 M.W.: 498.75 |
| |
QA130253 | Ambroxol Impurity 53 CAS# NA M.F.: C7H5Br2NO M.W.: 278.93 |
| |
QT142429 | Tranexamic Acid Impurity 29 CAS# 23358-95-4 M.F.: C16H22O6 M.W.: 310.35 |
| |
QH150923 | Hyoscine Butylbromide Impurity 23 CAS# NA M.F.: C19H25NO4 M.W.: 331.41 |
| |
QA200376 | Cisatracurium Besylate Impurity 76 CAS# 1075727-00-2 M.F.: C34H45NO9S M.W.: 643.79 |
| |
QA200375 | Cisatracurium Besylate Impurity 75 CAS# NA M.F.: C32H41NO9S M.W.: 615.74 |
| |
QT260432 | Trazodone hydrochloride Impurity 32 CAS# 1781591-94-3 M.F.: C6H4ClN3O M.W.: 169.57 |
| |
QT260431 | Trazodone hydrochloride Impurity 31 CAS# 333988-45-7 M.F.: C9H11Cl2N.HCl M.W.: 204.09 36.46 |
| |
QA031616 | Acipimox Impurity 16 CAS# 6890-38-6 M.F.: C6H8N2O2 M.W.: 140.14 |
| |
QM092217 | Mivacurium chloride Impurity 17 CAS# NA M.F.: C61H86Cl2N2O15 M.W.: 1158.26 |
| |
QC-C121541 | Coenzyme A CAS# 85-61-0 M.F.: C21H36N7O16P3S M.W.: 767.53 |
| |
QM161850 | Metoprolol Impurity 50 CAS# NA M.F.: C15H23NO2 M.W.: 249.35 |
| |
QB030509 | 7,10-Bis[O-(triethylsilyl)]-10-deacetyl Baccatin III CAS# 149107-84-6 M.F.: C41H64O10Si2 M.W.: 773.12 |
| |
QI040167 | Indacaterol Impurity 67 CAS# NA M.F.: C13H14F3NO M.W.: 257.26 |
| |
QB050430 | Bedaquiline Fumarate Impurity 30 CAS# NA M.F.: C28H20BrNO2 M.W.: 482.38 |
| |
QD150307 | Docusate sodium Impurity 7 CAS# NA M.F.: C12H21NaO7S M.W.: 332.34 |
| |
QD150306 | Docusate sodium Impurity 6 CAS# 29454-16-8 M.F.: C4H5NaO7S M.W.: 220.13 |
| |
QB030508 | Baccatin III Impurity 8 CAS# NA M.F.: C79H76N2O18 M.W.: 1341.47 |
| |
QB030507 | Baccatin III Impurity 7 CAS# NA M.F.: C35H42O13 M.W.: 670.71 |
| |
QB030506 | Baccatin III Impurity 6 CAS# NA M.F.: C39H54O12Si M.W.: 742.93 |
| |
QB030505 | Baccatin III Impurity 5 CAS# NA M.F.: C43H66O11Si2 M.W.: 815.16 |
| |
QB030504 | Baccatin III Impurity 4 CAS# NA M.F.: C39H54O12Si M.W.: 742.93 |
| |
QB030503 | 7,10,13-tris(triethylsilyl)-10-deacetylbaccatin III CAS# 194720-19-9 M.F.: C47H78O10Si3 M.W.: 887.39 |
| |
QO1920149 | Oseltamivir Impurity 149 CAS# NA M.F.: C25H42N2O4 M.W.: 434.62 |
| |
QT691559 | Testosterone Undecanoate Impurity 59 CAS# NA M.F.: C30H46O3 M.W.: 454.70 |
| |
QE192701 | Estetrol Impurity 1 CAS# 1426679-35-7 M.F.: C25H30O4 M.W.: 394.51 |
| |
QB051334 | Bempedoic acid Impurity 34 CAS# NA M.F.: C10H18O3 M.W.: 186.25 |
| |
QB051333 | Bempedoic acid Impurity 33 CAS# NA M.F.: C13H26O3 M.W.: 230.35 |
| |
QC132675 | Cefmetazole sodium Impurity 75 CAS# NA M.F.: C15H17N7O6S3 M.W.: 487.52 |
| |
QC132674 | Cefmetazole sodium Impurity 74 CAS# NA M.F.: C14H15N7O5S3 M.W.: 457.50 |
| |
QF030344 | Famciclovir Impurity 44 CAS# NA M.F.: C14H19N5O5 M.W.: 337.34 |
| |
QM201849 | Metaraminol Impurity 49 CAS# NA M.F.: C15H22ClNO3 M.W.: 299.80 |
| |
QA182301 | Artemisinic Aldehyde CAS# 125276-60-0 M.F.: C15H22O M.W.: 218.34 |
| |
QM050111 | Metamizole sodium Impurity 11 CAS# NA M.F.: C13H15N3O M.W.: 229.28 |
| |
QO240122 | Oxacillin sodium Impurity 22 CAS# 91059-01-7 M.F.: C11H7Cl2NO2 M.W.: 256.08 |
| |
QO240121 | Oxacillin sodium Impurity 21 CAS# 1598387-74-6 M.F.: C11H7Cl2NO2 M.W.: 256.08 |
| |
QO240120 | Oxacillin sodium Impurity 20 CAS# NA M.F.: C11H7Cl2NO2 M.W.: 256.08 |
| |
QO240119 | Oxacillin sodium Impurity 19 CAS# 1143-82-4 M.F.: C13H13NO3 M.W.: 231.25 |
| |
QS041923 | Sodium Valproate Impurity 23 CAS# 1085698-06-1 M.F.: C11H20O4 M.W.: 216.28 |
| |
QD171213 | Dequalinium chloride Impurity 13 CAS# NA M.F.: C20H30Cl2N2 M.W.: 369.37 |
| |
QD171212 | Dequalinium chloride Impurity 12 CAS# 77726-78-4 M.F.: C10H12N2O M.W.: 176.22 |
| |
QC081350 | Calcitriol Impurity 50 CAS# NA M.F.: C27H44O3 M.W.: 416.65 |
| |
QA161893 | Aprepitant Impurity 93 CAS# NA M.F.: C20H18F7NO2 M.W.: 437.36 |
| |
QG124602 | Glycine Nitroso Impurity 2 CAS# 25081-31-6 M.F.: C4H6N2O5 M.W.: 162.10 |
| |
QT211203 | Tulathromycin A Impurity 3 CAS# NA M.F.: C41H81N3O13 M.W.: 824.11 |
| |
QA163046 | Apremilast Impurity 46 CAS# NA M.F.: C12H17NO4S M.W.: 271.33 |
| |
QP092717 | Pinaverium Bromide Impurity 17 CAS# NA M.F.: C26H41Br2NO4 M.W.: 591.43 |
| |
QM050110 | Metamizole sodium Impurity 10 CAS# NA M.F.: C12H15N3O2 M.W.: 233.27 |
| |
QM050109 | Metamizole sodium Nitroso Impurity 2 CAS# NA M.F.: C12H14N4O5S M.W.: 326.33 |
| |
QM050108 | Metamizole sodium Impurity 8 CAS# 62902-13-0 M.F.: C13H17N3O2 M.W.: 247.30 |
| |
QU190452 | Ursodeoxycholic Acid Impurity 52 CAS# 73465-45-9 M.F.: C25H42O4 M.W.: 406.61 |
| |
QP081866 | Phloroglucinol Impurity 66 CAS# NA M.F.: C18H14O9 M.W.: 374.30 |
| |
QA030613 | N-Nitroso Aceclofenac CAS# NA M.F.: C16H12Cl2N2O5 M.W.: 383.18 |
| |
QF151500 | Fospropofol disodium CAS# 258516-87-9;258516-89-1(free acid) M.F.: C13H19Na2O5P M.W.: 332.24 |
| |
QD150228 | Dobutamine Impurity 28 CAS# NA M.F.: C16H21NO4 M.W.: 291.35 |
| |
QD150227 | Dobutamine Impurity 27 CAS# NA M.F.: C18H23NO4 M.W.: 317.39 |
| |
QC013700 | Catharanthine sulfate CAS# 70674-90-7 M.F.: C21H24N2O2.H2O4S M.W.: 336.44 98.07 |
| |
QP090335 | Sodium Picosulfate Impurity 35 CAS# NA M.F.: C30H24N2O3 M.W.: 460.53 |
| |
QG211208 | Sodium Gualenate Impurity 8 CAS# NA M.F.: C15H16O2 M.W.: 228.29 |
| |
QG211207 | Sodium Gualenate Impurity 7 CAS# NA M.F.: C15H16O M.W.: 212.29 |
| |
QG211206 | Sodium Gualenate Impurity 6 CAS# NA M.F.: C15H17NaO3S M.W.: 300.35 |
| |
QC031641 | Cefcapene pivoxil Impurity 41 CAS# NA M.F.: C55H61N13O16S6 M.W.: 1352.53 |
| |
QC031640 | Cefcapene pivoxil Impurity 40 CAS# NA M.F.: C16H18N4O5S2 M.W.: 410.46 |
| |
QE160512 | Eperisone Impurity 12 CAS# NA M.F.: C19H29NO.HCl M.W.: 287.45 36.46 |
| |
QF090533 | Finerenone Impurity 33 CAS# NA M.F.: C26H23N3O4 M.W.: 441.49 |
| |
QU160116 | Upadacitinib Impurity 16 CAS# NA M.F.: C29H29N5O4S M.W.: 543.64 |
| |
QZ121631 | Zolpidem tartrate Impurity 31 CAS# 258273-50-6 M.F.: C18H18N2O2 M.W.: 294.35 |
| |
QZ121630 | Zolpidem tartrate Impurity 30 CAS# NA M.F.: C18H18N2O3 M.W.: 310.35 |
| |
QB141700 | Benztropine Mesylate CAS# 132-17-2 M.F.: C21H25NO.CH4O3S M.W.: 307.44 96.10 |
| |
QB050429 | Bedaquiline Fumarate Impurity 29 CAS# NA M.F.: C32H31BrN2O3 M.W.: 571.52 |
| |
QU181201 | Urolithin A CAS# 1143-70-0 M.F.: C13H8O4 M.W.: 228.20 |
| |
QK200321 | Ketoconazole Impurity 21 CAS# 29098-85-9 M.F.: C12H7Cl3O2 M.W.: 289.54 |
| |
QH040325 | Hydrocortisone Impurity 25 CAS# NA M.F.: C25H36O7 M.W.: 448.56 |
| |
QR457053 | Rocuronium bromide Impurity 53 CAS# NA M.F.: C23H39NO3 M.W.: 377.57 |
| |
QR457052 | Rocuronium bromide Impurity 52 CAS# NA M.F.: C32H52N2O4 M.W.: 528.78 |
| |
QR457051 | Rocuronium bromide Impurity 51 CAS# NA M.F.: C32H53BrN2O4 M.W.: 609.69 |
| |
QR457050 | Rocuronium bromide Impurity 50 CAS# NA M.F.: C32H51BrN2O3 M.W.: 591.68 |
| |
QR457049 | Rocuronium bromide Impurity 49 CAS# NA M.F.: C32H51BrN2O3 M.W.: 591.68 |
| |
QD152613 | 7-ketodeoxycholic acid CAS# 911-40-0 M.F.: C24H38O5 M.W.: 406.56 |
| |
QC061450 | Cefdinir Impurity 50 CAS# NA M.F.: C42H39N15O15S6 M.W.: 1186.22 |
| |
QR182484 | Brexpiprazole Impurity 84 CAS# 2190474-85-0 M.F.: C50H54N6O4S2 M.W.: 867.14 |
| |
QF051300 | Fenoldopam Mesylate CAS# 67227-57-0;67227-56-9(free base) M.F.: C16H16ClNO3.CH4O3S M.W.: 305.76 96.10 |
| |
QC052009 | Cetrorelix Impurity 9 CAS# NA M.F.: C64H80ClN13O13 M.W.: 1274.87 |
| |
QL091687 | Lipoic Acid Impurity 87 CAS# NA M.F.: C8H14O3S2 M.W.: 222.32 |
| |
QV3077125 | Vitamin K1 Impurity 125 CAS# NA M.F.: C31H46O3 M.W.: 466.71 |
| |
QR190800 | Ro 19-8022 CAS# 104604-66-2 M.F.: C25H21ClN2O3 M.W.: 432.90 |
| |
QC0303142 | Cinacalcet Impurity 142 CAS# 27557-86-4 M.F.: C13H15N M.W.: 185.27 |
| |
QM092216 | Mivacurium chloride Impurity 16 CAS# NA M.F.: C36H51Cl2NO9 M.W.: 712.70 |
| |
QM092215 | Mivacurium chloride Impurity 15 CAS# 104758-49-8 M.F.: C22H29NO5 M.W.: 387.48 |
| |
QM092214 | Mivacurium chloride Impurity 14 CAS# NA M.F.: C14H22Cl2O4 M.W.: 325.23 |
| |
QM092213 | Mivacurium chloride Impurity 13 CAS# 48059-97-8 M.F.: C8H12O4 M.W.: 172.18 |
| |
QI142510 | Indocyanine Green Impurity 10 CAS# 52568-84-0 M.F.: C15H15N M.W.: 209.29 |
| |
QI142511 | Indocyanine Green Impurity 11 CAS# NA M.F.: C43H47N2NaO6S2 M.W.: 774.97 |
| |
QI142509 | Indocyanine Green Impurity 9 CAS# 20893-80-5 M.F.: C10H7ClN2 M.W.: 190.63 |
| |
QN162446 | (+/-)-Naproxen D3 CAS# 958293-79-3 M.F.: C14H11D3O3 M.W.: 233.28 |
| |
QF121613 | Flupentixol Impurity 13 CAS# NA M.F.: C19H20F3NO2S M.W.: 383.43 |
| |
QS210309 | Sucrose Octasulfate Octatriethylamine Salt CAS# 869561-07-9 M.F.: C12H22O35S8.8C6H15N M.W.: 982.75 8(101.19) |
| |
QG122546 | Glycopyrrolate-d5 Bromide CAS# NA M.F.: C19H23D5BrNO3 M.W.: 403.37 |
| |
QO240118 | Oxacillin sodium Impurity 18 CAS# NA M.F.: C19H19N3O5S M.W.: 401.44 |
| |
QV051402 | Venetoclax Impurity 2 CAS# 2254393-29-6;1235865-77-6(free base) M.F.: C33H35ClN4O3.HCl M.W.: 571.12 36.46 |
| |
QG121926 | Granisetron Impurity 26 CAS# NA M.F.: C15H11ClN2O2 M.W.: 286.72 |
| |
QT260430 | Trazodone hydrochloride Impurity 30 CAS# NA M.F.: C40H46Cl2N10O2 M.W.: 769.78 |
| |
QP081307 | Phentolamine Mesylate Impurity 7 CAS# NA M.F.: C15H15NO3 M.W.: 257.29 |
| |
QP081306 | Phentolamine Mesylate Impurity 6 CAS# NA M.F.: C18H21N3O3S M.W.: 359.44 |
| |
QO022037 | Obeticholic Acid Impurity 37 CAS# NA M.F.: C30H52O4 M.W.: 476.74 |
| |
QO022036 | Obeticholic Acid Impurity 36 CAS# NA M.F.: C28H48O4 M.W.: 448.69 |
| |
QO022035 | Obeticholic Acid Impurity 35 CAS# 951694-73-8 M.F.: C27H46O4 M.W.: 434.66 |
| |
QC031639 | Cefcapene pivoxil Impurity 39 CAS# NA M.F.: C28H37N5O10S2 M.W.: 667.75 |
| |
QO1920140 | Oseltamivir Impurity 140 CAS# NA M.F.: C22H32N2O9 M.W.: 468.50 |
| |
QC031638 | Cefcapene pivoxil Impurity 38 CAS# NA M.F.: C14H20N2O4S M.W.: 312.38 |
| |
QC031637 | Cefcapene pivoxil Impurity 37 CAS# NA M.F.: C24H31N5O9S2 M.W.: 597.66 |
| |
QC031636 | Cefcapene pivoxil Impurity 36 CAS# NA M.F.: C28H37N5O9S2 M.W.: 651.75 |
| |
QC031635 | Cefcapene pivoxil Impurity 35 CAS# NA M.F.: C22H28N4O6S2 M.W.: 508.61 |
| |
QC031634 | Cefcapene pivoxil Impurity 34 CAS# NA M.F.: C28H37N5O10S2 M.W.: 667.75 |
| |
QC031633 | Cefcapene pivoxil Impurity 33 CAS# NA M.F.: C29H39N5O11S2 M.W.: 697.78 |
| |
QC031632 | Cefcapene pivoxil Impurity 32 CAS# NA M.F.: C33H45N5O11S2 M.W.: 751.87 |
| |
QC031631 | Cefcapene pivoxil Impurity 31 CAS# NA M.F.: C21H24N4O6S2 M.W.: 492.57 |
| |
QC031630 | Cefcapene pivoxil Impurity 30 CAS# NA M.F.: C19H28N2O6S M.W.: 412.50 |
| |
QC031629 | Cefcapene pivoxil Impurity 29 CAS# NA M.F.: C14H20N2O6S M.W.: 344.38 |
| |
QC031628 | Cefcapene pivoxil Impurity 28 CAS# NA M.F.: C27H36N4O9S2 M.W.: 624.72 |
| |
QC031627 | Cefcapene pivoxil Impurity 27 CAS# NA M.F.: C27H36N4O8S2 M.W.: 608.73 |
| |
QC031626 | Cefcapene pivoxil Impurity 26 CAS# NA M.F.: C29H38N4O10S2 M.W.: 666.76 |
| |
QC031625 | Cefcapene pivoxil Impurity 25 CAS# NA M.F.: C29H39N5O10S2 M.W.: 681.78 |
| |
QC031624 | Cefcapene pivoxil Impurity 24 CAS# NA M.F.: C21H26N4O7S2 M.W.: 510.58 |
| |
QC031623 | Cefcapene pivoxil Impurity 23 CAS# NA M.F.: C21H26N4O6S2 M.W.: 494.58 |
| |
QC031622 | Cefcapene pivoxil Impurity 22 CAS# NA M.F.: C23H28N4O8S2 M.W.: 552.62 |
| |
QC031621 | Cefcapene pivoxil Impurity 21 CAS# NA M.F.: C22H27N5O8S2 M.W.: 553.61 |
| |
QC031620 | Cefcapene pivoxil Impurity 20 CAS# NA M.F.: C14H20N2O4S M.W.: 312.38 |
| |
QC031619 | Cefcapene pivoxil Impurity 19 CAS# NA M.F.: C9H12N2O2S M.W.: 212.27 |
| |
QP072051 | Pioglitazone hydrochloride Impurity 51 CAS# NA M.F.: C19H23NO3S M.W.: 345.46 |
| |
QP072050 | Pioglitazone hydrochloride Impurity 50 CAS# NA M.F.: C18H22N2O2S M.W.: 330.45 |
| |
QO240117 | Oxacillin sodium Impurity 17 CAS# NA M.F.: C38H38N6O10S2 M.W.: 802.87 |
| |
QO240116 | Oxacillin sodium Impurity 16 CAS# NA M.F.: C38H40N6O11S2 M.W.: 820.89 |
| |
QO240115 | Oxacillin sodium Impurity 15 CAS# NA M.F.: C38H38N6O10S2 M.W.: 802.87 |
| |
QP092716 | Pinaverium Bromide Impurity 16 CAS# NA M.F.: C12H17BrO3 M.W.: 289.17 |
| |
QP092715 | Pinaverium Bromide Impurity 15 CAS# 3647-69-6;3240-94-6(free base) M.F.: C6H12ClNO.HCl M.W.: 149.62 36.46 |
| |
QP092714 | Pinaverium Bromide Impurity 14 CAS# 4747-61-9 M.F.: C11H20O M.W.: 168.28 |
| |
QP092713 | Pinaverium Bromide Impurity 13 CAS# 54370-01-3 M.F.: C9H10BrClO2 M.W.: 265.53 |
| |
QP092712 | Pinaverium Bromide Impurity 12 CAS# 1185300-68-8 M.F.: C13H20N2O2.2HCl M.W.: 236.32 72.92 |
| |
QD122059 | Dolutegravir Impurity 59 CAS# 2583719-60-0 M.F.: C14H16N2O6 M.W.: 308.29 |
| |
QB050300D | Beclometasone Dipropionate Monohydrate CAS# 77011-63-3 M.F.: C28H37ClO7.H2O M.W.: 521.05 18.02 |
| |
QF121705 | Flumetasone pivalate Impurity 5 CAS# NA M.F.: C27H36F2O6 M.W.: 494.58 |
| |
QF211505 | Fluocortolone pivalate Impurity 5 CAS# NA M.F.: C27H37FO5 M.W.: 460.59 |
| |
QH150922 | Hyoscine Butylbromide Impurity 22 CAS# NA M.F.: C12H22BrNO2 M.W.: 292.22 |
| |
QH150921 | Hyoscine Butylbromide Impurity 21 CAS# NA M.F.: C12H22BrNO2 M.W.: 292.22 |
| |
QV3077123 | Vitamin K1 Impurity 123 CAS# 25486-55-9 M.F.: C31H46O3 M.W.: 466.71 |
| |
QC061873 | Cefuroxime sodium Impurity 73 CAS# 84522-17-8 M.F.: C6H5NO3 M.W.: 139.11 |
| |
QU190451 | 7β-Hydroxy-5β-cholanoic Acid CAS# 10601-78-2 M.F.: C24H40O3 M.W.: 376.58 |
| |
QC061872 | Cefuroxime sodium Impurity 72 CAS# NA M.F.: C15H13N3O8S M.W.: 395.34 |
| |
QN051521 | Neostigmine bromide Impurity 21 CAS# NA M.F.: C26H33N3O3 M.W.: 435.57 |
| |
QN051520 | Neostigmine bromide Impurity 20 CAS# 63468-95-1 M.F.: C17H22N2O2 M.W.: 286.38 |
| |
QS213100 | Suplatast Tosylate CAS# 94055-76-2 M.F.: C23H33NO7S2 M.W.: 499.64 |
| |
QL091686 | Lipoic Acid Impurity 86 CAS# NA M.F.: C24H44O6S6 M.W.: 620.97 |
| |
QL091685 | Lipoic Acid Impurity 85 CAS# NA M.F.: C24H44O6S6 M.W.: 620.97 |
| |
QL091684 | Lipoic Acid Impurity 84 CAS# NA M.F.: C16H30O4S4 M.W.: 414.65 |
| |
QR091219 | Riluzole Impurity 19 CAS# NA M.F.: C16H6F6N4O2S2 M.W.: 464.36 |
| |
QC031618 | Cefcapene pivoxil Impurity 18 CAS# NA M.F.: C16H16N4O4S2 M.W.: 392.45 |
| |
QL092601 | Dimethyl lithospermate B CAS# 875313-64-7 M.F.: C38H34O16 M.W.: 746.67 |
| |
QD098400 | Difluocortolone Valerate CAS# 59198-70-8 M.F.: C27H36F2O5 M.W.: 478.58 |
| |
QF012227 | Favipiravir Impurity 27 CAS# 55321-99-8;1237524-82-1(Na salt) M.F.: C5H5N3O2 M.W.: 139.11 |
| |
QC031617 | Cefcapene pivoxil Impurity 17 CAS# 86978-24-7 M.F.: C13H18N2O4S M.W.: 298.36 |
| |
QS150408 | Alendronic Acid Impurity 8 CAS# 457942-40-4 M.F.: C11H13NO4 M.W.: 223.23 |
| |
QS150407 | Alendronic Acid Impurity 7 CAS# NA M.F.: C11H17NO9P2 M.W.: 369.20 |
| |
QS150406 | Alendronic Acid Impurity 6 CAS# NA M.F.: C12H19NO9P2 M.W.: 383.23 |
| |
QS150405 | Alendronic Acid Impurity 5 CAS# NA M.F.: C14H23NO9P2 M.W.: 411.28 |
| |
QA190214 | Ascorbic Acid 3-Sulfate CAS# 22430-27-9 M.F.: C6H8O9S M.W.: 256.18 |
| |
QA555935 | Adenosine 3'-monophosphate CAS# 84-21-9 M.F.: C10H14N5O7P M.W.: 347.22 |
| |
QA130509 | Aminolevulinic Acid Impurity 9 CAS# NA M.F.: C12H16N2O4 M.W.: 252.27 |
| |
QA130508 | Aminolevulinic Acid Impurity 8 CAS# NA M.F.: C11H14N2O4 M.W.: 238.24 |
| |
QA130507 | Aminolevulinic Acid Impurity 7 CAS# NA M.F.: C15H18N2O7 M.W.: 338.32 |
| |
QA130506 | Aminolevulinic Acid Impurity 6 CAS# 56766-77-9 M.F.: C6H10O4 M.W.: 146.14 |
| |
QA130505 | Aminolevulinic Acid Impurity 5 CAS# NA M.F.: C10H16N2O5 M.W.: 244.25 |
| |
QV011233 | Valproic acid-d15 CAS# 362049-65-8 M.F.: C8HD15O2 M.W.: 159.31 |
| |
QI191659 | Isoproterenol Impurity 59 CAS# NA M.F.: C11H11NO3 M.W.: 205.21 |
| |
QC031616 | Cefcapene pivoxil Impurity 16 CAS# 118109-49-2 M.F.: C8H10N2O2S M.W.: 198.24 |
| |
QC031615 | Cefcapene pivoxil Impurity 15 CAS# 159860-40-9 M.F.: C13H18N2O4S M.W.: 298.36 |
| |
QP092711 | Pinaverium Bromide Impurity 11 CAS# NA M.F.: C26H41Br2NO4 M.W.: 591.43 |
| |
QC042042 | Cefditoren pivoxil Impurity 42 CAS# NA M.F.: C31H40N6O10S3 M.W.: 752.87 |
| |
QP181924 | Prasugrel Impurity X CAS# 1373350-57-2 M.F.: C11H11Br2FO M.W.: 338.01 |
| |
QD098200 | Diffractaic acid CAS# 436-32-8 M.F.: C20H22O7 M.W.: 374.39 |
| |
QB052522 | Benzylpenicillin sodium Impurity 22 CAS# NA M.F.: C32H36N4O8S2 M.W.: 668.78 |
| |
QB053218 | Beraprost Impurity 18 CAS# 132203-90-8 M.F.: C17H22O5 M.W.: 306.36 |
| |
QV3077122 | Vitamin K1 Impurity 122 CAS# NA M.F.: C31H46O2 M.W.: 450.71 |
| |
QV3077121 | Vitamin K1 Impurity 121 CAS# NA M.F.: C31H46O2 M.W.: 450.71 |
| |
QV3077120 | Vitamin K1 Impurity 120 CAS# NA M.F.: C31H46O2 M.W.: 450.71 |
| |
QV3077119 | Vitamin K1 Impurity 119 CAS# 132487-93-5 M.F.: C31H46O2 M.W.: 450.71 |
| |
QV3077118 | Vitamin K1 Impurity 118 CAS# 132487-94-6 M.F.: C31H46O2 M.W.: 450.71 |
| |
QV3077117 | Vitamin K1 Impurity 117 CAS# 132487-95-7 M.F.: C31H46O2 M.W.: 450.71 |
| |
QB011534 | Baloxavir Impurity 34 CAS# NA M.F.: C27H23F2N3O7S M.W.: 571.55 |
| |
QO240114 | Oxacillin sodium Impurity 14 CAS# NA M.F.: C19H19N3O5S M.W.: 401.44 |
| |
QF052004 | Fenticonazole nitrate EP Impurity D CAS# NA M.F.: C24H21Cl2N3O4S M.W.: 518.41 |
| |
QM182502 | Maropitant Citrate Impurity 2 CAS# NA M.F.: C32H40N2O M.W.: 468.69 |
| |
QP090334 | Sodium Picosulfate Impurity 34 CAS# 2563-78-2 M.F.: C12H10N2O2 M.W.: 214.22 |
| |
QV3077115 | Vitamin K1 Impurity 115 CAS# 1637238-61-9 M.F.: C20H39Br M.W.: 359.44 |
| |
QV3077114 | Vitamin K1 Impurity 114 CAS# NA M.F.: C21H20O2 M.W.: 304.39 |
| |
QV3077113 | Vitamin K1 Impurity 113 CAS# 108977-34-0 M.F.: C20H18O2 M.W.: 290.36 |
| |
QV3077112 | Vitamin K1 Impurity 112 CAS# 943232-38-0 M.F.: C20H39Br M.W.: 359.44 |
| |
QB051332 | Bempedoic acid Impurity 5-d4 CAS# 2408132-01-2 M.F.: C19H30D4O5 M.W.: 346.50 |
| |
QC016600 | Carotegrast methyl CAS# 401905-67-7 M.F.: C28H26Cl2N4O5 M.W.: 569.44 |
| |
QB051331 | Bempedoic acid-d4 CAS# 2408131-70-2 M.F.: C19H32D4O5 M.W.: 348.52 |
| |
QT031892 | Vitamin E Impurity 92 CAS# NA M.F.: C31H52O3 M.W.: 472.75 |
| |
QM050107 | Metamizole sodium Impurity 7 CAS# NA M.F.: C13H17N3O7S2 M.W.: 391.41 |
| |
QO022034 | Obeticholic Acid Impurity 34 CAS# 1516887-34-5 M.F.: C26H40O4 M.W.: 416.60 |
| |
QP181265 | Prucalopride Impurity 65 CAS# NA M.F.: C16H14Cl2N2O6 M.W.: 401.20 |
| |
QT180508 | Trametinib Impurity 8 CAS# 871701-87-0 M.F.: C24H21FIN5O3 M.W.: 573.37 |
| |
QC131434 | Cefminox Sodium Impurity 34 CAS# NA M.F.: C12H12Cl2N6O4S2 M.W.: 439.29 |
| |
QV3077111 | Vitamin B6 Impurity 111 CAS# 765235-25-4 M.F.: C10H15NO3 M.W.: 197.23 |
| |
QO200910 | Otilonium Bromide Impurity 10 CAS# NA M.F.: C33H51BrN2O4 M.W.: 619.69 |
| |
QO200909 | Otilonium Bromide Impurity 9 CAS# NA M.F.: C32H49BrN2O4 M.W.: 605.66 |
| |
QO200908 | Otilonium Bromide Impurity 8 CAS# NA M.F.: C31H47BrN2O4 M.W.: 591.63 |
| |
QO200907 | Otilonium Bromide Impurity 7 CAS# NA M.F.: C30H45BrN2O4 M.W.: 577.60 |
| |
QO200906 | Otilonium Bromide Impurity 6 CAS# 49557-33-7 M.F.: C28H41BrN2O4 M.W.: 549.55 |
| |
QO200905 | Otilonium Bromide Impurity 5 CAS# NA M.F.: C27H39BrN2O4 M.W.: 535.52 |
| |
QO200904 | Otilonium Bromide Impurity 4 CAS# NA M.F.: C26H37BrN2O4 M.W.: 521.50 |
| |
QO200903 | Otilonium Bromide Impurity 3 CAS# NA M.F.: C25H35BrN2O4 M.W.: 507.47 |
| |
QO200902 | Otilonium Bromide Impurity 2 CAS# 27830-12-2 M.F.: C15H22O3 M.W.: 250.34 |
| |
QO200901 | Otilonium Bromide Impurity 1 CAS# 51444-79-2 M.F.: C22H27NO4 M.W.: 369.46 |
| |
QE191827 | Estradiol Enantate CAS# 4956-37-0 M.F.: C25H36O3 M.W.: 384.56 |
| |
QF120606 | Flomoxef Impurity 6 CAS# NA M.F.: C27H30F4N8O13S3 M.W.: 846.75 |
| |
QA132457 | Amoxicillin Impurity 57 CAS# NA M.F.: C15H21N3O4S M.W.: 339.41 |
| |
QO032808 | Octreotide EP Impurity I;N2.1-acetyloctreotide CAS# NA M.F.: C51H68N10O11S2 M.W.: 1061.28 |
| |
QI242625 | MLN-9708 CAS# 1201902-80-8 M.F.: C20H23BCl2N2O9 M.W.: 517.12 |
| |
QB011529 | Baloxavir Impurity 29 CAS# NA M.F.: C26H19F2N3O8S M.W.: 571.51 |
| |
QB031811 | Bromocriptine mesilate Impurity 11 CAS# NA M.F.: C33H42BrN5O5 M.W.: 668.63 |
| |
QB031810 | Bromocriptine mesilate Impurity 10 CAS# NA M.F.: C64H79BrN10O10 M.W.: 1228.30 |
| |
QB031809 | Bromocriptine mesilate Impurity 9 CAS# NA M.F.: C32H40ClN5O5 M.W.: 610.15 |
| |
QS0102133 | Salbutamol Impurity 133 CAS# NA M.F.: C9H7BrO3 M.W.: 243.06 |
| |
QD053702 | anti-Dechlorane Plus CAS# 135821-74-8 M.F.: C18H12Cl12 M.W.: 653.69 |
| |
QD053701 | syn-Dechlorane Plus CAS# 135821-03-3 M.F.: C18H12Cl12 M.W.: 653.69 |
| |
QD053700 | Dechlorane Plus CAS# 13560-89-9 M.F.: C18H12Cl12 M.W.: 653.69 |
| |
QC121924 | Cilastatin EP Impurity G(epimer 2) CAS# NA M.F.: C16H26N2O5S M.W.: 358.45 |
| |
QG040501 | Gadobenate Dimeglumine Impurity 1 CAS# NA M.F.: C12H19N3O7 M.W.: 317.30 |
| |
QF132047 | Formoterol Impurity 47 CAS# 871266-45-4 M.F.: C15H12ClNO4 M.W.: 305.71 |
| |
QC191701 | Cisplatin EP Impurity A CAS# 14913-33-8 M.F.: Cl2H6N2Pt M.W.: 300.05 |
| |
QD151915 | Calcium Dobesilate Impurity 15 CAS# 609-46-1 M.F.: C6H6O4S M.W.: 174.17 |
| |
QD151914 | Calcium Dobesilate Impurity 14 CAS# 35857-70-6;2446301-91-1(diethylamine salt) M.F.: C6H6O5S M.W.: 190.17 |
| |
QD151913 | Calcium Dobesilate Impurity 13 CAS# 17724-11-7;2446301-90-0(Bis-diethylamine salt) M.F.: C6H6O8S2 M.W.: 270.23 |
| |
QD151912 | Calcium Dobesilate Impurity 12 CAS# 81010-88-0 M.F.: C6H6O8S2 M.W.: 270.23 |
| |
QH150920 | Hyoscine Butylbromide Impurity 20 CAS# NA M.F.: C12H22BrNO2 M.W.: 292.22 |
| |
QA164192 | Avanafil Impurity 92 CAS# NA M.F.: C23H30ClN5O4 M.W.: 475.97 |
| |
QC042041 | Cefditoren pivoxil Impurity 41 CAS# NA M.F.: C31H38N6O9S3 M.W.: 734.86 |
| |
QC042040 | Cefditoren pivoxil Impurity 40 CAS# NA M.F.: C31H40N6O10S3 M.W.: 752.87 |
| |
QC042039 | Cefditoren pivoxil Impurity 39 CAS# NA M.F.: C50H56N12O14S6 M.W.: 1241.43 |
| |
QC042038 | Cefditoren pivoxil Impurity 38 CAS# NA M.F.: C25H28N6O7S3 M.W.: 620.71 |
| |
QG042422 | Gadoxetate Disodium Impurity 22 CAS# NA M.F.: C41H69N3O11 M.W.: 780.01 |
| |
QG042421 | Gadoxetate Disodium Impurity 21 CAS# NA M.F.: C37H63N3O9 M.W.: 693.92 |
| |
QG042420 | Gadoxetate Disodium Impurity 20 CAS# NA M.F.: C27H41N3O11 M.W.: 583.64 |
| |
QA201627 | Nortropinone CAS# 5632-84-8 M.F.: C7H11NO M.W.: 125.17 |
| |
QV3077110 | Vitamin K1 Impurity 110 CAS# 85761-30-4 M.F.: C20H42O M.W.: 298.56 |
| |
QV3077109 | Vitamin K1 Impurity 109 CAS# 29171-23-1 M.F.: C20H38O M.W.: 294.52 |
| |
QV3077108 | Vitamin K1 Impurity 108 CAS# NA M.F.: C31H50O2 M.W.: 454.74 |
| |
QV3077107 | Vitamin K1 Impurity 107 CAS# 859974-92-8 M.F.: C19H38O M.W.: 282.51 |
| |
QI142508 | Indocyanine Green Impurity 8 CAS# NA M.F.: C43H48N2O7S2 M.W.: 768.98 |
| |
QI142507 | Indocyanine Green Impurity 7 CAS# NA M.F.: C13H13NO2 M.W.: 215.25 |
| |
QE161255 | Epalrestat Impurity 55 CAS# 149789-77-5 M.F.: C6H7NO3S2 M.W.: 205.25 |
| |
QS012601 | Salvianolic acid Y CAS# 1638738-76-7 M.F.: C36H30O16 M.W.: 718.62 |
| |
QP186000 | Prednienic acid CAS# 37927-29-0 M.F.: C20H26O5 M.W.: 346.42 |
| |
QT151235 | Tolvaptan Impurity 35 CAS# NA M.F.: C18H18N2O2 M.W.: 294.35 |
| |
QT151225 | Tolvaptan Impurity 25 CAS# 54620-98-3 M.F.: C20H21NO5S M.W.: 387.45 |
| |
QB152100 | alpha-Boswellic acid CAS# 471-66-9 M.F.: C30H48O3 M.W.: 456.71 |
| |
QD152612 | Deoxycholic Acid-d5 CAS# 52840-14-9 M.F.: C24H35D5O4 M.W.: 397.61 |
| |
QE201006 | Ethacridine lactate monohydrate Impurity 6 CAS# NA M.F.: C15H13N3O3.HCl M.W.: 283.29 36.46 |
| |
QE201005 | Ethacridine lactate monohydrate Impurity 5 CAS# 20304-69-2 M.F.: C15H11ClN2O3 M.W.: 302.71 |
| |
QD151636 | Dopamine Impurity 36 CAS# 1519015-73-6 M.F.: C20H22N2O6 M.W.: 386.40 |
| |
QR051264 | Relugolix Impurity 64 CAS# NA M.F.: C23H19F2N3O5S M.W.: 487.48 |
| |
QP180522 | Prilocaine Impurity 22 CAS# 780037-66-3;677029-53-7(HCl salt) M.F.: C15H22N2O M.W.: 246.35 |
| |
QP081854 | Phloroglucinol Impurity 54 CAS# NA M.F.: C12H8O8 M.W.: 280.19 |
| |
QG122728 | Glycopyrronium Bromide Impurity 28 CAS# 207856-85-7 M.F.: C18H25NO3 M.W.: 303.40 |
| |
QP1903200 | Posaconazole Impurity 200 CAS# NA M.F.: C13H20N2O3 M.W.: 252.31 |
| |
QD030475 | Diclofenac sodium Impurity 75 CAS# 944251-06-3 M.F.: C14H11Cl2NO3 M.W.: 312.15 |
| |
QG121505 | Glycocholic Acid Impurity 5 CAS# NA M.F.: C30H50N2O7 M.W.: 550.74 |
| |
QV3077106 | Vitamin K1 Impurity 106 CAS# 2211-27-0 M.F.: C13H12O3 M.W.: 216.24 |
| |
QV3077105 | Vitamin K1 Impurity 105 CAS# 15448-59-6 M.F.: C11H8O3 M.W.: 188.18 |
| |
QI091639 | Ipratropium Bromide Impurity 39 CAS# 259092-15-4 M.F.: C10H19NO M.W.: 169.27 |
| |
QF120374 | Folic Acid Impurity 74 CAS# NA M.F.: C31H31N9O10 M.W.: 689.64 |
| |
QF122924 | Fluocinolone acetonide Impurity 24 CAS# NA M.F.: C19H22F2O4 M.W.: 352.38 |
| |
QF122923 | Fluocinolone acetonide Impurity 23 CAS# NA M.F.: C24H28F2O6 M.W.: 450.48 |
| |
QB054400 | Betulonic acid CAS# 4481-62-3 M.F.: C30H46O3 M.W.: 454.70 |
| |
QN090500 | Nifekalant hydrochloride CAS# 130656-51-8 M.F.: C19H27N5O5.HCl M.W.: 405.46 36.46 |
| |
QD030474 | Diclofenac sodium Impurity 74 CAS# NA M.F.: C14H12Cl3N M.W.: 300.61 |
| |
QC061871 | Cefuroxime sodium Impurity 71 CAS# NA M.F.: C14H13N3O7S M.W.: 367.33 |
| |
QD030473 | Diclofenac sodium Impurity 73 CAS# NA M.F.: C14H12Cl3N M.W.: 300.61 |
| |
QC182711 | Sodium Cromoglicate Impurity 11 CAS# 16130-28-2 M.F.: C11H12O4 M.W.: 208.21 |
| |
QL051516 | Calcium levofolinate Impurity 16 CAS# NA M.F.: C20H25CaN7O6 M.W.: 499.54 |
| |
QI190902 | Taurolithocholic acid CAS# 516-90-5 M.F.: C26H45NO5S M.W.: 483.71 |
| |
QI190901 | Tauroursodeoxycholic Acid Impurity 4 CAS# 75808-01-4 M.F.: C26H43NO6S M.W.: 497.69 |
| |
QD0207103 | Dabigatran Etexilate Impurity 103 CAS# NA M.F.: C41H53N7O7 M.W.: 755.92 |
| |
QG120600 | Glatiramer acetate CAS# 147245-92-9 M.F.: C25H45N5O13 M.W.: 623.66 |
| |
QC182710 | Sodium Cromoglicate Impurity 10 CAS# 3361-18-0 M.F.: C11H14O5 M.W.: 226.23 |
| |
QC182709 | Sodium Cromoglicate Impurity 9 CAS# 50521-64-7 M.F.: C12H10O5 M.W.: 234.21 |
| |
QD092500 | Dihydrostreptomycin sulfate CAS# 5490-27-7;128-46-1(free base) M.F.: 2(C21H41N7O12).3(H2SO4) M.W.: 2(583.60) 3(98.07) |
| |
QA161889 | Aprepitant Impurity 89 CAS# NA M.F.: C10H8F6O M.W.: 258.16 |
| |
QR182476 | Brexpiprazole Impurity 76 CAS# 2126178-13-8 M.F.: C20H18N2S2 M.W.: 350.50 |
| |
QH091901 | Histamine Diphosphate CAS# 51-74-1 M.F.: C5H9N3.2H3O4P M.W.: 111.15 195.99 |
| |
QI141400 | Inosinic acid CAS# 131-99-7 M.F.: C10H13N4O8P M.W.: 348.21 |
| |
QC061915 | Ceftaroline Fosamil Impurity O CAS# NA M.F.: C22H20N8O5S4 M.W.: 604.69 |
| |
QL252900 | LY-2940094 tartrate CAS# 1307245-87-9 M.F.: C22H23ClF2N4O2S.C4H6O6 M.W.: 480.96 150.09 |
| |
QC220900 | Cevidoplenib dimesylate CAS# 2043659-93-2 M.F.: C25H27N7O3.2CH4O3S M.W.: 473.54 192.20 |
| |
QD095000 | Didemnin B CAS# 77327-05-0 M.F.: C57H89N7O15 M.W.: 1112.37 |
| |
QN221700 | NVR 3-778 CAS# 1445790-55-5 M.F.: C18H16F4N2O4S M.W.: 432.39 |
| |
QB181800 | Brr2 Inhibitor C9 CAS# 2104030-82-0 M.F.: C24H20N4O3S M.W.: 444.51 |
| |
QG141800 | GnRH antagonist 2 CAS# 1709823-61-9 M.F.: C28H27F2N9O5 M.W.: 607.58 |
| |
QS203100 | STING inhibitor-2 CAS# 2249435-90-1 M.F.: C25H19FN2O4S M.W.: 462.50 |
| |
QC182708 | Sodium Cromoglicate Impurity 8 CAS# NA M.F.: C19H16O9 M.W.: 388.33 |
| |
QC182707 | Sodium Cromoglicate Impurity 7 CAS# NA M.F.: C20H16O10 M.W.: 416.34 |
| |
QC182706 | Sodium Cromoglicate Impurity 6 CAS# 802857-44-9 M.F.: C13H12O7 M.W.: 280.23 |
| |
QA141900 | Ansamitocin P-3 CAS# 66584-72-3 M.F.: C32H43ClN2O9 M.W.: 635.15 |
| |
QY021900 | Y-29794 Tosylate CAS# 143984-17-2 M.F.: C23H34N2OS2.C7H8O3S M.W.: 418.66 172.20 |
| |
QO241100 | 3-Oxo-4,6-choladien-24-oic acid CAS# 88179-71-9 M.F.: C24H34O3 M.W.: 370.53 |
| |
QI200200 | IT1t Dihydrochloride CAS# 1092776-63-0 M.F.: C21H34N4S2.2HCl M.W.: 406.65 72.92 |
| |
QG141101 | Ginkgolide B CAS# 15291-77-7 M.F.: C20H24O10 M.W.: 424.40 |
| |
QD010600 | DAF-2 DA CAS# 205391-02-2 M.F.: C24H18N2O7 M.W.: 446.42 |
| |
QA124300 | Alvespimycin Hydrochloride CAS# 467214-21-7 M.F.: C32H48N4O8.HCl M.W.: 616.76 36.46 |
| |
QA122100 | Allura Red AC CAS# 25956-17-6 M.F.: C18H14N2Na2O8S2 M.W.: 496.42 |
| |
QF120373 | Folic Acid Nitroso Impurity 1 CAS# 26360-21-4 M.F.: C19H18N8O7 M.W.: 470.40 |
| |
QE081800 | EGFR inhibitor CAS# 879127-07-8 M.F.: C21H18F3N5O M.W.: 413.40 |
| |
QA133600 | AMI-1 Disodium Salt CAS# 20324-87-2 M.F.: C21H14N2Na2O9S2 M.W.: 548.45 |
| |
QM191000 | Maslinic Acid CAS# 4373-41-5 M.F.: C30H48O4 M.W.: 472.71 |
| |
QA121100 | ALK/IGF1R inhibitor CAS# 1356962-20-3 M.F.: C24H25ClN6O M.W.: 448.96 |
| |
QB180400 | BRD4 Inhibitor-10 CAS# 1660117-38-3 M.F.: C25H27N5O2 M.W.: 429.52 |
| |
QN093300 | Nicotinamide Riboside CAS# 1341-23-7 M.F.: C11H15N2O5+ M.W.: 255.25 |
| |
QY030900 | Y-39983 Hydrochloride CAS# 471843-75-1 M.F.: C16H16N4O.HCl M.W.: 280.33 36.46 |
| |
QA133500 | AMG 487 CAS# 473719-41-4 M.F.: C32H28F3N5O4 M.W.: 603.60 |
| |
QV3077102 | Vitamin B6 Impurity 102 CAS# 524-07-2 M.F.: C8H9NO4 M.W.: 183.16 |
| |
QV3077101 | Vitamin B6 Impurity 101 CAS# NA M.F.: C16H20N2O5 M.W.: 320.35 |
| |
QZ121629 | Zolpidem tartrate Impurity 29 CAS# 14547-80-9 M.F.: C13H12N2O M.W.: 212.25 |
| |
QZ121628 | Zolpidem tartrate Impurity 28 CAS# 20972-36-5 M.F.: C11H10O3 M.W.: 190.20 |
| |
QP190500 | Pseudovitamin B12 CAS# 13408-75-8 M.F.: C59H83CoN17O14P M.W.: 1344.33 |
| |
QT031891 | Vitamin E Impurity 91 CAS# 86993-71-7 M.F.: C30H52O2 M.W.: 444.74 |
| |
QM141400 | Menaquinone 4;Menatetrenone CAS# 863-61-6 M.F.: C31H40O2 M.W.: 444.66 |
| |
QL090649 | Lifitegrast Impurity 49 CAS# 166599-84-4 M.F.: C9H6O3 M.W.: 162.14 |
| |
QP080512 | Phenytoin Sodium Impurity 12 CAS# NA M.F.: C15H11N3O4 M.W.: 297.27 |
| |
QM092212 | Mivacurium chloride Impurity 12 CAS# NA M.F.: C28H42ClNO7 M.W.: 540.09 |
| |
QM092211 | Mivacurium chloride Impurity 11 CAS# NA M.F.: C23H30INO5 M.W.: 527.40 |
| |
QM092210 | Mivacurium chloride Impurity 10 CAS# NA M.F.: C21H25NO6 M.W.: 387.43 |
| |
QE261243 | Enzalutamide Impurity 43 CAS# NA M.F.: C9H3F3N2S M.W.: 228.19 |
| |
QB152001 | (+)-Bornyl acetate CAS# 20347-65-3 M.F.: C12H20O2 M.W.: 196.29 |
| |
QR027025 | Rifampicin Impurity 25 CAS# NA M.F.: C44H60N4O12 M.W.: 836.98 |
| |
QC080311 | Cholic Acid Impurity 11 CAS# 15073-99-1 M.F.: C26H44O5 M.W.: 436.63 |
| |
QA122616 | Alprazolam USP Related Compound A CAS# 28910-89-6 M.F.: C17H15ClN4O M.W.: 326.78 |
| |
QG131819 | Gimeracil Impurity 19 CAS# NA M.F.: C7H4Cl2N2O2 M.W.: 219.02 |
| |
QV041426 | Vardenafil Impurity 26 CAS# 1417529-67-9 M.F.: C17H18N4O4 M.W.: 342.36 |
| |
QG010600 | Gadoterate Meglumine CAS# 92943-93-6 M.F.: C16H25GdN4O8.C7H17NO5 M.W.: 558.65 195.22 |
| |
QL011430 | Landiolol Impurity 30 CAS# NA M.F.: C5H14N4O M.W.: 146.19 |
| |
QL011427 | Landiolol Impurity 27 CAS# NA M.F.: C26H42N6O7 M.W.: 550.66 |
| |
QL011422 | Landiolol Impurity 22 CAS# 69630-20-2 M.F.: C11H13NO3 M.W.: 207.23 |
| |
QG121504 | Glycocholic Acid Impurity 4 CAS# 26563-58-6 M.F.: C28H46N2O7 M.W.: 522.68 |
| |
QI032000 | Icotinib hydrochloride CAS# 1204313-51-8 M.F.: C22H21N3O4.HCl M.W.: 391.43 36.46 |
| |
QL091683 | Lipoic Acid Impurity 83 CAS# NA M.F.: C10H20N2OS2 M.W.: 248.40 |
| |
QL091682 | Lipoic Acid Impurity 82 CAS# NA M.F.: C10H20N2OS2 M.W.: 248.40 |
| |
QS041922 | Sodium Valproate Impurity 22 CAS# 66546-92-7 M.F.: C10H17NO2 M.W.: 183.25 |
| |
QS041921 | Sodium Valproate Impurity 21 CAS# 66546-91-6 M.F.: C9H15NO2 M.W.: 169.22 |
| |
QR051258 | Relugolix Impurity 58 CAS# 2814571-37-2 M.F.: C29H26F2N6O5S M.W.: 608.62 |
| |
QB142900 | Benzalkonium chloride CAS# 8001-54-5 M.F.: NA M.W.: NA |
| |
QC141201 | Controlled Substance (delta(9)-Tetrahydrocannabinolic acid) CAS# 23978-85-0 M.F.: C22H30O4 M.W.: 358.48 |
| |
QB152101 | beta-Boswellic acid CAS# 631-69-6 M.F.: C30H48O3 M.W.: 456.71 |
| |
QD162010 | Daptomycin Impurity J CAS# NA M.F.: C74H107N17O27 M.W.: 1666.76 |
| |
QN140448 | Nintedanib Impurity 48 CAS# 54699-92-2 M.F.: C7H14N2O2 M.W.: 158.20 |
| |
QN140426 | Nintedanib Impurity 26 CAS# 708279-23-6 M.F.: C13H18N4O3 M.W.: 278.31 |
| |
QA010301 | Arachidonic acid-d11 CAS# NA M.F.: C20H21D11O2 M.W.: 315.54 |
| |
QO130400 | Omadacycline tosylate CAS# 1075240-43-5;389139-89-3(free base) M.F.: C29H40N4O7.C7H8O3S M.W.: 556.66 172.20 |
| |
QC182704 | Sodium Cromoglicate Impurity 4 CAS# NA M.F.: C36H26O17 M.W.: 730.59 |
| |
QV3077100 | Vitamin K1 Chromenol CAS# 34044-00-3 M.F.: C31H46O2 M.W.: 450.71 |
| |
QV307799 | Vitamin K1 Impurity 99 CAS# 16825-16-4 M.F.: C18H36O M.W.: 268.49 |
| |
QD094600 | DL-Dihydroorotic acid CAS# 155-54-4 M.F.: C5H6N2O4 M.W.: 158.11 |
| |
QA031608 | Acipimox Impurity 8 CAS# 1368358-42-2 M.F.: C6H4N2O3 M.W.: 152.11 |
| |
QI040158 | Indacaterol Impurity 58 CAS# NA M.F.: C29H30N2O3 M.W.: 454.57 |
| |
QR152459 | Roxadustat Impurity 59 CAS# NA M.F.: C20H18N2O4 M.W.: 350.37 |
| |
QL012407 | Latamoxef Impurity 7 CAS# NA M.F.: C41H38N6O10S M.W.: 806.85 |
| |
QI210675 | Ibuprofen Impurity 75 CAS# NA M.F.: C12H15ClO M.W.: 210.70 |
| |
QG040274 | Gadobutrol Impurity 74 CAS# NA M.F.: C16H26CaN4O8 M.W.: 442.48 |
| |
QS075495 | Sugammadex Impurity 95 CAS# NA M.F.: C48H72Br7ClO32 M.W.: 1755.85 |
| |
QC132673 | Cefmetazole sodium Impurity 73 CAS# NA M.F.: C24H22N2O5S2 M.W.: 482.57 |
| |
QC132671 | Cefmetazole sodium Impurity 71 CAS# NA M.F.: C24H22N6O3S3 M.W.: 538.66 |
| |
QD152507 | Doxycycline hyclate Impurity 7 CAS# NA M.F.: C22H24N2O9 M.W.: 460.44 |
| |
QC132670 | Cefmetazole sodium Impurity 70 CAS# NA M.F.: C24H24N2O6S M.W.: 468.52 |
| |
QF022498 | Febuxostat Impurity 98 CAS# 2428631-65-4 M.F.: C17H15N3O3S M.W.: 341.39 |
| |
QD030472 | Diclofenac sodium Impurity 72 CAS# NA M.F.: C14H8Cl4NNaO2 M.W.: 387.01 |
| |
QD030471 | Diclofenac sodium Impurity 71 CAS# NA M.F.: C14H7Cl4NO M.W.: 347.02 |
| |
QA180254 | Arbidol Impurity 54 CAS# 39830-85-8 M.F.: C30H32N2O8 M.W.: 548.59 |
| |
QI182081 | Ibrutinib Impurity 81 CAS# 109384-19-2 M.F.: C10H19NO3 M.W.: 201.27 |
| |
QO132087 | Olmesartan Medoxomil Impurity 87 CAS# NA M.F.: C53H54N12O8 M.W.: 987.09 |
| |
QE161250 | Epalrestat Impurity 50 CAS# NA M.F.: C11H13NO3S2 M.W.: 271.35 |
| |
QT260428 | Trazodone hydrochloride Impurity 28 CAS# 23431-04-1 M.F.: C5H4N4O M.W.: 136.11 |
| |
QA130504 | Aminolevulinic Acid Impurity 4 CAS# 106-65-0 M.F.: C6H10O4 M.W.: 146.14 |
| |
QA130503 | Aminolevulinic Acid Impurity 3 CAS# 3878-55-5 M.F.: C5H8O4 M.W.: 132.12 |
| |
QA163039 | Apremilast Impurity 39 CAS# 208774-55-4 M.F.: C10H11NO4 M.W.: 209.20 |
| |
QZ151215 | Zoledronic acid EP Impurity A CAS# NA M.F.: C7H12N2O9P2 M.W.: 330.13 |
| |
QI091638 | Ipratropium Bromide Impurity 38 CAS# NA M.F.: C19H18O6 M.W.: 342.35 |
| |
QZ140102 | Zanamivir EP Impurity C CAS# NA M.F.: C11H18N2O7 M.W.: 290.27 |
| |
QT180925 | Triamcinolone hexacetonide EP Impurity B CAS# NA M.F.: C29H39FO7 M.W.: 518.62 |
| |
QC124100 | Calcium gluconate CAS# 18016-24-5 M.F.: C12H22CaO14.H2O M.W.: 430.37 18.02 |
| |
QT152800 | all-rac-α-Tocopheryl acetate CAS# 7695-91-2 M.F.: C31H52O3 M.W.: 472.75 |
| |
QD141648 | Donepezil Benzyl Chloride CAS# 937362-16-8 M.F.: C31H36ClNO3 M.W.: 506.08 |
| |
QM200513 | Methylene Blue Nitroso Impurity 1 CAS# NA M.F.: C12H7N3O2S M.W.: 257.27 |
| |
QM200512 | Methylene Blue Impurity 12 CAS# 1195557-65-3 M.F.: C12H10IN M.W.: 295.12 |
| |
QM200511 | Methylene Blue Impurity 11 CAS# 2204245-78-1 M.F.: C12H9I2N M.W.: 421.02 |
| |
QM200510 | Leucomethylene Blue CAS# 613-11-6 M.F.: C16H19N3S M.W.: 285.41 |
| |
QM200509 | Methylene Blue Impurity 9 CAS# 16078-95-8 M.F.: C12H11NS M.W.: 201.29 |
| |
QM200515 | Methylene Blue Impurity 15 CAS# 20255-70-3 M.F.: C12H9I2N M.W.: 421.02 |
| |
QM200514 | Methylene Blue Impurity 14 CAS# 61613-21-6 M.F.: C12H10IN M.W.: 295.12 |
| |
QT691544 | Testosterone Propionate EP Impurity E CAS# NA M.F.: C22H30O3 M.W.: 342.48 |
| |
QT691543 | Testosterone Propionate EP Impurity D CAS# NA M.F.: C22H30O3 M.W.: 342.48 |
| |
QT691539 | Testosterone Enantate EP Impurity H CAS# NA M.F.: C33H54O4 M.W.: 514.79 |
| |
QT082103 | Terpin EP Impurity C;Limonene CAS# 138-86-3 M.F.: C10H16 M.W.: 136.24 |
| |
QT082100 | Terpin Monohydrate CAS# 2451-01-6 M.F.: C10H20O2.H2O M.W.: 172.27 18.02 |
| |
QI041804 | Idarubicinone CAS# 60660-75-5 M.F.: C20H16O7 M.W.: 368.34 |
| |
QS210501 | Sulfacetamide sodium EP Impurity C CAS# NA M.F.: C10H12N2O4S M.W.: 256.28 |
| |
QS210500 | Sulfacetamide sodium monohydrate CAS# 6209-17-2 M.F.: C8H9N2NaO3S.H2O M.W.: 236.22 18.02 |
| |
QS161603 | Spirapril EP Impurity D CAS# NA M.F.: C25H36N2O5S2 M.W.: 508.69 |
| |
QE200394 | Entacapone Impurity 94 CAS# 80547-69-9 M.F.: C8H7NO5 M.W.: 197.15 |
| |
QP032025 | Procaterol Impurity 25 CAS# NA M.F.: C16H22N2O3 M.W.: 290.36 |
| |
QP032024 | Procaterol Impurity 24 CAS# NA M.F.: C16H22N2O2 M.W.: 274.36 |
| |
QP032023 | Procaterol Impurity 23 CAS# NA M.F.: C13H11Br2NO3 M.W.: 389.04 |
| |
QF151405 | Fondaparinux Sodium Impurity 5 CAS# NA M.F.: C32H42N3Na9O47S7 M.W.: 1651.99 |
| |
QF151404 | Fondaparinux Sodium Impurity 4 CAS# NA M.F.: C38H55N3Na10O49S8 M.W.: 1824.21 |
| |
QF151403 | Fondaparinux Sodium Impurity 3 CAS# NA M.F.: C32H44N3Na9O47S7 M.W.: 1654.01 |
| |
QF151402 | Fondaparinux Sodium Impurity 2 CAS# NA M.F.: C31H42N3Na11O52S9 M.W.: 1830.07 |
| |
QF151401 | Fondaparinux Sodium Impurity 1 CAS# NA M.F.: C31H44N3Na9O46S7 M.W.: 1626.00 |
| |
QS0102121 | Salbutamol Impurity 121 CAS# 27566-09-2 M.F.: C14H21NO4 M.W.: 267.33 |
| |
QS150404 | Alendronic acid CAS# 66376-36-1 M.F.: C4H13NO7P2 M.W.: 249.10 |
| |
QS0102119 | Salbutamol Impurity 119 CAS# 29754-58-3 M.F.: C10H10O6 M.W.: 226.18 |
| |
QG042419 | Gadoxetate Disodium Impurity 19 CAS# NA M.F.: C30H44N4O5 M.W.: 540.71 |
| |
QG042418 | Gadoxetate Disodium Impurity 18 CAS# NA M.F.: C13H22N2O2.2HCl M.W.: 238.33 72.92 |
| |
QG042417 | Gadoxetate Disodium Impurity 17 CAS# NA M.F.: C18H23NO4S M.W.: 349.45 |
| |
QR122008 | Raltegravir potassium EP Impurity H CAS# NA M.F.: C34H36F2N8O8 M.W.: 722.71 |
| |
QE160505 | Eperisone Impurity 5 CAS# 27465-51-6 M.F.: C11H14O M.W.: 162.23 |
| |
QP150707 | Proguanil hydrochloride EP Impurity G CAS# NA M.F.: C11H16ClN5 M.W.: 253.73 |
| |
QP150706 | Proguanil hydrochloride EP Impurity F CAS# NA M.F.: C11H15Cl2N5 M.W.: 288.18 |
| |
QP150705 | Proguanil hydrochloride EP Impurity E CAS# NA M.F.: C8H7ClN4 M.W.: 194.62 |
| |
QP150303 | Prochlorperazine Maleate EP Impurity C CAS# 1346602-34-3 M.F.: C20H24ClN3S M.W.: 373.94 |
| |
QP150302 | Prochlorperazine Maleate EP Impurity B; Perazine CAS# 84-97-9;14516-56-4(dimaleate) M.F.: C20H25N3S M.W.: 339.50 |
| |
QP150301 | Prochlorperazine Maleate EP Impurity A CAS# 10078-27-0 M.F.: C20H24ClN3OS M.W.: 389.94 |
| |
QP092104 | Primaquine Diphosphate EP Impurity D CAS# NA M.F.: C23H23N3O3 M.W.: 389.46 |
| |
QP092103 | Primaquine Diphosphate EP Impurity C CAS# 90-52-8 M.F.: C10H10N2O M.W.: 174.20 |
| |
QP092102 | Primaquine Diphosphate EP Impurity B CAS# 85-81-4 M.F.: C10H8N2O3 M.W.: 204.19 |
| |
QP092101 | Primaquine Diphosphate EP Impurity A;Quinocide CAS# 525-61-1 M.F.: C15H21N3O M.W.: 259.35 |
| |
QE192902 | Estradiol Cypionate Impurity 2 CAS# NA M.F.: C27H38O3 M.W.: 410.60 |
| |
QE192901 | Estradiol Cypionate Impurity 1 CAS# NA M.F.: C26H34O3 M.W.: 394.56 |
| |
QE192900 | Estradiol Cypionate CAS# 313-06-4 M.F.: C26H36O3 M.W.: 396.57 |
| |
QT131214 | Timolol Maleate Impurity 14 CAS# NA M.F.: C6H9N3O3S M.W.: 203.22 |
| |
QC181722 | Crotamiton Impurity 22 CAS# NA M.F.: C13H18ClNO M.W.: 239.74 |
| |
QP081305 | Phentolamine Mesylate Impurity 5 CAS# NA M.F.: C21H25N5O M.W.: 363.47 |
| |
QR152453 | Roxadustat Impurity 53 CAS# 39987-25-2 M.F.: C6H11NO4.HCl M.W.: 161.16 36.46 |
| |
QI192285 | Isavuconazole Impurity 85 CAS# NA M.F.: C35H36F2N8O9S2 M.W.: 814.84 |
| |
QT260426 | Trazodone hydrochloride Impurity Z CAS# 2727463-29-6 M.F.: C40H46Cl2N10O2 M.W.: 769.78 |
| |
QI152300 | Iothalamic acid CAS# 2276-90-6 M.F.: C11H9I3N2O4 M.W.: 613.92 |
| |
QA163020 | Apremilast Impurity 20 CAS# 113579-20-7 M.F.: C9H9NO4 M.W.: 195.17 |
| |
QC130426 | Cefamandole Impurity 26 CAS# NA M.F.: C18H17ClN6O4S2 M.W.: 480.94 |
| |
QC130425 | Cefamandole Impurity 25 CAS# NA M.F.: C27H26N8O9S3 M.W.: 702.73 |
| |
QA161912 | Acetylsalicylic Acid Impurity 12 CAS# NA M.F.: C14H13N3O4 M.W.: 287.28 |
| |
QA161911 | Acetylsalicylic Acid Impurity 11 CAS# NA M.F.: C14H12N2O5 M.W.: 288.26 |
| |
QR021660 | Rabeprazole Impurity 60 CAS# NA M.F.: C14H12ClN3OS M.W.: 305.78 |
| |
QO240113 | Oxacillin sodium Impurity 13 CAS# NA M.F.: C19H20N4O6S M.W.: 432.45 |
| |
QC153700 | Combretastatin A4 Phosphate Disodium Salt CAS# 168555-66-6 M.F.: C18H19Na2O8P M.W.: 440.30 |
| |
QC042433 | Cefadroxil Impurity 33 CAS# NA M.F.: C48H48N8O14S2 M.W.: 1025.07 |
| |
QB212539 | Butylphthalide Impurity 39 CAS# 72917-31-8 M.F.: C12H12O2 M.W.: 188.23 |
| |
QA120744 | Alogliptin Impurity 44 CAS# 2749357-07-9 M.F.: C12H8ClN3O2 M.W.: 261.67 |
| |
QC081341 | Calcitriol Impurity 41 CAS# NA M.F.: C39H70O4Si2 M.W.: 659.16 |
| |
QA132617 | Amorolfine Impurity 17 CAS# 67467-96-3 M.F.: C15H22O M.W.: 218.34 |
| |
QP092710 | Pinaverium Bromide Impurity 10 CAS# NA M.F.: C15H22BrCl2NO3 M.W.: 415.15 |
| |
QC181954 | Crisaborole Impurity 54 CAS# NA M.F.: C16H16BrNO3 M.W.: 350.21 |
| |
QI191651 | Isoproterenol Impurity 51 CAS# 28177-45-9 M.F.: C11H17NO5S M.W.: 275.32 |
| |
QC182703 | Sodium Cromoglicate Impurity 3 CAS# NA M.F.: C45H30O20 M.W.: 890.72 |
| |
QP160475 | Paliperidone Impurity 75 CAS# 1071864-06-6 M.F.: C30H31FN4O4 M.W.: 530.60 |
| |
QA130311 | Aminocaproic acid Impurity K CAS# 56403-09-9 M.F.: C12H22N2O2 M.W.: 226.32 |
| |
QA130310 | Aminocaproic acid Impurity J CAS# 19837-09-3 M.F.: C12H22N2O2 M.W.: 226.32 |
| |
QA130309 | Aminocaproic acid Impurity I CAS# 371-34-6 M.F.: C8H17NO2 M.W.: 159.23 |
| |
QM041851 | Minodronic Acid Impurity 51 CAS# NA M.F.: C9H11N2O4P M.W.: 242.17 |
| |
QM041850 | Minodronic Acid Impurity 50 CAS# NA M.F.: C9H11ClN2O6P2 M.W.: 340.59 |
| |
QT120231 | Tulobuterol Impurity 31 CAS# NA M.F.: C28H48ClNO3 M.W.: 482.15 |
| |
QL091681 | Lipoic Acid Impurity 81 CAS# NA M.F.: C24H42O6S6 M.W.: 618.95 |
| |
QU130506 | Umeclidinium bromide Nitroso Impurity 1 CAS# 1038-06-8 M.F.: C18H20N2O2 M.W.: 296.37 |
| |
QC042036 | Cefditoren Pivoxil-13C-d3 CAS# NA M.F.: C2413CH25D3N6O7S3 M.W.: 624.72 |
| |
QC042035 | Cefditoren pivoxil Impurity 35 CAS# NA M.F.: C51H59N13O14S6 M.W.: 1270.47 |
| |
QM201600 | Mitoquinone CAS# 444890-41-9 M.F.: C37H44O4P+ M.W.: 583.73 |
| |
QG040500 | Gadobenate Dimeglumine CAS# 127000-20-8 M.F.: C36H62GdN5O21 M.W.: 1058.16 |
| |
QC061900 | Ceftaroline fosamil acetate CAS# 400827-46-5 M.F.: C24H25N8O10PS4 M.W.: 744.72 |
| |
QT120223 | Tulobuterol Impurity 23 CAS# NA M.F.: C14H20ClNO2 M.W.: 269.77 |
| |
QE160946 | Epinastine Impurity 46 CAS# NA M.F.: C13H13N3 M.W.: 211.27 |
| |
QV200108 | Vitamin A palmitate CAS# 79-81-2 M.F.: C36H60O2 M.W.: 524.87 |
| |
QL220340 | Levocarnitine propionate hydrochloride CAS# 119793-66-7 M.F.: C10H20ClNO4 M.W.: 253.72 |
| |
QV307798 | Dihydro Vitamin K1 CAS# 572-96-3 M.F.: C31H48O2 M.W.: 452.72 |
| |
QL210901 | Lucidenic acid A CAS# 95311-94-7 M.F.: C27H38O6 M.W.: 458.60 |
| |
QG011404 | Ganoderic Acid G CAS# 98665-22-6 M.F.: C30H44O8 M.W.: 532.67 |
| |
QG011403 | Ganoderic Acid C2 CAS# 103773-62-2 M.F.: C30H46O7 M.W.: 518.69 |
| |
QA010736 | Alanyl Glutamine Impurity 36 CAS# 2680610-96-0 M.F.: C8H12N2O4 M.W.: 200.19 |
| |
QI142104 | Insulin degludec Impurity 4 CAS# NA M.F.: C25H38N2O8 M.W.: 494.59 |
| |
QI142103 | Insulin degludec Impurity 3 CAS# NA M.F.: C29H48N2O9 M.W.: 568.71 |
| |
QI142102 | Insulin degludec Impurity 2 CAS# NA M.F.: C21H35NO6 M.W.: 397.51 |
| |
QI142101 | Insulin degludec Impurity 1 CAS# NA M.F.: C21H37NO7 M.W.: 415.53 |
| |
QM050106 | Metamizole sodium Nitroso Impurity 1 CAS# NA M.F.: C10H8N4O3 M.W.: 232.20 |
| |
QN091242 | Nilotinib Impurity 42 CAS# 641571-06-4 M.F.: C11H10F3N3 M.W.: 241.22 |
| |
QV071209 | Voglibose Impurity 9 CAS# NA M.F.: C10H21NO7 M.W.: 267.28 |
| |
QP092709 | Pinaverium Bromide Impurity 9 CAS# NA M.F.: C15H22Br2ClNO3 M.W.: 459.60 |
| |
QP092708 | Pinaverium Bromide Impurity 8 CAS# NA M.F.: C15H23Br2NO4 M.W.: 441.16 |
| |
QD151911 | Calcium Dobesilate Impurity 11 CAS# NA M.F.: C8H8O5S M.W.: 216.21 |
| |
QB201345 | Betamethasone Impurity 45 CAS# 1202001-99-7;1201919-11-0(2Na salt) M.F.: C22H30FO8P M.W.: 472.45 |
| |
QC0303136 | Cinacalcet Impurity 136 CAS# NA M.F.: C22H22F3N M.W.: 357.42 |
| |
QE121200 | Ellagic acid CAS# 476-66-4 M.F.: C14H6O8 M.W.: 302.19 |
| |
QC192053 | Candesartan Cilexetil Impurity 53 CAS# NA M.F.: C10H9NO6 M.W.: 239.18 |
| |
QC192052 | Candesartan Cilexetil Impurity 52 CAS# NA M.F.: C14H18N2O6 M.W.: 310.31 |
| |
QM191400 | Masitinib mesylate CAS# 1048007-93-7;790299-79-5(free base) M.F.: C28H30N6OS.CH4O3S M.W.: 498.65 96.10 |
| |
QF120806 | Flecainide acetate Nitroso Impurity 1 CAS# NA M.F.: C17H18F6N4O5 M.W.: 472.34 |
| |
QF061322 | Fosfomycin Trometamol Impurity 22 CAS# NA M.F.: C7H17O5P M.W.: 212.18 |
| |
QF061321 | Fosfomycin Trometamol Impurity 21 CAS# NA M.F.: C5H13O5P M.W.: 184.13 |
| |
QC192051 | Candesartan Cilexetil Impurity 51 CAS# 62351-79-5 M.F.: C12H13NO6 M.W.: 267.24 |
| |
QT201628 | Tiotropium bromide Impurity 28 CAS# NA M.F.: C18H19NO4S2 M.W.: 377.47 |
| |
QK201846 | Ketorolac Impurity 46 CAS# 144710-35-0 M.F.: C18H19NO5 M.W.: 329.35 |
| |
QF022496 | Febuxostat Impurity 96 CAS# NA M.F.: C29H26N2O8S2 M.W.: 594.65 |
| |
QA131263 | Amlodipine Impurity 63 CAS# NA M.F.: C32H45ClN2O15 M.W.: 733.16 |
| |
QP050312 | Penicillamine Impurity 12 CAS# NA M.F.: C8H15N3O2S M.W.: 217.29 |
| |
QF120372 | Folic Acid Impurity 72 CAS# 1182291-60-6 M.F.: C7H7N5O3 M.W.: 209.17 |
| |
QP090333 | Sodium Picosulfate Impurity 33 CAS# NA M.F.: C24H27NO8S2 M.W.: 521.60 |
| |
QT1406195 | Tenofovir Disoproxil Fumarate Impurity 195 CAS# NA M.F.: C58H88N15O30P3 M.W.: 1568.34 |
| |
QL091680 | Lipoic Acid Impurity 80 CAS# 120476-62-2 M.F.: C8H13ClO2 M.W.: 176.64 |
| |
QL091679 | Lipoic Acid Impurity 79 CAS# NA M.F.: C10H17ClO2 M.W.: 204.69 |
| |
QS200793 | Sitagliptin Impurity 93 CAS# 1246961-45-4 M.F.: C19H26F3NO4 M.W.: 389.42 |
| |
QM092209 | Mivacurium chloride Impurity 9 CAS# NA M.F.: C25H36ClNO6 M.W.: 482.01 |
| |
QC061444 | Cefdinir Impurity 44 CAS# NA M.F.: C13H15N5O4S2 M.W.: 369.41 |
| |
QC042034 | Cefditoren pivoxil Impurity 34 CAS# NA M.F.: C50H56N12O14S6 M.W.: 1241.43 |
| |
QF132044 | Formoterol Impurity 44 CAS# NA M.F.: C14H19NO5 M.W.: 281.31 |
| |
QT0603171 | Tofacitinib Impurity 171 CAS# NA M.F.: C4H5N3O2 M.W.: 127.10 |
| |
QF122123 | Fluorouracil Impurity 23 CAS# NA M.F.: C5H6N2O3 M.W.: 142.11 |
| |
QC151309 | Clomifene citrate EP Impurity GH CAS# 1795130-17-4;1795130-18-5(citrate salt) M.F.: C26H27Cl2NO M.W.: 440.41 |
| |
QC192050 | Candesartan Cilexetil Impurity 50 CAS# NA M.F.: C10H8N2O5 M.W.: 236.18 |
| |
QC192049 | Candesartan Cilexetil Impurity 49 CAS# NA M.F.: C12H14N2O6 M.W.: 282.25 |
| |
QL090635 | Lifitegrast Impurity 35 CAS# NA M.F.: C29H26Cl2N2O9S M.W.: 649.49 |
| |
QP090332 | Sodium Picosulfate Impurity 32 CAS# NA M.F.: C18H12NNa3O11S3 M.W.: 583.44 |
| |
QP090331 | Sodium Picosulfate Impurity 31 CAS# 105745-58-2 M.F.: C18H15NO2 M.W.: 277.32 |
| |
QP090330 | Sodium Picosulfate Impurity 30 CAS# NA M.F.: C12H11NO2 M.W.: 201.23 |
| |
QK201844 | Ketorolac Impurity 44 CAS# NA M.F.: C15H12ClNO3 M.W.: 289.72 |
| |
QG121914 | Granisetron Impurity 14 CAS# NA M.F.: C18H24N4O2 M.W.: 328.42 |
| |
QP180353 | Piperacillin Impurity 53 CAS# NA M.F.: C23H29N5O8S M.W.: 535.57 |
| |
QI161600 | Iptacopan hydrochloride CAS# 1646321-63-2 M.F.: C25H30N2O4.HCl M.W.: 422.53 36.46 |
| |
QL091678 | Lipoic Acid Impurity 78 CAS# NA M.F.: C24H44O6S6 M.W.: 620.97 |
| |
QL091677 | Lipoic Acid Impurity 77 CAS# NA M.F.: C26H48O6S6 M.W.: 649.02 |
| |
QL091676 | Lipoic Acid Impurity 76 CAS# NA M.F.: C16H30O4S4 M.W.: 414.65 |
| |
QL091675 | Lipoic Acid Impurity 75 CAS# 108841-56-1 M.F.: C16H30O4S4 M.W.: 414.65 |
| |
QC121920 | Cilastatin Impurity 20 CAS# NA M.F.: C16H26N2O5S M.W.: 358.45 |
| |
QU181600 | Uroporphyrin I dihydrochloride CAS# 68929-06-6 M.F.: C40H38N4O16.2HCl M.W.: 830.76 72.92 |
| |
QZ151214 | Zoledronic acid Impurity 14 CAS# 131468-90-1 M.F.: C4H6N2O M.W.: 98.11 |
| |
QZ151213 | Zoledronic acid Impurity 13 CAS# NA M.F.: C5H11N3O7P2 M.W.: 287.10 |
| |
QZ151212 | Zoledronic acid Impurity 12 CAS# NA M.F.: C6H12N2O7P2 M.W.: 286.12 |
| |
QB051330 | Bempedoic acid Impurity 30 CAS# NA M.F.: C29H45NO6S M.W.: 535.74 |
| |
QB051329 | Bempedoic acid Impurity 29 CAS# NA M.F.: C27H41NO6S M.W.: 507.69 |
| |
QC181949 | Crisaborole Impurity 49 CAS# 2227126-09-0 M.F.: C16H12BrNO3 M.W.: 346.18 |
| |
QI142506 | Indocyanine Green Impurity 6 CAS# NA M.F.: C18H20NNaO4S M.W.: 369.41 |
| |
QV1416147 | Vonoprazan Impurity 147 CAS# NA M.F.: C18H18FN3O3S M.W.: 375.42 |
| |
QD151632 | Dopamine Impurity 32 CAS# NA M.F.: C16H20N2O4.HCl M.W.: 304.35 36.46 |
| |
QB152003 | Isobornyl Acetate CAS# 125-12-2 M.F.: C12H20O2 M.W.: 196.29 |
| |
QR052003 | Retinoic acid Impurity 3 CAS# 53282-28-3 M.F.: C33H38ClP M.W.: 501.09 |
| |
QP181919 | Prasugrel Metabolite R-138727 CAS# 204204-73-9 M.F.: C18H20FNO3S M.W.: 349.42 |
| |
QA661232 | Ampicillin Impurity 32 CAS# NA M.F.: C32H40N6O9S2 M.W.: 716.83 |
| |
QA123800 | Alflutinib mesylate CAS# 2130958-55-1 M.F.: C28H31F3N8O2.CH4O3S M.W.: 568.61 96.10 |
| |
QC031261 | Cefaclor Impurity 61 CAS# NA M.F.: C29H28Cl2N6O6S2 M.W.: 691.60 |
| |
QR051254 | Relugolix Impurity 54 CAS# NA M.F.: C32H35F2N7O6S M.W.: 683.73 |
| |
QM041510 | Medroxyprogesterone Acetate Impurity 10 CAS# 984-46-3 M.F.: C24H34O5 M.W.: 402.53 |
| |
QP081846 | Phloroglucinol Impurity 46 CAS# 531-02-2 M.F.: C12H10O4 M.W.: 218.21 |
| |
QP180352 | Piperacillin Impurity 52 CAS# NA M.F.: C25H33N5O8S M.W.: 563.63 |
| |
QA261967 | Azilsartan Impurity 67 CAS# NA M.F.: C29H28N4O5 M.W.: 512.57 |
| |
QB140444 | Benidipine Impurity 44 CAS# NA M.F.: C16H22N2O2.HCl M.W.: 274.36 36.46 |
| |
QB140443 | Benidipine Impurity 43 CAS# NA M.F.: C23H24N2O5.HCl M.W.: 408.45 36.46 |
| |
QT691527 | Testosterone octanoate CAS# NA M.F.: C27H42O3 M.W.: 414.63 |
| |
QB011524 | Baloxavir Impurity 24 CAS# 1985607-69-9 M.F.: C22H23N3O6 M.W.: 425.44 |
| |
QM031641 | Mycophenolate Mofetil Impurity 41 CAS# NA M.F.: C17H24O8 M.W.: 356.37 |
| |
QS150403 | Alendronic Acid-d6 CAS# 1035437-39-8 M.F.: C4H7D6NO7P2 M.W.: 255.13 |
| |
QM092200 | Mivacurium chloride CAS# 106861-44-3;133814-19-4(cation) M.F.: C58H80Cl2N2O14 M.W.: 1100.18 |
| |
QC620915 | Colchicine Impurity 15 CAS# NA M.F.: C23H27NO6S M.W.: 445.53 |
| |
QR131908 | Ramosetron Impurity 8 CAS# 603-76-9 M.F.: C9H9N M.W.: 131.18 |
| |
QS023390 | SCH 23390 maleate CAS# 87134-87-0 M.F.: C17H18ClNO.C4H4O4 M.W.: 287.79 116.07 |
| |
QP1824112 | Parecoxib Sodium Impurity 112 CAS# NA M.F.: C19H16N2O3S M.W.: 352.41 |
| |
QB011519 | Baloxavir Impurity 19 CAS# NA M.F.: C17H15N3O4 M.W.: 325.32 |
| |
QM154268 | Mirabegron Impurity 68 CAS# NA M.F.: C32H36N4O3 M.W.: 524.67 |
| |
QE191333 | Esmolol Impurity 33 CAS# 17449-03-5 M.F.: C10H8O5 M.W.: 208.17 |
| |
QI142505 | Indocyanine Green Impurity 5 CAS# NA M.F.: C45H52N2O6S2 M.W.: 781.04 |
| |
QD152611 | Deoxycholic acid Impurity 11 CAS# NA M.F.: C25H36O2 M.W.: 368.56 |
| |
QD152610 | Deoxycholic acid Impurity 10 CAS# NA M.F.: C25H36O3 M.W.: 384.56 |
| |
QD152609 | Deoxycholic acid Impurity 9 CAS# NA M.F.: C25H38O2 M.W.: 370.58 |
| |
QD152608 | Deoxycholic acid Impurity 8 CAS# NA M.F.: C24H36O2 M.W.: 356.55 |
| |
QD152607 | Deoxycholic acid Impurity 7 CAS# NA M.F.: C24H36O3 M.W.: 372.55 |
| |
QD152606 | Deoxycholic acid Impurity 6 CAS# 3318-71-6 M.F.: C24H34O2 M.W.: 354.53 |
| |
QM571813 | Megestrol Acetate-d3 CAS# 162462-72-8 M.F.: C24H29D3O4 M.W.: 387.53 |
| |
QN012106 | Nalfurafine Impurity 6 CAS# NA M.F.: C28H32N2O5 M.W.: 476.57 |
| |
QC121919 | Cilastatin Impurity 19 CAS# NA M.F.: C17H26N2O5S M.W.: 370.46 |
| |
QR051252 | Relugolix Impurity 52 CAS# NA M.F.: C25H25F2N3O6S M.W.: 533.55 |
| |
QS011236 | Salmeterol Impurity 36 CAS# NA M.F.: C29H45NO2 M.W.: 439.68 |
| |
QB011510 | Baloxavir marboxil Impurity 10 CAS# NA M.F.: C27H24FN3O7S M.W.: 553.56 |
| |
QF120371 | Folic Acid Impurity 71 CAS# NA M.F.: C19H17N7O7 M.W.: 455.39 |
| |
QC080310 | Cholic Acid Impurity 10 CAS# 10538-66-6 M.F.: C25H38O5 M.W.: 418.57 |
| |
QC080309 | Cholic Acid Impurity 9 CAS# 10538-64-4 M.F.: C25H40O5 M.W.: 420.59 |
| |
QC080308 | Cholic Acid Impurity 8 CAS# 14772-99-7 M.F.: C25H40O5 M.W.: 420.59 |
| |
QI040153 | Indacaterol Impurity 53 CAS# NA M.F.: C31H34N2O3 M.W.: 482.62 |
| |
QA031604 | Acipimox Impurity 4 CAS# 98502-96-6 M.F.: C6H6N2O3 M.W.: 154.13 |
| |
QA031602 | Acipimox Impurity 2 CAS# 51037-31-1 M.F.: C6H6N2O3 M.W.: 154.13 |
| |
QB051328 | Bempedoic acid Impurity 28 CAS# 50592-83-1 M.F.: C9H16O2 M.W.: 156.23 |
| |
QB051327 | Bempedoic acid Impurity 27 CAS# 143958-75-2 M.F.: C11H20O2 M.W.: 184.28 |
| |
QB051326 | Bempedoic acid Impurity 26 CAS# NA M.F.: C11H22O3 M.W.: 202.29 |
| |
QB051325 | Bempedoic acid Impurity 25 CAS# NA M.F.: C16H24O4S M.W.: 312.42 |
| |
QB051324 | Bempedoic acid Impurity 24 CAS# NA M.F.: C16H24O5S M.W.: 328.42 |
| |
QB051323 | Bempedoic acid Impurity 23 CAS# NA M.F.: C18H28O5S M.W.: 356.48 |
| |
QB051322 | Bempedoic acid Impurity 22 CAS# 1529323-27-0 M.F.: C9H18O3 M.W.: 174.24 |
| |
QA020307 | Abacavir sulfate Impurity 7 CAS# NA M.F.: C14H18N6O M.W.: 286.34 |
| |
QX050400 | XE 991 dihydrochloride CAS# 122955-13-9 M.F.: C26H20N2O.2HCl M.W.: 376.46 72.92 |
| |
QF124001 | Flavine Adenine Dinucleotide-13C5 Ammonium Salt CAS# NA M.F.: C2213C5H33N9O15P2.xNH3 M.W.: 790.52+x(17.03) |
| |
QC151307 | Clomifene citrate Impurity 7 CAS# NA M.F.: C33H34ClNO.HCl M.W.: 496.09 36.46 |
| |
QO242013 | Oxytocin Impurity 13 CAS# NA M.F.: C43H67N13O12S2 M.W.: 1022.20 |
| |
QG121810 | Glycyrrhizic Acid Impurity 10 CAS# NA M.F.: C45H68O17 M.W.: 881.01 |
| |
QL011413 | Landiolol Impurity 13 CAS# NA M.F.: C21H33N3O6 M.W.: 423.50 |
| |
QL011412 | Landiolol Impurity 12 CAS# NA M.F.: C22H35N3O6 M.W.: 437.53 |
| |
QR122007 | Raltegravir potassium EP Impurity G CAS# NA M.F.: C22H27FN6O6 M.W.: 490.48 |
| |
QR122006 | Raltegravir potassium EP Impurity F CAS# NA M.F.: C22H27FN6O6 M.W.: 490.48 |
| |
QR122005 | Raltegravir potassium EP Impurity E CAS# NA M.F.: C20H22N6O5 M.W.: 426.43 |
| |
QR122003 | Raltegravir potassium EP Impurity C CAS# 1391918-17-4 M.F.: C20H23FN6O6 M.W.: 462.43 |
| |
QM050700 | Melengestrol acetate CAS# 2919-66-6 M.F.: C25H32O4 M.W.: 396.52 |
| |
QR122000 | Raltegravir potassium CAS# 871038-72-1;518048-05-0(free base) M.F.: C20H20FKN6O5 M.W.: 482.51 |
| |
QI091637 | Ipratropium Bromide Impurity 37 CAS# NA M.F.: C19H25NO3 M.W.: 315.41 |
| |
QC061239 | Cephalexin Impurity 39 CAS# 1323247-65-9 M.F.: C16H19N3O5S M.W.: 365.40 |
| |
QC205915 | Cytidine Impurity 15 CAS# 77172-20-4 M.F.: C9H13N3O5 M.W.: 243.22 |
| |
QC-A131447 | (S)-2-amino-3-(3-nitrophenyl)propanoic acid CAS# 19883-74-0 M.F.: C9H10N2O4 M.W.: 210.19 |
| |
QB200110 | Betamethasone Dipropionate Impurity 10 CAS# NA M.F.: C32H39FO8S M.W.: 602.71 |
| |
QT130612 | Tamoxifen Citrate Impurity 12 CAS# NA M.F.: C18H20 M.W.: 236.35 |
| |
QM053900 | Methylthioninium chloride hydrate CAS# 122965-43-9 M.F.: C16H18ClN3S.xH2O M.W.: 319.85+x(18.02) |
| |
QN140418 | Nintedanib Impurity 18 CAS# 676326-36-6 M.F.: C12H11NO4 M.W.: 233.22 |
| |
QM052601 | Methylrosanilinium chloride EP Impurity B CAS# NA M.F.: C24H28ClN3 M.W.: 393.95 |
| |
QS120305 | Methyl salicylate EP Impurity L CAS# 33528-09-5 M.F.: C9H10O3 M.W.: 166.17 |
| |
QS120304 | Methyl salicylate EP Impurity K CAS# 4670-56-8 M.F.: C9H10O3 M.W.: 166.17 |
| |
QS120303 | Methyl salicylate EP Impurity J CAS# 22717-57-3 M.F.: C9H10O3 M.W.: 166.17 |
| |
QS120302 | Methyl salicylate EP Impurity I CAS# 23287-26-5 M.F.: C9H10O3 M.W.: 166.17 |
| |
QC120104 | Clavulanic Acid Impurity 4 CAS# 762-84-5 M.F.: C6H13NO M.W.: 115.17 |
| |
QC010303 | Calcitonin (Salmon) EP Impurity C; Des-22-tyrosine-calcitonin (salmon) CAS# NA M.F.: C136H231N43O46S2 M.W.: 3268.68 |
| |
QI091636 | Ipratropium Bromide Impurity 36 CAS# NA M.F.: C19H28BrNO2 M.W.: 382.34 |
| |
QR092000 | Ritalinic acid CAS# 19395-41-6 M.F.: C13H17NO2 M.W.: 219.28 |
| |
QP140831 | Penehyclidine Impurity 5 CAS# 4397-01-7 M.F.: C12H16O M.W.: 176.25 |
| |
QD030468 | Diclofenac sodium Impurity 68 CAS# NA M.F.: C14H11NO2 M.W.: 225.24 |
| |
QD030467 | Diclofenac sodium Impurity 67 CAS# NA M.F.: C14H11NO3 M.W.: 241.24 |
| |
QT081538 | Theophylline Impurity 38 CAS# NA M.F.: C17H22N8O5 M.W.: 418.41 |
| |
QE201827 | Emtricitabine Impurity 27 CAS# 64282-88-8 M.F.: C10H20O M.W.: 156.27 |
| |
QA152409 | Amphotericin B Impurity 9 CAS# NA M.F.: C47H73NO16 M.W.: 908.08 |
| |
QT182003 | Tropisetron hydrochloride Impurity 3 CAS# NA M.F.: C26H25N3O3 M.W.: 427.50 |
| |
QC042033 | Cefditoren pivoxil Impurity 33 CAS# NA M.F.: C50H56N12O14S6 M.W.: 1241.44 |
| |
QC042032 | Cefditoren pivoxil Impurity 32 CAS# NA M.F.: C27H32N6O8S3 M.W.: 664.77 |
| |
QZ151211 | Zoledronic acid Impurity 11 CAS# NA M.F.: C5H10N2O8P2 M.W.: 288.09 |
| |
QI120119 | Ilaprazole Impurity 19 CAS# NA M.F.: C20H20N4O2S M.W.: 380.46 |
| |
QD152605 | Deoxycholic acid Impurity 5 CAS# 3245-38-3 M.F.: C25H42O4 M.W.: 406.60 |
| |
QR051242 | Relugolix Impurity 42 CAS# NA M.F.: C54H44F4N12O6S2 M.W.: 1097.13 |
| |
QR051234 | Relugolix Impurity 34 CAS# NA M.F.: C24H22F2N2O7S M.W.: 520.50 |
| |
QR051231 | Relugolix Impurity 31 CAS# NA M.F.: C10H11N5O2 M.W.: 233.23 |
| |
QV307797 | cis-Vitamin K1-d7 CAS# NA M.F.: C31H39D7O2 M.W.: 457.74 |
| |
QL052602 | Levomepromazine Maleate EP Impurity B CAS# NA M.F.: C19H24N2O2S M.W.: 344.47 |
| |
QL052601 | Levomepromazine Maleate EP Impurity A CAS# 1771-18-2 M.F.: C13H11NOS M.W.: 229.30 |
| |
QJ150104 | Josamycin Propionate EP Impurity D CAS# NA M.F.: C48H77NO17 M.W.: 940.12 |
| |
QM191232 | Mesalazine Impurity 32 CAS# NA M.F.: C19H14N4O3 M.W.: 346.34 |
| |
QA161213 | Apalutamide Impurity 13 CAS# NA M.F.: C22H8F9N9 M.W.: 569.34 |
| |
QJ150103 | Josamycin Propionate EP Impurity C CAS# NA M.F.: C46H75NO16 M.W.: 898.08 |
| |
QJ150102 | Josamycin Propionate EP Impurity B CAS# NA M.F.: C42H69NO15 M.W.: 827.99 |
| |
QJ150101 | Josamycin Propionate EP Impurity A CAS# NA M.F.: C42H67NO16 M.W.: 841.98 |
| |
QG121503 | Glycocholic Acid Impurity 1 CAS# NA M.F.: C52H84N2O11 M.W.: 913.23 |
| |
QI130903 | Imiquimod Impurity 3 CAS# NA M.F.: C13H15N3O2 M.W.: 245.28 |
| |
QI142504 | Indocyanine Green Impurity 4 CAS# 63149-24-6 M.F.: C19H23NO3S M.W.: 345.46 |
| |
QG042416 | Gadoxetate Disodium Impurity O CAS# NA M.F.: C23H33N3O11 M.W.: 527.52 |
| |
QG042415 | Gadoxetate Disodium Impurity N CAS# NA M.F.: C21H29N3O8 M.W.: 451.47 |
| |
QG042414 | Gadoxetate Disodium Impurity M CAS# NA M.F.: C21H29N3O8 M.W.: 451.47 |
| |
QG042413 | Gadoxetate Disodium Impurity L CAS# NA M.F.: C19H26N2O9 M.W.: 426.42 |
| |
QG042412 | Gadoxetate Disodium Impurity K CAS# NA M.F.: C18H29N3O4 M.W.: 351.44 |
| |
QG042411 | Gadoxetate Disodium Impurity J CAS# NA M.F.: C24H38N4O2.2HCl M.W.: 414.58 72.92 |
| |
QC030701 | Alanyl Glutamine Impurity 1 CAS# NA M.F.: C8H12N2O4 M.W.: 200.19 |
| |
QF140608 | Fenofibric acid-d6 CAS# 1092484-69-9 M.F.: C17H9D6ClO4 M.W.: 324.79 |
| |
QT012801 | Taurocholic acid 3-sulfate CAS# 67030-62-0;71781-33-4(2Na salt) M.F.: C26H45NO10S2 M.W.: 595.77 |
| |
QC080307 | Cholic acid 7-sulfate CAS# 60320-05-0 M.F.: C24H40O8S M.W.: 488.63 |
| |
QQ211500 | Quinoline Yellow CAS# 8004-92-0 M.F.: C18H9NNa2O8S2 M.W.: 477.38 |
| |
QP184600 | Proadifen Hydrochloride CAS# 62-68-0 M.F.: C23H31NO2.HCl M.W.: 353.50 36.46 |
| |
QM010400 | Madecassic acid CAS# 18449-41-7 M.F.: C30H48O6 M.W.: 504.70 |
| |
QR1922149 | Rosuvastatin Impurity 149 CAS# NA M.F.: C20H28FN3O3S M.W.: 409.52 |
| |
QL011404 | Landiolol Impurity 4 CAS# 1253907-81-1;133242-29-2(free base) M.F.: C25H39N3O8.HCl M.W.: 509.59 36.46 |
| |
QE201608 | Ertapenem Impurity 8 CAS# NA M.F.: C12H14N2O4 M.W.: 250.25 |
| |
QD152604 | Deoxycholic Acid 3-O-β-D-Glucuronide Disodium Salt CAS# 59274-67-8 M.F.: C30H46Na2O10 M.W.: 612.66 |
| |
QP090329 | Sodium Picosulfate Impurity 29 CAS# 158839-52-2 M.F.: C12H11NO2 M.W.: 201.22 |
| |
QP090328 | Sodium Picosulfate Impurity 28 CAS# 33455-95-7 M.F.: C12H11NO2 M.W.: 201.22 |
| |
QP090327 | Sodium Picosulfate Impurity 27 CAS# NA M.F.: C18H14NNaO5S M.W.: 379.36 |
| |
QP090326 | Sodium Picosulfate Impurity 26 CAS# NA M.F.: C18H14NNaO5S M.W.: 379.36 |
| |
QP090325 | Sodium Picosulfate Impurity 25 CAS# NA M.F.: C18H14NNaO5S M.W.: 379.36 |
| |
QC-M011206 | Maleopimaric acid CAS# 510-39-4 M.F.: C24H32O5 M.W.: 400.51 |
| |
QP010300 | Pachymic acid CAS# 29070-92-6 M.F.: C33H52O5 M.W.: 528.76 |
| |
QC-M251804 | Myristic acid CAS# 544-63-8 M.F.: C14H28O2 M.W.: 228.37 |
| |
QH250700 | Hydrogenated lecithin CAS# 92128-87-5 M.F.: C42H84NO8P M.W.: 762.09 |
| |
QE261240 | Enzalutamide Impurity 40 CAS# NA M.F.: C18H10F6N4O M.W.: 412.29 |
| |
QP180463 | Perindopril Impurity 63 CAS# NA M.F.: C10H19NO4 M.W.: 217.26 |
| |
QH042508 | Hydrocortisone acetate EP Impurity G CAS# 81968-66-3 M.F.: C25H34O7 M.W.: 446.53 |
| |
QH042507 | Hydrocortisone acetate EP Impurity E CAS# 7753-60-8 M.F.: C23H30O5 M.W.: 386.48 |
| |
QH152002 | Homatropine methylbromide EP Impurity F;Methyl mandelate CAS# 4358-87-6 M.F.: C9H10O3 M.W.: 166.17 |
| |
QC042031 | Cefditoren pivoxil Impurity 31 CAS# NA M.F.: C27H32N6O8S3 M.W.: 664.77 |
| |
QT1406193 | Tenofovir Impurity 193 CAS# NA M.F.: C31H50N5O20P M.W.: 843.72 |
| |
QL090306 | 10,11-Dihydro-10-Hydroxy Carbamazepine-d4 CAS# 1188265-49-7 M.F.: C15H10D4N2O2 M.W.: 258.31 |
| |
QA161910 | Acetylsalicylic Acid-d4 (Aspirin-d4) CAS# 97781-16-3 M.F.: C9H4D4O4 M.W.: 184.18 |
| |
QM031634 | Mycophenolate Mofetil-d4 CAS# 1132748-21-0 M.F.: C23H27D4NO7 M.W.: 437.52 |
| |
QG121809 | Glycyrrhizic Acid Impurity E CAS# NA M.F.: C44H66O16 M.W.: 850.99 |
| |
QG121808 | Licoricesaponin C2 CAS# 118525-49-8 M.F.: C42H62O15 M.W.: 806.93 |
| |
QG121807 | Glycyrrhizic Acid Impurity D CAS# NA M.F.: C44H67NO16 M.W.: 866.00 |
| |
QG121806 | Glycyrrhizic Acid Impurity C CAS# 138268-00-5 M.F.: C42H62O16 M.W.: 822.93 |
| |
QG121805 | Glycyrrhizic Acid Impurity B CAS# 134250-15-0 M.F.: C42H64O15 M.W.: 808.95 |
| |
QG121804 | Licoricesaponin E2 CAS# 119417-96-8 M.F.: C42H60O16 M.W.: 820.92 |
| |
QG121803 | Licoricesaponin A3 CAS# 118325-22-7 M.F.: C48H72O21 M.W.: 985.07 |
| |
QC120910 | Calcipotriol Impurity 10 CAS# NA M.F.: C30H46O3 M.W.: 454.68 |
| |
QH152001 | Homatropine methylbromide EP Impurity A CAS# NA M.F.: C17H22BrNO3 M.W.: 368.27 |
| |
QH152000 | Homatropine methylbromide CAS# 80-49-9 M.F.: C17H24BrNO3 M.W.: 370.28 |
| |
QS150402 | Alendronic Acid Impurity 2 CAS# NA M.F.: C4H12NO8P3 M.W.: 295.06 |
| |
QS150401 | Alendronic Acid Dimeric Anhydride CAS# 165043-20-9 M.F.: C8H22N2O12P4 M.W.: 462.16 |
| |
QL091674 | rac α-Lipoic Acid-d5 CAS# 1189471-66-6 M.F.: C8H9D5O2S2 M.W.: 211.36 |
| |
QB050323 | Beclometasone Dipropionate-d6 CAS# NA M.F.: C28H31D6ClO7 M.W.: 527.08 |
| |
QP032019 | Procaterol Impurity 19 CAS# NA M.F.: C15H20N2O3 M.W.: 276.33 |
| |
QC080306 | Cholic Acid Impurity 6 CAS# NA M.F.: C24H38O4 M.W.: 390.56 |
| |
QC080305 | Cholic Acid Impurity 5 CAS# 105227-28-9 M.F.: C24H40O4 M.W.: 392.57 |
| |
QM031633 | Mycophenolic Acid Impurity 33 CAS# NA M.F.: C21H28O6 M.W.: 376.44 |
| |
QG051903 | Gestodene EP Impurity C;2-isopropanol-gestodene CAS# NA M.F.: C24H32O3 M.W.: 368.51 |
| |
QI132070 | Imatinib Impurity 70 CAS# NA M.F.: C30H33Cl2N7O M.W.: 578.54 |
| |
QC191901 | (E)-Cinnamyl alcohol CAS# 4407-36-7 M.F.: C9H10O M.W.: 134.18 |
| |
QC191900 | Cinnamyl alcohol CAS# 104-54-1 M.F.: C9H10O M.W.: 134.18 |
| |
QE160405 | Eptifibatide Impurity 5 CAS# NA M.F.: C35H49N11O9S2 M.W.: 831.96 |
| |
QB180501 | Brevianamide F CAS# 38136-70-8 M.F.: C16H17N3O2 M.W.: 283.33 |
| |
QC-P251834 | Pyrophosphoric acid CAS# 2466-09-3 M.F.: H4O7P2 M.W.: 177.98 |
| |
QN150400 | Nordeoxycholic acid CAS# 53608-86-9 M.F.: C23H38O4 M.W.: 378.55 |
| |
QT012100 | Taurohyocholic acid CAS# 32747-07-2 M.F.: C26H45NO7S M.W.: 515.70 |
| |
QG123500 | Glycohyocholic acid CAS# 32747-08-3 M.F.: C26H43NO6 M.W.: 465.62 |
| |
QE2620110 | Ezetimibe Impurity 110 CAS# NA M.F.: C26H27F2NO4 M.W.: 455.49 |
| |
QL131102 | Malic Acid Impurity 2 CAS# NA M.F.: C8H8O8 M.W.: 232.14 |
| |
QR131220 | Ramelteon Impurity T CAS# 896736-21-3 M.F.: C16H21NO3 M.W.: 275.34 |
| |
QA164826 | Axitinib Impurity 26 CAS# NA M.F.: C15H12IN3O3S M.W.: 441.24 |
| |
QN140415 | Nintedanib Impurity 15 CAS# 1168152-07-5 M.F.: C20H17NO5 M.W.: 351.35 |
| |
QF211704 | Fluphenazine dihydrochloride EP Impurity F CAS# NA M.F.: C31H44F3N5O3S M.W.: 623.77 |
| |
QF211703 | Fluphenazine dihydrochloride EP Impurity D CAS# NA M.F.: C36H34F6N4S2 M.W.: 700.80 |
| |
QF211702 | Fluphenazine dihydrochloride EP Impurity C CAS# NA M.F.: C35H32F6N4OS2 M.W.: 702.78 |
| |
QC-M151404 | Monooctyl Maleate CAS# 2370-71-0 M.F.: C12H20O4 M.W.: 228.28 |
| |
QF211701 | Fluphenazine dihydrochloride EP Impurity B; Fluphenazine S,S-dioxide CAS# 1476-79-5 M.F.: C22H26F3N3O3S M.W.: 469.52 |
| |
QB051321 | Bempedoic acid Impurity 21 CAS# NA M.F.: C21H40O5 M.W.: 372.54 |
| |
QB051320 | Bempedoic acid Impurity 20 CAS# NA M.F.: C21H38O6 M.W.: 386.52 |
| |
QB051319 | Bempedoic acid Impurity 19 CAS# 738606-64-9 M.F.: C23H44O5 M.W.: 400.59 |
| |
QE202703 | Ethionamide EP Impurity D CAS# 1531-18-6 M.F.: C8H8N2 M.W.: 132.16 |
| |
QE191907 | Estradiol benzoate EP Impurity H CAS# NA M.F.: C27H30O4 M.W.: 418.52 |
| |
QE191906 | Estradiol benzoate EP Impurity G;Estrone benzoate CAS# NA M.F.: C25H26O3 M.W.: 374.47 |
| |
QE191905 | Estradiol benzoate EP Impurity F CAS# NA M.F.: C25H26O3 M.W.: 374.47 |
| |
QE191904 | Estradiol benzoate EP Impurity E CAS# NA M.F.: C25H28O3 M.W.: 376.49 |
| |
QE191903 | Estradiol benzoate EP Impurity D CAS# NA M.F.: C25H28O3 M.W.: 376.49 |
| |
QE191902 | Estradiol benzoate EP Impurity C CAS# NA M.F.: C32H32O4 M.W.: 480.59 |
| |
QE191901 | Estradiol benzoate EP Impurity B CAS# NA M.F.: C26H30O3 M.W.: 390.51 |
| |
QE191900 | Estradiol benzoate CAS# 50-50-0 M.F.: C25H28O3 M.W.: 376.49 |
| |
QE182051 | Erythromycin estolate EP Impurity G CAS# NA M.F.: C39H69NO14 M.W.: 775.96 |
| |
QA261962 | Azilsartan Impurity 62 CAS# NA M.F.: C32H28N4O8 M.W.: 596.59 |
| |
QT142428 | Tranexamic Acid Impurity 28 CAS# NA M.F.: C24H41N3O4 M.W.: 435.60 |
| |
QC083100 | Chlorophyll a CAS# 479-61-8 M.F.: C55H72MgN4O5 M.W.: 893.50 |
| |
QG042410 | Gadoxetate Disodium Impurity I CAS# NA M.F.: C23H28GdN3Na2O11 M.W.: 725.71 |
| |
QG042409 | Gadoxetate Disodium Impurity H CAS# NA M.F.: C23H28GdN3Na2O11 M.W.: 725.71 |
| |
QG011209 | Galantamine hydrobromide Impurity 9 CAS# 134332-50-6 M.F.: C17H21NO4 M.W.: 303.35 |
| |
QI191646 | Isoproterenol Impurity 46 CAS# NA M.F.: C11H15NO3 M.W.: 209.24 |
| |
QI191645 | Isoproterenol Impurity 45 CAS# NA M.F.: C12H16O4 M.W.: 224.25 |
| |
QI182066 | Ibrutinib Impurity 66 CAS# NA M.F.: C16H13NO5 M.W.: 299.28 |
| |
QI182064 | Ibrutinib Impurity 64 CAS# NA M.F.: C16H11NO4 M.W.: 281.26 |
| |
QI150201 | Isochlorogenic acid C CAS# 57378-72-0 M.F.: C25H24O12 M.W.: 516.45 |
| |
QB041437 | Budesonide Impurity 37 CAS# NA M.F.: C23H28O7 M.W.: 416.46 |
| |
QS052500 | Senkyunolide A CAS# 63038-10-8 M.F.: C12H16O2 M.W.: 192.25 |
| |
QG052700 | Genipin 1-gentiobioside CAS# 29307-60-6 M.F.: C23H34O15 M.W.: 550.51 |
| |
QD161503 | Dipotassium clorazepate EP Impurity C CAS# NA M.F.: C18H15ClN2O3 M.W.: 342.78 |
| |
QN051519 | Neostigmine bromide Impurity 19 CAS# NA M.F.: C6H7NO2 M.W.: 125.13 |
| |
QD061400 | Diphenoxylate hydrochloride CAS# 3810-80-8 M.F.: C30H32N2O2.HCl M.W.: 452.59 36.46 |
| |
QI132068 | Imatinib Impurity 68 CAS# NA M.F.: C16H13N5O2 M.W.: 307.31 |
| |
QD162476 | Dapoxetine Impurity 76 CAS# NA M.F.: C18H17ClO2 M.W.: 300.78 |
| |
QP812556 | Paclitaxel Impurity 56 CAS# NA M.F.: C58H58Cl3NO17 M.W.: 1147.44 |
| |
QD091006 | Dicloxacillin sodium Impurity 6 CAS# NA M.F.: C27H27Cl2N5O7S2 M.W.: 668.57 |
| |
QD098107 | Difloxacin hydrochloride trihydrate EP Impurity G CAS# NA M.F.: C16H8ClF2NO3 M.W.: 335.69 |
| |
QD098105 | Difloxacin hydrochloride trihydrate EP Impurity F CAS# NA M.F.: C27H23F3N4O2 M.W.: 492.49 |
| |
QD098104 | Difloxacin hydrochloride trihydrate EP Impurity E CAS# NA M.F.: C21H19ClFN3O3 M.W.: 415.85 |
| |
QS0602104 | Sofosbuvir Impurity 104 CAS# 874638-98-9 M.F.: C17H18FN3O5 M.W.: 363.34 |
| |
QU130505 | Umeclidinium bromide Impurity 5 CAS# NA M.F.: C44H54Br2N2O3 M.W.: 818.72 |
| |
QV307795 | Vitamin K1 Impurity 95 CAS# NA M.F.: C31H46O3 M.W.: 466.70 |
| |
QV307794 | Vitamin K1 Impurity 94 CAS# 85955-78-8 M.F.: C31H46O3 M.W.: 466.70 |
| |
QD091005 | Dicloxacillin sodium Impurity 5 CAS# NA M.F.: C32H27Cl4N5O9S M.W.: 799.46 |
| |
QO240209 | Oxybutynin hydrochloride Impurity 9 CAS# NA M.F.: C11H14O3 M.W.: 194.23 |
| |
QO240208 | Oxybutynin hydrochloride Impurity 8 CAS# NA M.F.: C26H38O M.W.: 366.58 |
| |
QO240207 | Oxybutynin hydrochloride Impurity 7 CAS# NA M.F.: C26H40O2 M.W.: 384.59 |
| |
QC016100 | Caronic anhydride CAS# 67911-21-1 M.F.: C7H8O3 M.W.: 140.14 |
| |
QV091220 | Vilanterol Impurity 20 CAS# 2762285-55-0 M.F.: C48H64Cl4N2O9 M.W.: 954.84 |
| |
QV091215 | Vilanterol Impurity 15 CAS# NA M.F.: C24H33Cl2NO5 M.W.: 486.43 |
| |
QV091212 | Vilanterol Impurity 12 CAS# NA M.F.: C36H53Cl2NO15 M.W.: 810.71 |
| |
QC052001 | Cetrorelix Impurity 1 CAS# NA M.F.: C69H91ClN16O13 M.W.: 1388.01 |
| |
QD098103 | Difloxacin hydrochloride trihydrate EP Impurity D CAS# NA M.F.: C21H19ClFN3O3 M.W.: 415.85 |
| |
QE201937 | Sacubitril Impurity 37 CAS# NA M.F.: C25H31NO4 M.W.: 409.52 |
| |
QV307793 | Vitamin K1 Impurity 93 CAS# NA M.F.: C31H46O3 M.W.: 466.70 |
| |
QA182003 | Arotinolol Impurity 3 CAS# NA M.F.: C15H20N2O3S3 M.W.: 372.53 |
| |
QO121509 | Olodaterol Impurity 9 CAS# NA M.F.: C17H16ClNO4 M.W.: 333.77 |
| |
QO121508 | Olodaterol Impurity 8 CAS# 869478-13-7 M.F.: C28H32N2O5 M.W.: 476.56 |
| |
QL051926 | Levosimendan Impurity 26 CAS# NA M.F.: C11H14N2O2 M.W.: 206.24 |
| |
QD030466 | Diclofenac sodium Impurity 66 CAS# NA M.F.: C14H9Cl3NNaO2 M.W.: 352.58 |
| |
QD030465 | Diclofenac sodium Impurity 65 CAS# NA M.F.: C14H8Cl3NO M.W.: 312.58 |
| |
QD152603 | Deoxycholic acid Impurity 3 CAS# NA M.F.: C26H44O5 M.W.: 436.62 |
| |
QD152602 | Deoxycholic acid Impurity 2 CAS# NA M.F.: C24H40O5 M.W.: 408.57 |
| |
QD152601 | Deoxycholic acid Impurity 1 CAS# 24637-46-5 M.F.: C24H38O4 M.W.: 390.56 |
| |
QF140607 | 2-Chloro Fenofibric Acid CAS# 61024-31-5 M.F.: C17H15ClO4 M.W.: 318.75 |
| |
QC132666 | Cefmetazole sodium Impurity 66 CAS# NA M.F.: C13H16N6O5S3 M.W.: 432.50 |
| |
QC132665 | Cefmetazole sodium Impurity 65 CAS# NA M.F.: C26H25ClN6O5S2 M.W.: 601.10 |
| |
QC132664 | Cefmetazole sodium Impurity 64 CAS# NA M.F.: C26H26N6O5S3 M.W.: 598.72 |
| |
QC132663 | Cefmetazole sodium Impurity 63 CAS# NA M.F.: C28H27N7O5S3 M.W.: 637.75 |
| |
QC132662 | Cefmetazole sodium Impurity 62 CAS# NA M.F.: C24H22N6O3S3 M.W.: 538.66 |
| |
QE1316173 | Empagliflozin Impurity 173 CAS# NA M.F.: C17H17ClO4 M.W.: 320.77 |
| |
QA060307 | Alfacalcidol Impurity 7 CAS# 160796-62-3 M.F.: C27H44O4S M.W.: 464.70 |
| |
QF181952 | Furosemide Impurity 52 CAS# NA M.F.: C16H18ClNO6S M.W.: 387.84 |
| |
QS040688 | Sildenafil Impurity 88 CAS# NA M.F.: C5H12N2O M.W.: 116.16 |
| |
QC152900 | Cortisone acetate; Hydrocortisone acetate EP Impurity D CAS# 50-04-4 M.F.: C23H30O6 M.W.: 402.48 |
| |
QB011223 | Baclofen Impurity 23 CAS# NA M.F.: C9H13ClN2 M.W.: 184.67 |
| |
QC123602 | Clodronate disodium EP Impurity D CAS# 87591-00-2 M.F.: CH5ClO6P2 M.W.: 210.45 |
| |
QC123601 | Clodronate disodium EP Impurity A CAS# 134757-52-1 M.F.: C4H10Cl2O6P2 M.W.: 286.97 |
| |
QC123600 | Clodronate disodium tetrahydrate CAS# NA M.F.: CH2Cl2Na2O6P2.4H2O M.W.: 288.86 72.06 |
| |
QS061431 | Safinamide Impurity 5 CAS# NA M.F.: C17H17FN2O2 M.W.: 300.33 |
| |
QD030464 | Diclofenac sodium Impurity 64 CAS# NA M.F.: C28H16Cl4N2O2 M.W.: 554.25 |
| |
QR0718100 | Regorafenib Impurity 100 CAS# NA M.F.: C8H8FNO2 M.W.: 169.15 |
| |
QR071891 | Regorafenib Impurity 91 CAS# NA M.F.: C20H19N5O4 M.W.: 393.40 |
| |
QR071887 | Regorafenib Impurity 87 CAS# NA M.F.: C12H8ClFN2O2 M.W.: 266.66 |
| |
QR071882 | Regorafenib Impurity 82 CAS# NA M.F.: C13H13N3O3 M.W.: 259.26 |
| |
QR071881 | Regorafenib Impurity 81 CAS# NA M.F.: C12H11FN2O2 M.W.: 234.23 |
| |
QA130242 | Ambroxol Impurity 42 CAS# NA M.F.: C19H22Br2N2O3 M.W.: 486.20 |
| |
QC050514 | Ceftibuten Impurity 14 CAS# 36923-21-4 M.F.: C20H18N2O3S M.W.: 366.43 |
| |
QC050504 | Ceftibuten Impurity 4 CAS# NA M.F.: C20H22N2O4S M.W.: 386.46 |
| |
QB211309 | Bumetanide Impurity 9 CAS# NA M.F.: C7H5ClN2O6S M.W.: 280.64 |
| |
QC082811 | Chlormadinone acetate EP Impurity L CAS# NA M.F.: C23H31ClO4 M.W.: 406.94 |
| |
QC082810 | Chlormadinone acetate EP Impurity K CAS# NA M.F.: C23H30O4 M.W.: 370.48 |
| |
QC082809 | Chlormadinone acetate EP Impurity J; Chlormadinone CAS# 1961-77-9 M.F.: C21H27ClO3 M.W.: 362.89 |
| |
QC082808 | Chlormadinone acetate EP Impurity I CAS# NA M.F.: C25H35ClO4 M.W.: 435.00 |
| |
QC082807 | Chlormadinone acetate EP Impurity H CAS# 1054-64-4 M.F.: C24H34O4 M.W.: 386.52 |
| |
QC082806 | Chlormadinone acetate EP Impurity F CAS# NA M.F.: C24H34O4 M.W.: 386.52 |
| |
QC082805 | Chlormadinone acetate EP Impurity E CAS# 15251-04-4 M.F.: C23H29BrO4 M.W.: 449.38 |
| |
QC050503 | Ceftibuten Impurity 3 CAS# NA M.F.: C13H12N2O4S M.W.: 292.31 |
| |
QC082803 | Chlormadinone acetate EP Impurity C CAS# NA M.F.: C24H33ClO4 M.W.: 420.97 |
| |
QC082802 | Chlormadinone acetate EP Impurity B CAS# NA M.F.: C23H26BrClO4 M.W.: 481.81 |
| |
QO131909 | Olmesartan Medoxomil Impurity 9 CAS# NA M.F.: C53H54N12O8 M.W.: 987.07 |
| |
QR242227 | Roxatidine Impurity 27 CAS# NA M.F.: C10H19ClN2O3 M.W.: 250.72 |
| |
QF210660 | Flurbiprofen Impurity 60 CAS# NA M.F.: C9H9FN2O4 M.W.: 228.18 |
| |
QF210659 | Flurbiprofen Impurity 59 CAS# NA M.F.: C14H17FN2O6 M.W.: 328.29 |
| |
QF210657 | Flurbiprofen Impurity 57 CAS# NA M.F.: C19H20O5 M.W.: 328.36 |
| |
QT1406191 | Tenofovir Impurity 191 CAS# NA M.F.: C53H80N15O26P3 M.W.: 1436.21 |
| |
QP092707 | Pinaverium Bromide Impurity 7 CAS# 38284-47-8;53330-19-1(HCl salt) M.F.: C17H31NO2 M.W.: 281.43 |
| |
QD161408 | Dexpanthenol Impurity 8 CAS# 18679-90-8 M.F.: C10H19NO5 M.W.: 233.26 |
| |
QD161407 | L-Panthenol CAS# 74561-18-5 M.F.: C9H19NO4 M.W.: 205.25 |
| |
QC082902 | Chloramphenicol palmitate EP Impurity B CAS# NA M.F.: C43H72Cl2N2O7 M.W.: 799.95 |
| |
QC082901 | Chloramphenicol palmitate EP Impurity A CAS# NA M.F.: C27H42Cl2N2O6 M.W.: 561.54 |
| |
QC082900 | Chloramphenicol palmitate CAS# 530-43-8 M.F.: C27H42Cl2N2O6 M.W.: 561.54 |
| |
QC052903 | Cefapirin sodium EP Impurity C CAS# NA M.F.: C15H15N3O4S2 M.W.: 365.43 |
| |
QC052902 | Cefapirin sodium EP Impurity B CAS# 104557-24-6(Na salt) M.F.: C15H15N3O5S2 M.W.: 381.43 |
| |
QC052901 | Cefapirin sodium EP Impurity A CAS# NA M.F.: C15H13N3O4S2 M.W.: 363.41 |
| |
QD150423 | Dronedarone Impurity 23 CAS# NA M.F.: C19H16ClNO5 M.W.: 373.79 |
| |
QC180200 | Carbasalate calcium CAS# 5749-67-7 M.F.: C18H14CaO8.CH4N2O M.W.: 398.38 60.06 |
| |
QH042506 | Hydrocortisone Acetate EP Impurity F; epi-Hydrocortisone Acetate CAS# 1250-97-1 M.F.: C23H32O6 M.W.: 404.50 |
| |
QP0203100 | Palbociclib Impurity 100 CAS# NA M.F.: C13H13Cl2N3O M.W.: 298.17 |
| |
QP020398 | Palbociclib Impurity 98 CAS# 119285-07-3 M.F.: C14H22N4O2 M.W.: 278.35 |
| |
QI071837 | Iguratimod Impurity 37 CAS# NA M.F.: C18H19NO6S M.W.: 377.41 |
| |
QF150901 | Calcium Folinate Hydrate EP Impurity E CAS# 4349-43-3 M.F.: C15H16N6O4 M.W.: 344.33 |
| |
QP081844 | Phloroglucinol Impurity 44 CAS# 23957-21-3 M.F.: C8H10BrNO2 M.W.: 232.07 |
| |
QI192271 | Isavuconazole Impurity 71 CAS# NA M.F.: C50H55ClF2N10O10S M.W.: 1061.55 |
| |
QB200109 | Betamethasone Dipropionate EP Impurity I CAS# 80163-83-3 M.F.: C28H39FO7 M.W.: 506.60 |
| |
QD0207102 | Dabigatran Etexilate Impurity 102 CAS# 1900865-84-0 M.F.: C16H12N4O M.W.: 276.29 |
| |
QD0207101 | Dabigatran Etexilate Impurity 101 CAS# 18358-63-9 M.F.: C9H11NO2 M.W.: 165.19 |
| |
QS0102106 | Salbutamol Impurity 106 CAS# NA M.F.: C22H31NO6 M.W.: 405.48 |
| |
QS0102105 | Salbutamol Impurity 105 CAS# 1888806-75-4 M.F.: C8H9BrO2 M.W.: 217.06 |
| |
QS010298 | Salbutamol Impurity 98 CAS# 1044764-21-7 M.F.: C9H11NO3 M.W.: 181.19 |
| |
QM200315 | Metoclopramide Impurity 15 CAS# 3761-48-6 M.F.: C14H23N3O2 M.W.: 265.35 |
| |
QT011415 | Tandospirone Impurity 15 CAS# NA M.F.: C13H18BrNO2 M.W.: 300.19 |
| |
QM131931 | 21-Acetyloxy Deschloromometasone Furoate CAS# 83897-05-6 M.F.: C29H33ClO8 M.W.: 545.02 |
| |
QI091635 | Ipratropium Bromide Impurity 35 CAS# NA M.F.: C11H19NO2 M.W.: 197.27 |
| |
QF130427 | Famotidine Impurity 27 CAS# NA M.F.: C9H15N7O2S3 M.W.: 349.46 |
| |
QI192901 | Gambogic acid CAS# 2752-65-0 M.F.: C38H44O8 M.W.: 628.75 |
| |
QI192267 | Isavuconazole Impurity 67 CAS# NA M.F.: C15H23N3O4 M.W.: 309.36 |
| |
QD0207100 | Dabigatran Etexilate Impurity 100 CAS# NA M.F.: C18H22N4O3 M.W.: 342.39 |
| |
QD020799 | Dabigatran Etexilate Impurity 99 CAS# NA M.F.: C18H22N4O3 M.W.: 342.39 |
| |
QD020798 | Dabigatran Etexilate Impurity 98 CAS# NA M.F.: C27H28N6O4 M.W.: 500.55 |
| |
QI191643 | Isoproterenol Impurity 43 CAS# 3868-81-3 M.F.: C12H19NO3.HCl M.W.: 225.28 36.46 |
| |
QC-C250351 | cyclohexylmethanol;Benzyl alcohol EP Impurity B CAS# 100-49-2 M.F.: C7H14O M.W.: 114.19 |
| |
QP053100 | Pelargonidin chloride CAS# 134-04-3 M.F.: C15H11ClO5 M.W.: 306.70 |
| |
QT130611 | Tamoxifen Citrate Impurity 11 CAS# NA M.F.: C28H35NO2 M.W.: 417.58 |
| |
QA260406 | Ricinoleic acid CAS# 141-22-0 M.F.: C18H34O3 M.W.: 298.46 |
| |
QR457048 | Rocuronium bromide Impurity 48;Androsterone CAS# 53-41-8 M.F.: C19H30O2 M.W.: 290.44 |
| |
QB053406 | Benzydamine Hydrochloride EP Impurity F CAS# 87453-75-6 M.F.: C12H18N2O2 M.W.: 222.28 |
| |
QB053405 | Benzydamine Hydrochloride EP Impurity E CAS# 52413-42-0;85284-06-6(HCl salt) M.F.: C19H23N3O M.W.: 309.41 |
| |
QB053404 | Benzydamine Hydrochloride EP Impurity D CAS# 1337966-15-0 M.F.: C23H32N4O M.W.: 380.53 |
| |
QB053403 | Benzydamine Hydrochloride EP Impurity C CAS# 2215-63-6 M.F.: C14H12N2O M.W.: 224.26 |
| |
QB053402 | Benzydamine Hydrochloride EP Impurity B CAS# 1797879-37-8;2196183-71-6(HCl salt) M.F.: C26H29N3O M.W.: 399.53 |
| |
QB053401 | Benzydamine Hydrochloride EP Impurity A CAS# 87453-76-7;2196185-65-4(HCl salt) M.F.: C19H24N2O2 M.W.: 312.41 |
| |
QB053400 | Benzydamine Hydrochloride CAS# 132-69-4 M.F.: C19H23N3O.HCl M.W.: 309.41 36.46 |
| |
QC065303 | 1-Caffeoylquinic acid CAS# 1241-87-8 M.F.: C16H18O9 M.W.: 354.31 |
| |
QI142503 | Indocyanine Green Impurity 3 CAS# NA M.F.: C44H50N2O6S2 M.W.: 767.01 |
| |
QI142502 | Indocyanine Green Impurity 2 CAS# NA M.F.: C44H50N2O6S2 M.W.: 767.01 |
| |
QI142501 | Indocyanine Green N-Oxide CAS# NA M.F.: C43H47N2NaO7S2 M.W.: 790.96 |
| |
QI142500 | Indocyanine Green CAS# 3599-32-4 M.F.: C43H47N2NaO6S2 M.W.: 774.96 |
| |
QP090324 | Sodium Picosulfate Impurity 24 CAS# NA M.F.: C19H17NO3 M.W.: 307.34 |
| |
QL010320 | L-Alanine Isopropyl Ester Lactose Adduct CAS# NA M.F.: C18H33NO12 M.W.: 455.45 |
| |
QL091673 | Lipoic Acid Impurity 73 CAS# NA M.F.: C10H18O2S3 M.W.: 266.44 |
| |
QZ151210 | Zoledronic acid Impurity 10 CAS# 239065-60-2 M.F.: C8H12N2O2 M.W.: 168.19 |
| |
QI192900 | Isogambogic acid CAS# 149655-52-7 M.F.: C38H44O8 M.W.: 628.75 |
| |
QE161700 | Epigambogic acid CAS# 887606-04-4 M.F.: C38H44O8 M.W.: 628.75 |
| |
QG010200 | Gambogenic acid CAS# 173932-75-7 M.F.: C38H46O8 M.W.: 630.77 |
| |
QM154300 | Morellic acid CAS# 5304-71-2 M.F.: C33H36O8 M.W.: 560.63 |
| |
QF123702 | Florfenicol Impurity 2 CAS# NA M.F.: C12H14Cl2FNO4S M.W.: 358.21 |
| |
QT161894 | Topiroxostat Impurity 94 CAS# NA M.F.: C8H5N5O M.W.: 187.16 |
| |
QP160533 | Prednisone EP Impurity K CAS# 7738-93-4 M.F.: C19H22O3 M.W.: 298.38 |
| |
QI192265 | Isavuconazole Impurity 65 CAS# NA M.F.: C40H43ClF2N8O7S M.W.: 853.33 |
| |
QA261960 | Azilsartan Impurity 60 CAS# 91526-16-8 M.F.: C12H12O6S M.W.: 284.29 |
| |
QD242615 | Doxazosin Impurity 15 CAS# 60547-96-8 M.F.: C10H12N4O2 M.W.: 220.23 |
| |
QS040687 | Sildenafil Impurity 87 CAS# 501120-38-3 M.F.: C17H22N4O3 M.W.: 330.38 |
| |
QD141647 | Donepezil Impurity 47 CAS# NA M.F.: C24H29NO3.HCl M.W.: 379.49 36.46 |
| |
QC150900 | Colistin sulfate CAS# 1264-72-8 M.F.: C53H100N16O13.5/2H2SO4+C52H98N16O13.5/2H2SO4 M.W.: 1169.46 245.20+1155.43 245.20 |
| |
QP090323 | Sodium Picosulfate Impurity 23 CAS# NA M.F.: C22H19NO4 M.W.: 361.39 |
| |
QP090322 | Sodium Picosulfate Impurity 22 CAS# NA M.F.: C22H19NO4 M.W.: 361.39 |
| |
QV011232 | Valproic Acid Impurity 32 CAS# NA M.F.: C15H28O4 M.W.: 272.38 |
| |
QV011231 | Valproic Acid Impurity 31 CAS# NA M.F.: C14H26O4 M.W.: 258.35 |
| |
QC-H042405 | Butyl parahydroxybenzoate; Propyl Parahydroxybenzoate EP Impurity D; Sodium ethyl parahydroxybenzoate EP Impurity D CAS# 94-26-8 M.F.: C11H14O3 M.W.: 194.23 |
| |
QG011208 | N-Nitroso Galantamine EP Impurity E CAS# NA M.F.: C16H18N2O4 M.W.: 302.33 |
| |
QO131908 | Olmesartan Medoxomil Impurity 8 CAS# NA M.F.: C49H53ClN8O10 M.W.: 949.45 |
| |
QM122507 | Melatonin Impurity 7 CAS# 188397-16-2 (keton form), 229018-17-1 (enol form) M.F.: C13H16N2O3 M.W.: 248.28 |
| |
QO260765 | Ozagrel Impurity 65 CAS# 67688-89-5(HCl salt) M.F.: C10H11NO2 M.W.: 177.20 |
| |
QA0702108 | Argatroban Impurity 108 CAS# NA M.F.: C15H28N6O5 M.W.: 372.42 |
| |
QS041920 | Sodium Valproate Impurity 20 CAS# 258264-00-5 M.F.: C11H20O4 M.W.: 216.27 |
| |
QI091634 | Ipratropium Bromide Impurity 34 CAS# NA M.F.: C20H28BrNO2 M.W.: 394.35 |
| |
QP182712 | Piribedil Impurity 12 CAS# 1580471-72-2 M.F.: C8H8Cl2O2 M.W.: 207.05 |
| |
QP182707 | Piribedil Impurity 7 CAS# 55436-41-4 M.F.: C20H22N2O4 M.W.: 354.40 |
| |
QP182706 | Piribedil Impurity 6 CAS# 443694-35-7 M.F.: C12H18N2O2 M.W.: 222.28 |
| |
QP182704 | Piribedil Impurity 4 CAS# NA M.F.: C7H7ClO2 M.W.: 158.58 |
| |
QR210601 | Rufinamide USP Related Compound A CAS# 106308-41-2 M.F.: C10H9FN4O M.W.: 220.20 |
| |
QB010437 | Bazedoxifene Acetate Impurity 37 CAS# NA M.F.: C44H46N2O3 M.W.: 650.85 |
| |
QR152439 | Roxadustat Impurity 39 CAS# NA M.F.: C22H22N2O5 M.W.: 394.42 |
| |
QI192251 | Isavuconazole Impurity 51 CAS# 2069200-13-9 M.F.: C13H12F2N4O M.W.: 278.26 |
| |
QO121828 | Olprinone Impurity 28 CAS# NA M.F.: C12H14N2O M.W.: 202.25 |
| |
QM031632 | Mycophenolic Acid Impurity 32 CAS# NA M.F.: C23H32O11 M.W.: 484.49 |
| |
QV200107 | Vitamin A Impurity 7 CAS# 34356-30-4 M.F.: C36H60O2 M.W.: 524.86 |
| |
QV041424 | Vardenafil Impurity 24 CAS# NA M.F.: C17H19ClN4O2 M.W.: 346.81 |
| |
QT260400 | Trazodone hydrochloride CAS# 25332-39-2 M.F.: C19H22ClN5O.HCl M.W.: 371.86 36.46 |
| |
QT1406183 | Tenofovir Impurity 183 CAS# NA M.F.: C33H49N6O15P M.W.: 800.75 |
| |
QU190449 | Deoxycholic Acid Ethyl Ester CAS# 69519-35-3 M.F.: C26H44O4 M.W.: 420.63 |
| |
QD150211 | Dobutamine Impurity 11 CAS# 69617-84-1 M.F.: C10H14O2 M.W.: 166.22 |
| |
QC-H052419 | Hexadecanedioic acid CAS# 505-54-4 M.F.: C16H30O4 M.W.: 286.41 |
| |
QP092706 | Pinaverium Bromide Impurity 6 CAS# 135964-95-3 M.F.: C26H41Br2NO4 M.W.: 591.42 |
| |
QP092705 | Pinaverium Bromide Impurity 5 CAS# 1970218-70-2 M.F.: C26H41Br2NO4 M.W.: 591.42 |
| |
QC061914 | Ceftaroline Fosamil Impurity N CAS# 1286218-68-5 M.F.: C44H40N16O15P2S8 M.W.: 1351.35 |
| |
QC061913 | Ceftaroline Fosamil Impurity M CAS# 1277090-04-6 M.F.: C28H35N12O10PS4 M.W.: 858.89 |
| |
QC061912 | Ceftaroline Fosamil CAS# 229016-73-3 M.F.: C22H21N8O8PS4 M.W.: 684.68 |
| |
QC061911 | Ceftaroline Fosamil Impurity K CAS# 1286218-64-1 M.F.: C22H22N8O11P2S4 M.W.: 764.66 |
| |
QE161249 | Epalrestat Impurity 23 CAS# 15289-56-2 M.F.: C13H11NOS2 M.W.: 261.36 |
| |
QL252028 | Lysine Impurity 28; DL-Lysine acetylsalicylate EP Impurity C CAS# NA M.F.: C12H26N4O3 M.W.: 274.36 |
| |
QZ121623 | Zolpidem tartrate Impurity 23 CAS# NA M.F.: C19H25N3O M.W.: 311.42 |
| |
QG211205 | Sodium Gualenate Impurity 5 CAS# NA M.F.: C5H8N2O2 M.W.: 128.13 |
| |
QD020797 | Dabigatran Etexilate Impurity 97 CAS# 1307233-94-8 M.F.: C20H21ClN4O3 M.W.: 400.86 |
| |
QD241358 | Dexamethasone Impurity 58 CAS# 6762-51-2 M.F.: C22H27FO4 M.W.: 374.45 |
| |
QI591816 | Imidacloprid Impurity 16 CAS# 380912-09-4 M.F.: C9H10ClN5O3 M.W.: 271.66 |
| |
QC-M052504 | methyl 2-amino-3-bromobenzoate CAS# 104670-74-8 M.F.: C8H8BrNO2 M.W.: 230.06 |
| |
QL032002 | Lactitol monohydrate EP Impurity B;Lactulitol CAS# 53796-37-5 M.F.: C12H24O11 M.W.: 344.31 |
| |
QA163003 | Apremilast Impurity W CAS# 253168-94-4 M.F.: C12H19NO4S M.W.: 273.35 |
| |
QL091672 | Lipoic Acid Impurity 46 CAS# NA M.F.: C8H14O3S2 M.W.: 222.32 |
| |
QN151863 | Noradrenaline (Norepinephrine) Impurity 63 CAS# NA M.F.: C9H13NO6S M.W.: 263.27 |
| |
QD160701 | Dapagliflozin Impurity A CAS# 1807632-95-6 M.F.: C21H25BrO6 M.W.: 453.32 |
| |
QP091326 | Pimavanserin Impurity 26 CAS# NA M.F.: C25H34FN3O2 M.W.: 427.55 |
| |
QP180458 | Perindopril EP Impurity X CAS# NA M.F.: C19H32N2O5 M.W.: 368.47 |
| |
QP180453 | Perindopril EP Impurity Q CAS# NA M.F.: C19H32N2O5 M.W.: 368.47 |
| |
QD090710 | Diclazuril Impurity 10 CAS# 103317-59-5 M.F.: C14H7Cl3N2O2 M.W.: 341.58 |
| |
QP261639 | Pazopanib Impurity 39 CAS# NA M.F.: C34H34N12O2S M.W.: 674.78 |
| |
QP181679 | Pramipexole Impurity 79 CAS# 106006-83-1 M.F.: C7H11N3S M.W.: 169.25 |
| |
QC120453 | Clindamycin Pentadecanoate CAS# 1123211-67-5 M.F.: C33H61ClN2O6S M.W.: 649.37 |
| |
QG270101 | GCTA Impurity 1 CAS# NA M.F.: C29H27N3O5S2 M.W.: 561.67 |
| |
QC042024 | Cefditoren pivoxil Impurity 24 CAS# NA M.F.: C19H17N6NaO5S3 M.W.: 528.56 |
| |
QT180126 | Travoprost Impurity 26 CAS# NA M.F.: C24H30O4Si M.W.: 410.58 |
| |
QC012311 | Carteolol Impurity 11 CAS# NA M.F.: C9H8BrNO2 M.W.: 242.07 |
| |
QC042023 | Cefditoren pivoxil Impurity 23 CAS# NA M.F.: C50H56N12O14S6 M.W.: 1241.44 |
| |
QC042022 | Cefditoren pivoxil Impurity 22 CAS# 878002-85-8 M.F.: C51H56N12O14S6 M.W.: 1253.45 |
| |
QI191641 | Isoproterenol Impurity 15 CAS# NA M.F.: C11H17NO3 M.W.: 211.26 |
| |
QR152436 | Roxadustat Impurity 36 CAS# 1455091-04-9 M.F.: C15H13ClO3 M.W.: 276.71 |
| |
QT031241 | Tacrolimus Impurity 41 CAS# NA M.F.: C46H75NO13 M.W.: 850.09 |
| |
QH251400 | Sodium Hyaluronate CAS# 9067-32-7 M.F.: (C14H20NNaO11)n M.W.: NA |
| |
QK201841 | Ketorolac Impurity 41 CAS# NA M.F.: C17H17NO3 M.W.: 283.32 |
| |
QA200118 | Atazanavir EP Impurity H CAS# NA M.F.: C38H52N6O7 M.W.: 704.86 |
| |
QH150918 | Hyoscine Butylbromide EP Impurity H CAS# NA M.F.: C21H32BrNO3 M.W.: 426.39 |
| |
QA200116 | Atazanavir EP Impurity F CAS# 1332981-14-2 M.F.: C38H52N6O7 M.W.: 704.86 |
| |
QV091208 | Vilanterol Impurity 8 CAS# 452340-96-4 M.F.: C13H15NO4 M.W.: 249.26 |
| |
QP090321 | Sodium Picosulfate Impurity 21 CAS# NA M.F.: C18H13NNa2O8S2 M.W.: 481.41 |
| |
QA164183 | Avanafil Impurity 57 CAS# NA M.F.: C40H43Cl2N11O6 M.W.: 844.75 |
| |
QF122046 | Fluticasone Furoate EP Impurity I CAS# NA M.F.: C27H29F3O6S M.W.: 538.58 |
| |
QB051318 | Bempedoic acid Impurity 18 CAS# NA M.F.: C38H70O9 M.W.: 670.96 |
| |
QT201625 | Tiotropium bromide Impurity 25 CAS# 3141-26-2 M.F.: C4H2Br2S M.W.: 241.93 |
| |
QT201624 | Tiotropium bromide Impurity 24 CAS# 3140-93-0 M.F.: C4H2Br2S M.W.: 241.93 |
| |
QT201623 | Tiotropium bromide Impurity 23 CAS# 3141-27-3 M.F.: C4H2Br2S M.W.: 241.93 |
| |
QT201622 | Tiotropium bromide Impurity 22 CAS# 3140-92-9 M.F.: C4H2Br2S M.W.: 241.93 |
| |
QU190447 | Ursodeoxycholic Acid Impurity 47 CAS# 2393-61-5 M.F.: C24H38O4 M.W.: 390.56 |
| |
QR051224 | Relugolix Impurity 24 CAS# NA M.F.: C30H28F2N6O5S M.W.: 622.64 |
| |
QF121936 | Fulvestrant Impurity 36 CAS# NA M.F.: C5H5F5I2O3S M.W.: 493.96 |
| |
QO162023 | Olopatadine Impurity 23 CAS# NA M.F.: C20H21NO2 HCl M.W.: 307.39 36.46 |
| |
QU190446 | Ursodeoxycholic Acid Impurity 46 CAS# 71883-64-2 M.F.: C24H40O5 M.W.: 408.57 |
| |
QU190445 | Ursodeoxycholic Acid Impurity 45 CAS# 14772-92-0 M.F.: C25H40O5 M.W.: 420.58 |
| |
QB211400 | Butenafine CAS# 101828-21-1 M.F.: C23H27N M.W.: 317.47 |
| |
QU190443 | Ursodeoxycholic Acid Impurity 43 CAS# 108266-90-6 M.F.: C24H40O5 M.W.: 408.57 |
| |
QU190442 | Ursodeoxycholic Acid Impurity 42 CAS# 67008-26-8 M.F.: C24H38O4 M.W.: 390.56 |
| |
QU190441 | Ursodeoxycholic Acid Impurity 41 CAS# 110107-03-4 M.F.: C24H38O4 M.W.: 390.56 |
| |
QD030459 | Diclofenac sodium Impurity 59 CAS# NA M.F.: C15H11Cl2NO M.W.: 292.16 |
| |
QC061357 | Cefotiam Impurity 57 CAS# NA M.F.: C36H44N18O7S6 M.W.: 1033.24 |
| |
QU190438 | 12-Ketolithocholic acid CAS# 5130-29-0 M.F.: C24H38O4 M.W.: 390.56 |
| |
QU190437 | 3-Hydroxy-7,12-diketocholanoic acid CAS# 517-33-9 M.F.: C24H36O5 M.W.: 404.54 |
| |
QS067647 | Salicylic Acid Impurity 47 CAS# NA M.F.: C7H4NNaO4 M.W.: 189.10 |
| |
QS067646 | Salicylic Acid Impurity 46 CAS# 1172605-63-8(free base) M.F.: C7H4NNaO4 M.W.: 189.10 |
| |
QA131255 | Amlodipine Impurity 55 CAS# 140171-49-9 M.F.: C29H29ClN2O7 M.W.: 553.00 |
| |
QO022033 | Obeticholic Acid Impurity 33 CAS# NA M.F.: C35H52O5Si M.W.: 580.87 |
| |
QN051819 | Neratinib Impurity 19 CAS# 20629-35-0 M.F.: C4H5BrO2 M.W.: 164.99 |
| |
QD053401 | Delfaprazine Impurity 1 CAS# 791026-42-1 M.F.: C17H19ClN2 M.W.: 286.80 |
| |
QR1922137 | Rosuvastatin Impurity 137 CAS# NA M.F.: C13H15NO5S2 M.W.: 329.39 |
| |
QR1922134 | Rosuvastatin Impurity 134 CAS# NA M.F.: C20H27NO5S2 M.W.: 425.56 |
| |
QR1922133 | Rosuvastatin Impurity 133 CAS# 325471-28-1 M.F.: C10H19ClO4 M.W.: 238.71 |
| |
QR1922131 | Rosuvastatin Impurity 131 CAS# NA M.F.: C13H15NO4S2 M.W.: 313.39 |
| |
QR1922130 | Rosuvastatin Impurity 130 CAS# NA M.F.: C16H19NO4S2 M.W.: 353.46 |
| |
QC022655 | Cabozantinib Impurity 55 CAS# 1355031-15-0 M.F.: C16H14N2O3 M.W.: 282.29 |
| |
QT011409 | Tandospirone Impurity 9 CAS# NA M.F.: C21H27N5O3 M.W.: 397.47 |
| |
QG122201 | Glutamic Acid Impurity 1 CAS# 3929-61-1 M.F.: C10H16N2O7 M.W.: 276.24 |
| |
QT180685 | Tirofiban Impurity 85 CAS# NA M.F.: C12H17Cl2N M.W.: 246.18 |
| |
QO242801 | Oxonic Acid Impurity 1 CAS# 60301-55-5 M.F.: C3H3N3O2 M.W.: 113.07 |
| |
QP1903174 | Posaconazole Impurity 174 CAS# NA M.F.: C24H31N5O3 M.W.: 437.53 |
| |
QA261950 | Azilsartan Impurity 50 CAS# NA M.F.: C29H23N3O6 M.W.: 509.51 |
| |
QA261949 | Azilsartan Impurity 49 CAS# NA M.F.: C27H22N4O7 M.W.: 514.49 |
| |
QZ010600 | Zafirlukast CAS# 107753-78-6 M.F.: C31H33N3O6S M.W.: 575.68 |
| |
QB011216 | Baclofen Impurity 16 CAS# NA M.F.: C20H20Cl2N2O2 M.W.: 391.29 |
| |
QB011212 | Baclofen Impurity 12 CAS# NA M.F.: C20H22Cl2N2O3 M.W.: 409.31 |
| |
QS212600 | Sulfadimethoxine CAS# 122-11-2 M.F.: C12H14N4O4S M.W.: 310.33 |
| |
QM201826 | Metaraminol Impurity 26 CAS# 1075-61-2;54779-56-5(HCl salt) M.F.: C9H13NO M.W.: 151.21 |
| |
QL091671 | Lipoic Acid Impurity 45 CAS# NA M.F.: C12H20N2OS2 M.W.: 272.43 |
| |
QA161884 | Aprepitant Impurity 84 CAS# NA M.F.: C21H19F6NO3 M.W.: 447.37 |
| |
QP160628 | Propofol Impurity 28 CAS# NA M.F.: C13H18O3 M.W.: 222.28 |
| |
QT0307195 | Ticagrelor Impurity 195 CAS# 1345413-20-8(free base) M.F.: C9H9F2N C8H8O3 M.W.: 169.17 152.15 |
| |
QV011230 | Valproic Acid Impurity 4 CAS# NA M.F.: C6H12O2 M.W.: 116.16 |
| |
QL091670 | Lipoic Acid Impurity 44 CAS# NA M.F.: C10H18O2S M.W.: 202.31 |
| |
QF120322 | Folic Acid Impurity 22 CAS# 1148179-25-2 M.F.: C21H25N7O7 M.W.: 487.47 |
| |
QP160625 | Propofol Impurity 25 CAS# NA M.F.: C26H34O5 M.W.: 426.55 |
| |
QE2003111 | Entecavir Impurity 111 CAS# NA M.F.: C51H47N5O4 M.W.: 793.95 |
| |
QE1316157 | Empagliflozin Impurity 157 CAS# NA M.F.: C17H17BrO2 M.W.: 333.22 |
| |
QM142414 | Minoxidil Impurity 14 CAS# NA M.F.: C4H5ClN4O M.W.: 160.56 |
| |
QO1920129 | Oseltamivir Impurity 129 CAS# NA M.F.: C24H42N2O3 M.W.: 406.60 |
| |
QO1920128 | Oseltamivir Impurity 128 CAS# NA M.F.: C24H42N2O3 M.W.: 406.60 |
| |
QT142427 | Tranexamic Acid Impurity 27 CAS# NA M.F.: C8H7Cl2NO M.W.: 204.05 |
| |
QO201567 | Vortioxetine Impurity 41 CAS# 1025895-66-2 M.F.: C17H19NS M.W.: 269.40 |
| |
QO201566 | Vortioxetine Impurity 40 CAS# 62755-64-0 M.F.: C16H18N2O M.W.: 254.33 |
| |
QO022026 | Obeticholic Acid Impurity 26 CAS# 4185-00-6 M.F.: C24H38O4 M.W.: 390.56 |
| |
QU190436 | Ursodeoxycholic Acid Impurity 36 CAS# 77059-13-3 M.F.: C24H38O4 M.W.: 390.56 |
| |
QM200508 | Methylene Blue Impurity 8 CAS# 823802-43-3 M.F.: C12H7N3O4S M.W.: 289.27 |
| |
QM200507 | Methylene Blue Impurity 7 CAS# 860443-88-5 M.F.: C12H5N5O8S M.W.: 379.26 |
| |
QM200506 | Methylene Blue Impurity 6 CAS# 1747-87-1 M.F.: C12H8N2O2S M.W.: 244.27 |
| |
QM200505 | Methylene Blue Impurity 5 CAS# 1628-76-8 M.F.: C12H8N2O2S M.W.: 244.27 |
| |
QM200504 | Methylene Blue Impurity 4 CAS# 1628-77-9 M.F.: C12H8N2O2S M.W.: 244.27 |
| |
QM200503 | Methylene Blue Impurity 3 CAS# 77529-65-8 M.F.: C12H6N4O6S M.W.: 334.26 |
| |
QM200502 | Methylene Blue Impurity 2 CAS# NA M.F.: C12H7N3O4S M.W.: 289.27 |
| |
QM200501 | Methylene Blue Impurity 1 CAS# 1628-78-0 M.F.: C12H7N3O4S M.W.: 289.27 |
| |
QR152434 | Roxadustat Impurity 34 CAS# 1421312-34-6 M.F.: C18H15NO4 M.W.: 309.32 |
| |
QP160622 | Propofol Impurity 22 CAS# 2005-09-6 M.F.: C19H22O2 M.W.: 282.38 |
| |
QS040675 | Sildenafil Impurity 75 CAS# 17243-13-9 M.F.: C7H5ClO5S M.W.: 236.63 |
| |
QM092609 | Mizolastine Impurity 9 CAS# 935860-12-1 M.F.: C25H27FN6O M.W.: 446.52 |
| |
QC182585 | Canagliflozin Impurity 85 CAS# NA M.F.: C24H25FO7S M.W.: 476.51 |
| |
QP011408 | Pantothenic acid calcium Impurity 8 CAS# NA M.F.: C18H32CaN2O10 M.W.: 476.53 |
| |
QP011407 | Pantothenic acid calcium Impurity 7 CAS# NA M.F.: C10H17NO5 M.W.: 231.25 |
| |
QA220139 | Avatrombopag Impurity 39 CAS# NA M.F.: C29H34Cl2N6O4S2 M.W.: 665.65 |
| |
QT082000 | L-Threonic Acid CAS# 7306-96-9;70753-61-6(Ca salt) M.F.: C4H8O5 M.W.: 136.10 |
| |
QT201621 | Tiotropium bromide Impurity 21 CAS# NA M.F.: C19H21ClINO3S2 M.W.: 537.86 |
| |
QE2620104 | Ezetimibe Impurity 104 CAS# 2280081-72-1 M.F.: C39H47FN2O5Si2 M.W.: 698.97 |
| |
QP182254 | Peramivir Impurity 54 CAS# NA M.F.: C16H28N2O5 M.W.: 328.40 |
| |
QR1922123 | Rosuvastatin Impurity 123 CAS# NA M.F.: C22H28FN3O6S M.W.: 481.54 |
| |
QM071204 | Miglitol Impurity 4 CAS# NA M.F.: C8H11NO2 M.W.: 153.18 |
| |
QP1903161 | Posaconazole Impurity 161 CAS# 1185745-03-2 M.F.: C34H45N5O5 M.W.: 603.75 |
| |
QP1903158 | Posaconazole Impurity 158 CAS# NA M.F.: C16H19N3O M.W.: 269.34 |
| |
QN022228 | Nebivolol Impurity 28 CAS# NA M.F.: C20H37N M.W.: 291.51 |
| |
QD241355 | Dexamethasone Impurity 55 CAS# 1188271-71-7(aldehyde form) M.F.: C22H29FO5.C22H27FO4 M.W.: 392.47 374.45 |
| |
QB051317 | Bempedoic acid Impurity 17 CAS# 2570179-40-5 M.F.: C25H48O6 M.W.: 444.65 |
| |
QE191330 | Esmolol Impurity 30 CAS# 495-78-3 M.F.: C9H10O3 M.W.: 166.17 |
| |
QE191328 | Esmolol Impurity 28 CAS# 22367-76-6 M.F.: C9H11NO2 M.W.: 165.19 |
| |
QE191325 | Esmolol Impurity 25 CAS# NA M.F.: C28H39NO8 M.W.: 517.61 |
| |
QL091669 | Lipoic Acid Impurity 43 CAS# NA M.F.: C10H20O2S2 M.W.: 236.39 |
| |
QL091668 | Lipoic Acid Impurity 42 CAS# NA M.F.: C10H18O2S M.W.: 202.31 |
| |
QL091667 | Lipoic Acid Impurity 41 CAS# NA M.F.: C16H26O5S4 M.W.: 426.63 |
| |
QV091206 | Vilanterol Impurity 6 CAS# NA M.F.: C24H31Cl2NO5 M.W.: 484.41 |
| |
QP051207 | Penicillin Impurity 7 CAS# NA M.F.: C16H18N2O6S M.W.: 366.39 |
| |
QA661222 | Ampicillin Impurity 22 CAS# NA M.F.: C24H33N3O5S M.W.: 475.60 |
| |
QI131200 | Imiprothrin CAS# 72963-72-5 M.F.: C17H22N2O4 M.W.: 318.37 |
| |
QN022225 | Nebivolol Impurity 25 CAS# 1346562-35-3 M.F.: C22H21F2NO4 M.W.: 401.40 |
| |
QL051301 | Folinic Acid Impurity 1 CAS# 4349-41-1 M.F.: C15H18N6O3 M.W.: 330.34 |
| |
QB180961 | Brivaracetam Impurity 35 CAS# NA M.F.: C11H21BrN2O2 M.W.: 293.20 |
| |
QV180395 | Voriconazole Impurity 69 CAS# NA M.F.: C16H13BrF3N5O M.W.: 428.21 |
| |
QV180394 | Voriconazole Impurity 68 CAS# NA M.F.: C16H14F3N5O2 M.W.: 365.31 |
| |
QT0307194 | Ticagrelor Impurity 194 CAS# 2204313-65-3 M.F.: C17H27ClN4O6S M.W.: 450.94 |
| |
QM151700 | Metopimazine Acid CAS# 18182-00-8 M.F.: C22H26N2O4S2 M.W.: 446.58 |
| |
QL241688 | Loxoprofen Impurity 62 CAS# NA M.F.: C22H26O5 M.W.: 370.44 |
| |
QD050128 | Dexrazoxane Impurity 28 CAS# NA M.F.: C11H15N4O4 M.W.: 267.26 |
| |
QS111677 | Sitafloxacin Impurity 51 CAS# 185225-84-7 M.F.: C7H8O3S C3H6FN M.W.: 172.20 75.08 |
| |
QP140303 | Pancuronium bromide EP Impurity C CAS# 15500-65-9 M.F.: C31H56Br2N2O2 M.W.: 648.60 |
| |
QP140302 | Pancuronium bromide EP Impurity B CAS# 41261-71-6;43021-44-9(cation form) M.F.: C33H58Br2N2O3 M.W.: 690.63 |
| |
QP140301 | Pancuronium bromide EP Impurity A CAS# 27115-86-2 M.F.: C33H58Br2N2O3 M.W.: 690.63 |
| |
QI192108 | Isoflurane Impurity 8 CAS# NA M.F.: C5H5F7O2 M.W.: 230.08 |
| |
QZ151209 | Zoledronic acid Impurity 9 CAS# 1313885-85-6 M.F.: C6H12N2O7P2 M.W.: 286.12 |
| |
QZ151208 | Zoledronic acid Impurity 8 CAS# 118054-52-7 M.F.: C6H12N2O7P2 M.W.: 286.12 |
| |
QL091666 | Lipoic Acid Impurity 40 CAS# 100386-08-1 M.F.: C12H24O2S2 M.W.: 264.45 |
| |
QT202001 | Tetrahydrobiopterin Impurity 1 CAS# NA M.F.: C813CH15N215N3O3 2C2HF3O2 M.W.: 245.22 228.04 |
| |
QF151600 | Fosphenytoin Disodium Salt CAS# 92134-98-0;93390-81-9 (free base) M.F.: C16H13N2Na2O6P M.W.: 406.24 |
| |
QD121842 | Desloratadine Impurity 42 CAS# 119410-05-8 M.F.: C19H19ClN2O M.W.: 326.82 |
| |
QV180393 | Voriconazole Impurity 67 CAS# NA M.F.: C22H18ClF4N7O M.W.: 507.87 |
| |
QL252024 | DL-Lysine acetylsalicylate EP Impurity K CAS# NA M.F.: C15H20N2O5 M.W.: 308.33 |
| |
QL252023 | DL-Lysine acetylsalicylate EP Impurity I CAS# NA M.F.: C15H20N2O5 M.W.: 308.33 |
| |
QL252022 | Lysine aspirin Impurity 22 CAS# NA M.F.: C15H20N2O5 M.W.: 308.33 |
| |
QL252021 | DL-Lysine acetylsalicylate EP Impurity J CAS# NA M.F.: C13H18N2O4 M.W.: 266.29 |
| |
QT120217 | Tulobuterol Impurity 17 CAS# NA M.F.: C12H18ClNO M.W.: 227.73 |
| |
QT120207 | Tulobuterol Impurity 7 CAS# 133662-20-1 M.F.: C8H7ClO2 M.W.: 170.59 |
| |
QD030457 | Diclofenac sodium Impurity 57 CAS# 304884-75-1 M.F.: C14H11Cl2NO M.W.: 280.15 |
| |
QE262097 | Ezetimibe Impurity 97 CAS# NA M.F.: C39H46F2N2O5Si2 M.W.: 716.96 |
| |
QT031884 | Vitamin E Impurity 84 CAS# NA M.F.: C32H54O3 M.W.: 486.77 |
| |
QT031882 | Vitamin E Impurity 82 CAS# NA M.F.: C31H52O3 M.W.: 472.74 |
| |
QP051304 | Perampanel Impurity 4 CAS# 380918-51-4 M.F.: C22H16N2O M.W.: 324.38 |
| |
QE262090 | Ezetimibe Impurity 90 CAS# NA M.F.: C39H46F2N2O5Si2 M.W.: 716.96 |
| |
QA162978 | Apremilast Impurity 78 CAS# NA M.F.: C16H10N2O7 M.W.: 342.26 |
| |
QA162975 | Apremilast Impurity 75 CAS# NA M.F.: C16H12N2O8 M.W.: 360.28 |
| |
QI182053 | Ibrutinib Impurity 53 CAS# NA M.F.: C27H28N6O3 M.W.: 484.55 |
| |
QR201422 | Ritonavir EP Impurity S CAS# NA M.F.: C52H61N7O8S2 M.W.: 976.21 |
| |
QF122922 | Fluocinolone acetonide Impurity 22 CAS# NA M.F.: C26H32ClFO7 M.W.: 510.98 |
| |
QP156534 | Progesterone Impurity 34 CAS# 88128-62-5 M.F.: C23H36O4 M.W.: 376.53 |
| |
QR1922118 | Rosuvastatin Impurity 118 CAS# 122549-26-2 M.F.: C14H15FO3 M.W.: 250.27 |
| |
QN152710 | Norethindrone Impurity 10 CAS# 1670-34-4 M.F.: C20H26O2 M.W.: 298.42 |
| |
QM202425 | Methotrexate Impurity 25 CAS# NA M.F.: C4H5N6 M.W.: 137.12 |
| |
QA200370 | Atracurium besilate EP Impurity K CAS# NA M.F.: C54H74N2O12 M.W.: 943.17 |
| |
QA200369 | Atracurium besilate EP Impurity I CAS# NA M.F.: C54H74N2O12 M.W.: 943.17 |
| |
QA200368 | Atracurium besilate EP Impurity H CAS# NA M.F.: C54H74N2O12 M.W.: 943.17 |
| |
QA200366 | Atracurium besilate EP Impurity F CAS# NA M.F.: C22H30NO4 M.W.: 372.48 |
| |
QA200365 | Atracurium besilate EP Impurity E CAS# NA M.F.: C24H32NO6 M.W.: 430.51 |
| |
QA200364 | Atracurium besilate EP Impurity D CAS# NA M.F.: C29H42NO7 M.W.: 516.65 |
| |
QA200363 | Atracurium besilate EP Impurity C CAS# NA M.F.: C32H44NO8 M.W.: 570.69 |
| |
QA200362 | Atracurium besilate EP Impurity B CAS# NA M.F.: C51H66N2O12 M.W.: 899.08 |
| |
QA200361 | Atracurium besilate EP Impurity A CAS# NA M.F.: C52H69N2O12 M.W.: 914.11 |
| |
QS011234 | Salmeterol Impurity 8 CAS# 934842-69-0 M.F.: C32H43NO4 M.W.: 505.69 |
| |
QT0307192 | Ticagrelor Impurity 192 CAS# NA M.F.: C14H14Cl2N6O5S2 M.W.: 481.33 |
| |
QP090320 | Sodium Picosulfate Impurity 20 CAS# NA M.F.: C20H19NO8S2 M.W.: 465.50 |
| |
QA060306 | Alfacalcidol Impurity 6 CAS# NA M.F.: C33H58O2Si M.W.: 514.90 |
| |
QI091633 | Ipratropium Bromide Impurity 33 CAS# 3967-53-1 M.F.: C10H12O3 M.W.: 180.20 |
| |
QI091632 | Ipratropium Bromide Impurity 32 CAS# 59216-85-2 M.F.: C9H8O3 M.W.: 164.16 |
| |
QI091631 | Ipratropium Bromide Impurity 31 CAS# 54108-62-2 M.F.: C16H14O3 M.W.: 254.28 |
| |
QS200779 | Sitagliptin Impurity 79 CAS# NA M.F.: C16H13F6N5O2 M.W.: 421.30 |
| |
QA011538 | Anastrozole Impurity 38 CAS# 1301724-97-9 M.F.: C19H21N3O2 M.W.: 323.39 |
| |
QE1316132 | Empagliflozin Impurity 132 CAS# NA M.F.: C23H27BrO7 M.W.: 495.36 |
| |
QL130629 | Lamivudine Impurity 29 CAS# NA M.F.: C23H33N8O10PS M.W.: 644.59 |
| |
QI151621 | R-Iopamidol CAS# 88375-91-1 M.F.: C17H22I3N3O8 M.W.: 777.09 |
| |
QA1624202 | Apixaban Impurity 202 CAS# NA M.F.: C27H30N4O5 M.W.: 490.55 |
| |
QF181944 | Furosemide Impurity 44 CAS# NA M.F.: C15H16ClNO6S M.W.: 373.81 |
| |
QN151856 | Noradrenaline (Norepinephrine) Impurity 56 CAS# 14309-96-7 M.F.: C8H9NO3 M.W.: 167.16 |
| |
QP012100 | Pasireotide CAS# 396091-73-9 M.F.: C58H66N10O9 M.W.: 1047.21 |
| |
QA1624197 | Apixaban Impurity 197 CAS# NA M.F.: C25H28N6O4 M.W.: 476.53 |
| |
QA1624196 | Apixaban Impurity 196 CAS# NA M.F.: C27H31N5O5 M.W.: 505.57 |
| |
QA1624194 | Apixaban Impurity 194 CAS# NA M.F.: C38H38N6O6 M.W.: 674.74 |
| |
QA1624193 | Apixaban Impurity 193 CAS# NA M.F.: C29H34N6O5 M.W.: 546.62 |
| |
QL201554 | Letrozole Impurity 54 CAS# NA M.F.: C17H11N5O M.W.: 301.30 |
| |
QL201553 | Letrozole Impurity 53 CAS# NA M.F.: C17H11N5O2 M.W.: 317.30 |
| |
QI131800 | Imidapril CAS# 89371-37-9 M.F.: C20H27N3O6 M.W.: 405.44 |
| |
QR457047 | Rocuronium bromide Impurity 47 CAS# NA M.F.: C32H53BrN2O4 M.W.: 609.68 |
| |
QE191817 | Estradiol Valerate EP Impurity G CAS# 1313382-25-0 M.F.: C23H30O3 M.W.: 354.48 |
| |
QF122043 | Fluticasone Impurity 43 CAS# NA M.F.: C52H54F4O12S3 M.W.: 1043.17 |
| |
QT161890 | Topiroxostat Impurity 64 CAS# NA M.F.: C13H8N6O2 M.W.: 280.24 |
| |
QM031631 | Mycophenolic Acid Impurity 31 CAS# 344562-78-3 M.F.: C23H30O11 M.W.: 482.48 |
| |
QL151433 | Lornoxicam Impurity 33 CAS# NA M.F.: C9H12ClNO6S2 M.W.: 329.78 |
| |
QM132040 | Memantine Impurity 40 CAS# NA M.F.: C16H26N2O2 M.W.: 278.39 |
| |
QF022490 | Febuxostat Impurity 64 CAS# 923942-36-3 M.F.: C20H24N2O3S M.W.: 372.48 |
| |
QF022489 | Febuxostat Impurity 63 CAS# 1312815-36-3 M.F.: C20H25NO4S M.W.: 375.48 |
| |
QI192022 | Irbesartan Impurity 22 CAS# NA M.F.: C25H27N3O M.W.: 385.50 |
| |
QM154258 | Mirabegron Impurity 32 CAS# NA M.F.: C24H22N2O6 M.W.: 434.44 |
| |
QG122538 | Glycopyrrolate Impurity 38 CAS# NA M.F.: C5H13NO2 M.W.: 119.16 |
| |
QG122535 | Glycopyrrolate Impurity 35 CAS# NA M.F.: C5H9NO2 M.W.: 115.13 |
| |
QG122533 | Glycopyrrolate Impurity 33 CAS# NA M.F.: C5H7NO3 M.W.: 129.11 |
| |
QF120320 | Folic Acid Impurity 20 CAS# 5959-18-2 M.F.: C12H14N2O5 M.W.: 266.25 |
| |
QK201837 | Ketorolac Impurity 37 CAS# 111930-01-9 M.F.: C15H13NO4 M.W.: 271.27 |
| |
QF132033 | Formoterol Impurity 33 CAS# NA M.F.: C20H26N2O4 M.W.: 358.43 |
| |
QS060295 | Sofosbuvir Impurity 95 CAS# NA M.F.: C10H13FN2O5 M.W.: 260.22 |
| |
QS060294 | Sofosbuvir Impurity 94 CAS# NA M.F.: C24H21FN2O7 M.W.: 468.43 |
| |
QD012010 | Daprodustat Impurity 10 CAS# NA M.F.: C18H27N3O4 M.W.: 349.42 |
| |
QD053300 | Doxacurium chloride CAS# 106819-53-8 M.F.: C56H78Cl2N2O16 M.W.: 1106.13 |
| |
QO240111 | Oxacillin sodium Impurity 11 CAS# NA M.F.: C19H19N3O5S M.W.: 401.44 |
| |
QE1316129 | Empagliflozin Impurity 129 CAS# NA M.F.: C20H25ClO3Si M.W.: 376.95 |
| |
QE120134 | Elagolix Impurity 34 CAS# 7143-01-3 M.F.: C2H6O5S2 M.W.: 174.20 |
| |
QE120133 | Elagolix Impurity 33 CAS# 117049-14-6 M.F.: C13H19NO3 M.W.: 237.29 |
| |
QE120131 | Elagolix Impurity 31 CAS# 20989-17-7 M.F.: C8H11NO M.W.: 137.18 |
| |
QE120127 | Elagolix Impurity 27 CAS# 830346-47-9 M.F.: C13H10F4N2O2 M.W.: 302.22 |
| |
QP180450 | Perindopril Impurity 50 CAS# 145513-33-3(free base) M.F.: C19H32N2O5 C4H11N M.W.: 368.47 73.14 |
| |
QS200777 | Sitagliptin Impurity 77 CAS# 1253056-01-7 M.F.: C16H14F6N4O2 M.W.: 408.30 |
| |
QR182452 | Brexpiprazole Impurity 52 CAS# 15116-41-3 M.F.: C16H15NO2 M.W.: 253.30 |
| |
QA200105 | Atazanavir Impurity 5 CAS# 156474-21-4 M.F.: C15H21NO3 M.W.: 263.33 |
| |
QT183200 | Triclabendazole CAS# 68786-66-3 M.F.: C14H9Cl3N2OS M.W.: 359.66 |
| |
QT092401 | Tixocortol pivalate CAS# 55560-96-8 M.F.: C26H38O5S M.W.: 462.64 |
| |
QF122430 | Fluoxetine Impurity 30 CAS# NA M.F.: C9H9IO M.W.: 260.07 |
| |
QF122429 | Fluoxetine Impurity 29 CAS# 62872-58-6 M.F.: C9H11IO M.W.: 262.09 |
| |
QA132449 | Amoxicillin Impurity 23 CAS# NA M.F.: C31H40N6O9S2 M.W.: 704.81 |
| |
QA1624179 | Apixaban Impurity 179 CAS# NA M.F.: C27H29ClN4O5 M.W.: 525.00 |
| |
QC551819 | Clenbuterol Impurity 19 CAS# 37159-31-2 M.F.: C12H19ClN2O M.W.: 242.75 |
| |
QT0307191 | Ticagrelor Impurity 191 CAS# NA M.F.: C7H10N2O3S M.W.: 202.23 |
| |
QO022025 | Obeticholic Acid Impurity 25 CAS# 1516887-33-4 M.F.: C26H40O4 M.W.: 416.59 |
| |
QP092700 | Pinaverium Bromide CAS# 53251-94-8 M.F.: C26H41Br2NO4 M.W.: 591.42 |
| |
QP092704 | Pinaverium Bromide Impurity 4 CAS# 1235355-01-7 M.F.: C26H39Br2NO4 M.W.: 589.40 |
| |
QP092703 | Pinaverium Bromide Impurity 3 CAS# 1126385-20-3 M.F.: C9H11BrO M.W.: 215.09 |
| |
QP092702 | Pinaverium Bromide Impurity 2 CAS# 53207-00-4 M.F.: C9H10Br2O2 M.W.: 309.98 |
| |
QP092701 | Pinaverium Bromide Impurity 1 CAS# 54370-00-2 M.F.: C9H11BrO3 M.W.: 247.09 |
| |
QO1920112 | Oseltamivir Impurity 112 CAS# NA M.F.: C11H17N3O5 M.W.: 271.27 |
| |
QO1920110 | Oseltamivir Impurity 110 CAS# NA M.F.: C11H16N4O4 M.W.: 268.27 |
| |
QA1624171 | Apixaban Impurity 171 CAS# NA M.F.: C25H33Cl2N3O4 M.W.: 510.45 |
| |
QA1624168 | Apixaban Impurity 168 CAS# NA M.F.: C19H28N4O3 M.W.: 360.45 |
| |
QA1624166 | Apixaban Impurity 166 CAS# NA M.F.: C19H26N4O5 M.W.: 390.43 |
| |
QR152425 | Roxadustat Impurity 25 CAS# 1455091-10-7 M.F.: C17H13NO4 M.W.: 295.29 |
| |
QG140957 | Ganciclovir Impurity 57 CAS# NA M.F.: C15H21N5O8 M.W.: 399.36 |
| |
QT142426 | Tranexamic Acid Impurity 26 CAS# 2375016-71-8 M.F.: C8H13ClO2 M.W.: 176.64 |
| |
QA022600 | Abeprazan CAS# 1902954-60-2 M.F.: C19H17F3N2O3S M.W.: 410.41 |
| |
QS011232 | Salmeterol Impurity 6 CAS# 2262385-84-0 M.F.: C9H9BrO3 M.W.: 245.07 |
| |
QT012000 | Tartronic acid CAS# 80-69-3 M.F.: C3H4O5 M.W.: 120.06 |
| |
QI162000 | Isomaltohexaonic acid CAS# 534-74-7 M.F.: C12H22O12 M.W.: 358.30 |
| |
QM120200 | Maltobionic acid CAS# 534-42-9 M.F.: C12H22O12 M.W.: 358.30 |
| |
QT0307190 | Ticagrelor Impurity 190 CAS# NA M.F.: C26H31F2N7O5S M.W.: 591.63 |
| |
QI120114 | Ilaprazole Impurity 14 CAS# 1018229-53-2 M.F.: C11H9N3O M.W.: 199.21 |
| |
QF132032 | Formoterol Impurity 32 CAS# NA M.F.: C20H26N2O4 M.W.: 358.43 |
| |
QG140954 | Ganciclovir Impurity 54 CAS# 108436-61-9 M.F.: C18H21N5O5 M.W.: 387.39 |
| |
QI120113 | Ilaprazole Impurity 13 CAS# 86604-74-2;124473-12-7(free base) M.F.: C8H10ClNO HCl M.W.: 171.62 36.46 |
| |
QI210658 | Ibuprofen Impurity 32 CAS# 4397-53-9 M.F.: C14H12O2 M.W.: 212.24 |
| |
QI222040 | Itraconazole Impurity 40 CAS# 219923-93-0 M.F.: C18H22N4O2 M.W.: 326.39 |
| |
QI041553 | Indobufen Impurity 27 CAS# NA M.F.: C18H17NO5 M.W.: 327.33 |
| |
QI041551 | Indobufen Impurity 25 CAS# 1093759-05-7 M.F.: C14H13NO4 M.W.: 259.26 |
| |
QS091106 | Shikimic Acid Impurity 6 CAS# 171963-37-4 M.F.: C7H10O5 M.W.: 174.15 |
| |
QS091105 | Shikimic Acid Impurity 5 CAS# NA M.F.: C7H10O5 M.W.: 174.15 |
| |
QS091104 | Shikimic Acid Impurity 4 CAS# 21967-35-1 M.F.: C7H10O5 M.W.: 174.15 |
| |
QS091103 | Shikimic Acid Impurity 3 CAS# 10191-00-1 M.F.: C7H10O5 M.W.: 174.15 |
| |
QA220370 | Avibactam Impurity 44 CAS# NA M.F.: C17H19N M.W.: 237.34 |
| |
QA220368 | Avibactam Impurity 42 CAS# NA M.F.: C27H36N6O5 M.W.: 524.61 |
| |
QC061738 | Cefoperazone Impurity 12 CAS# NA M.F.: C24H25N9O8S2 M.W.: 631.64 |
| |
QR182450 | Brexpiprazole Impurity 50 CAS# NA M.F.: C33H31N3O2S2 M.W.: 565.75 |
| |
QD261615 | Diazepam Impurity 15 CAS# 25759-97-1 M.F.: C20H14Cl2N2O M.W.: 369.24 |
| |
QD030451 | Diclofenac sodium Impurity 51 CAS# 95093-56-4 M.F.: C17H17Cl2NO3 M.W.: 354.23 |
| |
QC022649 | Cabozantinib Impurity 49 CAS# NA M.F.: C28H24FN3O5 M.W.: 501.51 |
| |
QC022648 | Cabozantinib Impurity 48 CAS# NA M.F.: C28H26FN3O6 M.W.: 519.52 |
| |
QA130240 | Ambroxol Impurity 40 CAS# NA M.F.: C13H16Br2N2O3 M.W.: 408.09 |
| |
QA260501 | Dehydro Azelnidipine CAS# 918659-10-6 M.F.: C33H32N4O6 M.W.: 580.63 |
| |
QI071800 | Iguratimod CAS# 123663-49-0 M.F.: C17H14N2O6S M.W.: 374.37 |
| |
QN202112 | Netupitant Impurity 12 CAS# NA M.F.: C11H8F6O2 M.W.: 286.17 |
| |
QC080304 | Cholic Acid Impurity 4 CAS# NA M.F.: C25H40O5 M.W.: 420.58 |
| |
QC080303 | Cholic Acid Impurity 3 CAS# NA M.F.: C25H42O5 M.W.: 422.60 |
| |
QR021649 | Rabeprazole Impurity 49 CAS# 117977-19-2 M.F.: C13H19NO4 M.W.: 253.29 |
| |
QL201548 | Letrozole Impurity 48 CAS# 143030-54-0 M.F.: C16H11BrN4 M.W.: 339.19 |
| |
QA161908 | Acetylsalicylic Acid Impurity 8 CAS# 15540-79-1 M.F.: C8H7NO5 M.W.: 197.14 |
| |
QS041919 | Sodium Valproate Impurity 19 CAS# 3274-28-0 M.F.: C9H18O2 M.W.: 158.24 |
| |
QR457046 | Rocuronium bromide Impurity 46 CAS# NA M.F.: C23H37NO2 M.W.: 359.55 |
| |
QR457045 | Rocuronium bromide Impurity 45 CAS# NA M.F.: C23H37NO2 M.W.: 359.55 |
| |
QR457044 | Rocuronium bromide Impurity 44 CAS# 2102929-98-4 M.F.: C23H37NO2 M.W.: 359.55 |
| |
QR457043 | Rocuronium bromide Impurity 43 CAS# NA M.F.: C21H30O3 M.W.: 330.46 |
| |
QR457042 | Rocuronium bromide Impurity 42 CAS# 212505-49-2 M.F.: C21H30O3 M.W.: 330.46 |
| |
QR457041 | Rocuronium bromide Impurity 41 CAS# NA M.F.: C21H30O4 M.W.: 346.46 |
| |
QR457040 | Rocuronium bromide Impurity 40 CAS# NA M.F.: C21H30O4 M.W.: 346.46 |
| |
QR457039 | Rocuronium bromide Impurity 39 CAS# NA M.F.: C21H30O2 M.W.: 314.46 |
| |
QG123301 | Glycodeoxycholic Acid Ethyl Ester CAS# 70779-06-5 M.F.: C28H47NO5 M.W.: 477.68 |
| |
QG121502 | Glycocholic Acid Ethyl Ester CAS# 517904-33-5 M.F.: C28H47NO6 M.W.: 493.68 |
| |
QV180388 | Voriconazole Nitroso Impurity 4 CAS# NA M.F.: C10H9F2N5O2 M.W.: 269.21 |
| |
QV180386 | Voriconazole Nitroso Impurity 3 CAS# NA M.F.: C2H3N5O M.W.: 113.08 |
| |
QO1920101 | Oseltamivir Impurity 101 CAS# NA M.F.: C13H18N4O5 M.W.: 310.31 |
| |
QV307786 | Vitamin K1 Impurity 86 CAS# NA M.F.: C31H46O3 M.W.: 466.70 |
| |
QP082902 | Calcium Phenylpyruvate Impurity 2 CAS# NA M.F.: C17H14N2O3 M.W.: 294.30 |
| |
QP082901 | Calcium Phenylpyruvate Impurity 1 CAS# NA M.F.: C18H13NO4 M.W.: 307.30 |
| |
QD030444 | Diclofenac sodium Impurity 44 CAS# NA M.F.: C28H23NO4 M.W.: 437.49 |
| |
QL151427 | Lornoxicam Impurity 27 CAS# NA M.F.: C10H11Cl2NO6S2 M.W.: 376.23 |
| |
QL151425 | Lornoxicam Impurity 25 CAS# NA M.F.: C7H7Cl2NO4S2 M.W.: 304.17 |
| |
QT1406175 | Tenofovir Impurity 175 CAS# 50615-40-2 M.F.: C8H10ClN5 M.W.: 211.65 |
| |
QF122602 | Flutrimazole EP Impurity B CAS# 128092-72-8 M.F.: C19H14F2O M.W.: 296.31 |
| |
QM092208 | Mivacurium chloride Impurity 8 CAS# 38561-68-1 M.F.: C8H12O4 M.W.: 172.18 |
| |
QD122041 | Dolutegravir Impurity 41 CAS# 1309560-49-3 M.F.: C20H19F2N3O5 M.W.: 419.38 |
| |
QC082801 | Chlormadinone acetate EP Impurity A CAS# 2477-73-8 M.F.: C23H31ClO4 M.W.: 406.94 |
| |
QN131129 | Nifuratel impurity 29 CAS# NA M.F.: C5H10N2O2S M.W.: 162.21 |
| |
QC120103 | Clavulanic Acid Impurity 3 CAS# 92632-79-6 M.F.: C4H9NO2 HCl M.W.: 103.12 36.46 |
| |
QA262011 | Azathioprine Impurity 11; Mercaptopurine EP Impurity C CAS# 90947-51-6 M.F.: C10H6N8S M.W.: 270.27 |
| |
QV122220 | Valaciclovir Impurity 20;Adenine; Mercaptopurine EP Impurity B CAS# 73-24-5 M.F.: C5H5N5 M.W.: 135.13 |
| |
QE1316124 | Empagliflozin Impurity 124 CAS# 915095-90-8 M.F.: C17H16BrClO2 M.W.: 367.66 |
| |
QG123400 | Glycolithocholic acid CAS# 474-74-8 M.F.: C26H43NO4 M.W.: 433.62 |
| |
QR182448 | Brexpiprazole Impurity 48 CAS# 6855-48-7 M.F.: C8H7NO2 M.W.: 149.15 |
| |
QR182447 | Brexpiprazole Impurity 47 CAS# 22246-84-0 M.F.: C10H11NO2 M.W.: 177.20 |
| |
QR182446 | Brexpiprazole Impurity 46 CAS# NA M.F.: C26H28ClN3O2S M.W.: 482.04 |
| |
QD030440 | Diclofenac sodium Impurity 40 CAS# 320777-08-0 M.F.: C14H12ClNO2 M.W.: 261.70 |
| |
QM202421 | Methotrexate Impurity 21 CAS# 82778-08-3 M.F.: C7H7ClN6 HCl M.W.: 210.62 36.46 |
| |
QB052512 | Benzylpenicillin sodium CP Impurity L CAS# NA M.F.: C26H29N3O7S M.W.: 527.59 |
| |
QB052510 | Benzylpenicillin sodium CP Impurity J CAS# NA M.F.: C17H20N2O6S M.W.: 380.42 |
| |
QB052509 | Benzylpenicillin sodium CP Impurity I CAS# NA M.F.: C16H18N2O4S M.W.: 334.39 |
| |
QB052508 | Benzylpenicillin sodium CP Impurity H CAS# 500-98-1 M.F.: C10H11NO3 M.W.: 193.20 |
| |
QK200318 | Ketoconazole Impurity 18 CAS# 2234-16-4 M.F.: C8H6Cl2O M.W.: 189.04 |
| |
QG131815 | Gimeracil Impurity 15 CAS# 1379260-15-7 M.F.: C6H6ClNO2 M.W.: 159.57 |
| |
QH041815 | Cholesterol Impurity 15 CAS# 15073-00-4 M.F.: C28H48O M.W.: 400.68 |
| |
QE042245 | Edaravone Impurity 19 CAS# NA M.F.: C27H30N4O4 M.W.: 474.55 |
| |
QC042020 | Cefditoren pivoxil Impurity 20 CAS# NA M.F.: C31H40N6O10S3 M.W.: 752.88 |
| |
QC042018 | Cefditoren pivoxil Impurity 18 CAS# NA M.F.: C33H36N6O8S3 M.W.: 740.87 |
| |
QC042017 | Cefditoren pivoxil Impurity 17 CAS# 145904-68-3 M.F.: C19H18N6O5S3 M.W.: 506.58 |
| |
QR052002 | 9-cis-4-Hydroxyretinoic acid CAS# 150737-17-0 M.F.: C20H28O3 M.W.: 316.43 |
| |
QM031630 | Mycophenolic Acid Impurity 30 CAS# 27979-57-3 M.F.: C9H8O4 M.W.: 180.16 |
| |
QR022238 | Ribavirin Impurity 12 CAS# 61849-90-9 M.F.: C13H18O9 M.W.: 318.28 |
| |
QG211202 | Sodium Gualenate Impurity 2 CAS# 6223-36-5 M.F.: C17H22O3S M.W.: 306.42 |
| |
QG211201 | Sodium Gualenate Impurity 1 CAS# 93914-28-4 M.F.: C15H17NaO3S M.W.: 300.35 |
| |
QG211200 | Sodium Gualenate CAS# 6223-35-4 M.F.: C15H17NaO3S M.W.: 300.35 |
| |
QV307785 | Vitamin B6 Impurity 85 CAS# 90005-85-9 M.F.: C8H9NO3 HCl M.W.: 167.16 36.46 |
| |
QV307784 | Vitamin B6 Impurity 84 CAS# NA M.F.: C16H20N2O5 M.W.: 320.34 |
| |
QV307783 | Vitamin B6 Impurity 83 CAS# 2726926-28-7 M.F.: C16H20N2O5 M.W.: 320.34 |
| |
QV307782 | Vitamin B6 Impurity 82 CAS# NA M.F.: C16H20N2O5 M.W.: 320.34 |
| |
QV307781 | Vitamin B6 Impurity 81 CAS# NA M.F.: C8H11NO3 M.W.: 169.18 |
| |
QV307780 | Vitamin B6 Impurity 80 CAS# NA M.F.: C12H17NO3 M.W.: 223.27 |
| |
QV307779 | Vitamin B6 Impurity 79 CAS# 1385767-86-1 M.F.: C12H17NO3 M.W.: 223.27 |
| |
QV307778 | Vitamin B6 Impurity 78 CAS# NA M.F.: C14H21NO3 M.W.: 251.32 |
| |
QC065302 | Chlorogenic acid Impurity 2 CAS# NA M.F.: C16H16O9 M.W.: 352.29 |
| |
QV307777 | Vitamin K1 Impurity 77 CAS# NA M.F.: C31H46O2 M.W.: 450.71 |
| |
QO022024 | Obeticholic Acid Impurity 24 CAS# 1831863-02-5 M.F.: C26H44O4 M.W.: 420.63 |
| |
QO022023 | Tauro-Obeticholic Acid-d5 CAS# NA M.F.: C28H44D5NO6S M.W.: 532.79 |
| |
QO022022 | Tauro-Obeticholic Acid CAS# 863239-61-6 M.F.: C28H49NO6S M.W.: 527.76 |
| |
QO022021 | Glyco-Obeticholic Acid-d5 CAS# NA M.F.: C28H42D5NO5 M.W.: 482.71 |
| |
QO022020 | Glyco-Obeticholic Acid CAS# 863239-60-5 M.F.: C28H47NO5 M.W.: 477.68 |
| |
QO022019 | Obeticholic Acid-d5 CAS# 1992000-80-2 M.F.: C26H39D5O4 M.W.: 425.66 |
| |
QA056342 | Agomelatine Impurity 42 CAS# 178677-39-9 M.F.: C15H19NO2 M.W.: 245.32 |
| |
QT131212 | Timolol Maleate Impurity 12 CAS# 158636-96-5 M.F.: C13H24N4O3S M.W.: 316.42 |
| |
QW011820 | Warfarin sodium Impurity 20 CAS# NA M.F.: C18H18O3 M.W.: 282.33 |
| |
QA131245 | Amlodipine Impurity 45 CAS# 130161-00-1 M.F.: C18H18ClNO4 M.W.: 347.79 |
| |
QI091630 | Ipratropium Bromide Impurity 30 CAS# NA M.F.: C19H25NO3 M.W.: 315.41 |
| |
QP180449 | Perindopril Impurity 49 CAS# 145513-93-5 M.F.: C9H15NO2 M.W.: 169.22 |
| |
QM201820 | Metaraminol Impurity 20 CAS# NA M.F.: C24H25NO4 M.W.: 391.46 |
| |
QR122411 | Raloxifene Impurity 11 CAS# 2008-75-5 M.F.: C7H14ClN HCl M.W.: 147.65 36.46 |
| |
QP1903129 | Posaconazole Impurity 129 CAS# NA M.F.: C22H20F2INO4 M.W.: 527.30 |
| |
QA020415 | Albendazole Impurity 15 CAS# 95384-59-1 M.F.: C14H14N2O M.W.: 226.27 |
| |
QR051209 | Relugolix Impurity 9 CAS# NA M.F.: C31H30F2N8O7S M.W.: 696.68 |
| |
QR051208 | Relugolix Impurity 8 CAS# NA M.F.: C54H46F4N12O6S2 M.W.: 1099.14 |
| |
QP082202 | Phenprocoumon, (S)- CAS# 3770-63-6 M.F.: C18H16O3 M.W.: 280.32 |
| |
QS211704 | Sulindac Impurity 4 CAS# 61849-35-2 M.F.: C20H17FO3S M.W.: 356.41 |
| |
QZ151207 | Zoledronic acid Impurity 7 CAS# NA M.F.: C5H8N2O6P2 M.W.: 254.07 |
| |
QC160765 | Clopidogrel Impurity 39 CAS# NA M.F.: C15H14O5S M.W.: 306.33 |
| |
QP180787 | Pregabalin Impurity 87 CAS# NA M.F.: C8H17NO3 M.W.: 175.23 |
| |
QS040669 | Sildenafil Impurity 69 CAS# 1446089-83-3 M.F.: C32H38N6O3 M.W.: 554.68 |
| |
QP160520 | Prednisolone Acetate EP Impurity E CAS# 4380-55-6 M.F.: C23H28O5 M.W.: 384.47 |
| |
QP160519 | Prednisolone Acetate EP Impurity D CAS# 20423-99-8 M.F.: C21H28O4 M.W.: 344.44 |
| |
QP160518 | Prednisolone Acetate EP Impurity C CAS# 98523-85-4 M.F.: C25H32O7 M.W.: 444.52 |
| |
QT050704 | Tegafur Impurity 4 CAS# NA M.F.: C10H14N2O4 M.W.: 226.23 |
| |
QE201515 | Etodolac Impurity 15 CAS# 101901-08-0 M.F.: C17H21NO4 M.W.: 303.35 |
| |
QR021644 | Rabeprazole Impurity 44 CAS# 1173655-69-0 M.F.: C11H17NO4 M.W.: 227.26 |
| |
QF120319 | Folic Acid Impurity 19 CAS# NA M.F.: C20H22ClN7O6 M.W.: 491.88 |
| |
QV307775 | Vitamin K1 Impurity 75 CAS# 64236-23-3 M.F.: C31H48O2 M.W.: 452.71 |
| |
QS075488 | Sugammadex Impurity 88 CAS# 131105-41-4 M.F.: C36H54I6O24 M.W.: 1632.23 |
| |
QP1903120 | Posaconazole Impurity 120 CAS# NA M.F.: C44H48F2N8O4 M.W.: 790.90 |
| |
QV041415 | Vardenafil Impurity 15 CAS# NA M.F.: C18H22N4O5S M.W.: 406.46 |
| |
QS200774 | Sitagliptin Impurity 74 CAS# NA M.F.: C10H8F3NO2 M.W.: 231.17 |
| |
QS200773 | Sitagliptin Impurity 73 CAS# 1256815-03-8 M.F.: C10H7F3O3 M.W.: 232.16 |
| |
QS200772 | Sitagliptin Impurity 72 CAS# 1151240-88-8 M.F.: C12H11F3O3 M.W.: 260.21 |
| |
QP131243 | Pomalidomide Impurity 17 CAS# NA M.F.: C15H10N2O4 M.W.: 282.25 |
| |
QP090319 | Sodium Picosulfate Impurity 19 CAS# NA M.F.: C26H31NO8S2 M.W.: 549.66 |
| |
QP090318 | Sodium Picosulfate Impurity 18 CAS# NA M.F.: C22H23NO8S2 M.W.: 493.55 |
| |
QC010100 | Controlled Substance (Cannabidiolic acid) CAS# 1244-58-2 M.F.: C22H30O4 M.W.: 358.47 |
| |
QT142425 | Tranexamic Acid Impurity 25 CAS# 861518-79-8 M.F.: C16H13ClO4 M.W.: 304.73 |
| |
QB121432 | Blonanserin Impurity 6 CAS# NA M.F.: C25H35N3O M.W.: 393.56 |
| |
QM1602121 | Moxifloxacin Impurity 121 CAS# 1797982-51-4 M.F.: C16H16FNO5 M.W.: 321.30 |
| |
QT052402 | Tenoxicam Impurity 2 CAS# 59337-92-7 M.F.: C6H5ClO4S2 M.W.: 240.68 |
| |
QI140414 | Indometacin Impurity 14 CAS# 73301-01-6 M.F.: C10H11ClO4 M.W.: 230.64 |
| |
QS132249 | Simvastatin EP Impurity M CAS# 864357-87-9 M.F.: C27H44O6 M.W.: 464.63 |
| |
QD030439 | Diclofenac sodium Impurity 39 CAS# 172494-87-0 M.F.: C13H11Cl2N M.W.: 252.14 |
| |
QD030438 | Diclofenac sodium Impurity 38 CAS# 127792-34-1 M.F.: C14H12ClNO2 M.W.: 261.70 |
| |
QD030437 | Diclofenac sodium Impurity 37 CAS# NA M.F.: C18H20Cl2N2O2 M.W.: 367.27 |
| |
QS061426 | Safinamide Impurity Z CAS# 1827614-91-4 M.F.: C18H20FNO3 M.W.: 317.35 |
| |
QF122113 | Fluorouracil Impurity 13 CAS# 155-16-8 M.F.: C5H5FN2O2 M.W.: 144.10 |
| |
QA150925 | Atomoxetine Impurity 25 CAS# 881995-46-6 M.F.: C16H19NO HCl M.W.: 241.33 36.46 |
| |
QP181674 | Pramipexole Impurity 74 CAS# 1001648-75-4 M.F.: C7H11N3OS M.W.: 185.25 |
| |
QS010262 | Salbutamol Impurity 36 CAS# NA M.F.: C17H23NO4 M.W.: 305.37 |
| |
QF130421 | Famotidine Impurity 21 CAS# 95853-46-6 M.F.: C3H7N3O2S M.W.: 149.17 |
| |
QP180784 | Pregabalin Impurity 84 CAS# 313651-25-1 M.F.: C9H19NO2 M.W.: 173.25 |
| |
QV307774 | Vitamin K1 Impurity 74 CAS# 107759-10-4 M.F.: C31H48O4 M.W.: 484.71 |
| |
QA190213 | Ascorbic Acid Impurity 13 CAS# NA M.F.: C6H6O7 M.W.: 190.11 |
| |
QD162006 | Daptomycin Impurity F CAS# NA M.F.: C72H103N17O27 M.W.: 1638.69 |
| |
QM031629 | Mycophenolic Acid-13C-d3 CAS# NA M.F.: C1613CH17D3O6 M.W.: 324.35 |
| |
QM040140 | Midazolam Impurity 14 CAS# NA M.F.: C23H18ClFN2O4 M.W.: 440.85 |
| |
QB191626 | Bisoprolol Impurity 26 CAS# NA M.F.: C19H33NO4 M.W.: 339.47 |
| |
QB191625 | Bisoprolol Impurity 25 CAS# 2226263-67-6 M.F.: C15H22O4 M.W.: 266.33 |
| |
QB191624 | Bisoprolol Impurity 24 CAS# NA M.F.: C27H40O7 M.W.: 476.60 |
| |
QA220362 | Avibactam Impurity 36 CAS# NA M.F.: C9H21O3P M.W.: 208.24 |
| |
QA220361 | Avibactam Impurity 35 CAS# 18812-51-6 M.F.: C7H17O3P M.W.: 180.18 |
| |
QA220359 | Avibactam Impurity 33 CAS# NA M.F.: C11H25O3P M.W.: 236.29 |
| |
QA220358 | Avibactam Impurity 32 CAS# NA M.F.: C17H21O3P M.W.: 304.32 |
| |
QV180382 | Voriconazole Impurity 56 CAS# 2094735-34-7 M.F.: C10H10BrFN4O M.W.: 301.12 |
| |
QC180821 | Chlorphenamine Impurity 21 CAS# NA M.F.: C17H20ClN3O M.W.: 317.81 |
| |
QA180607 | ArforMoterol Tartrate Impurity 7 CAS# NA M.F.: C20H26N2O4 M.W.: 358.43 |
| |
QG040238 | Gadobutrol Impurity 38 CAS# 112193-75-6 M.F.: C12H24N4O4 M.W.: 288.34 |
| |
QG040237 | Gadobutrol Impurity 37 CAS# 170454-90-7 M.F.: C10H22N4O2 M.W.: 230.31 |
| |
QF022487 | Febuxostat Impurity 61 CAS# 25984-63-8 M.F.: C7H7NOS M.W.: 153.20 |
| |
QP090317 | Sodium Picosulfate Impurity 17 CAS# 22945-62-6 M.F.: C12H9NO2 M.W.: 199.21 |
| |
QP090316 | Sodium Picosulfate Impurity 16 CAS# 33077-70-2 M.F.: C12H9NO2 M.W.: 199.21 |
| |
QB082440 | Bromhexine Impurity 14 CAS# NA M.F.: C20H30Br2N2O5 M.W.: 538.27 |
| |
QP052700 | Pemirolast CAS# 69372-19-6 M.F.: C10H8N6O M.W.: 228.21 |
| |
QP132075 | Pemetrexed Impurity 49 CAS# 883553-87-5 M.F.: C25H28N6O9 M.W.: 556.52 |
| |
QP1824108 | Parecoxib Sodium Impurity 82 CAS# 1448355-87-0 M.F.: C16H12ClNO M.W.: 269.73 |
| |
QF120210 | Flubendazole Impurity 10 CAS# NA M.F.: C13H7ClFNO3 M.W.: 279.65 |
| |
QF120209 | Flubendazole Impurity 9 CAS# NA M.F.: C12H8F2OS M.W.: 238.25 |
| |
QS201223 | Sertraline Impurity 23 CAS# NA M.F.: C17H17Cl2N M.W.: 306.23 |
| |
QP012200 | Parvine CAS# 57103-51-2 M.F.: C18H13N3O M.W.: 287.32 |
| |
QI221800 | Ivermectin B1a CAS# 71827-03-7 M.F.: C48H74O14 M.W.: 875.09 |
| |
QM041849 | Minodronic Acid Impurity 23 CAS# 22418-77-5 M.F.: C4H4O3 M.W.: 100.07 |
| |
QT180678 | Tirofiban Impurity 78 CAS# NA M.F.: C21H34N2O5S M.W.: 426.57 |
| |
QT180676 | Tirofiban Impurity 76 CAS# NA M.F.: C20H26N2O5S M.W.: 406.50 |
| |
QM041848 | Minodronic Acid Impurity 22 CAS# 1575-59-3 M.F.: C4H4O3 M.W.: 100.07 |
| |
QD030435 | Diclofenac sodium Impurity 35 CAS# 69002-84-2 M.F.: C14H11Cl2NO3 M.W.: 312.15 |
| |
QL091665 | Lipoic Acid Impurity39 CAS# 6718-96-3 M.F.: C16H28O4S4 M.W.: 412.65 |
| |
QL091664 | Lipoic Acid Impurity 38 CAS# NA M.F.: C16H28O4S4 M.W.: 412.65 |
| |
QP081833 | Phloroglucinol Impurity 33 CAS# NA M.F.: C18H14O9 M.W.: 374.30 |
| |
QL053000 | Leucovorin CAS# 58-05-9 M.F.: C20H23N7O7 M.W.: 473.44 |
| |
QI200341 | Irinotecan-d10 HCl CAS# 718612-62-5 M.F.: C33H28D10N4O6 HCl M.W.: 596.74 36.46 |
| |
QC162011 | Camptothecin Impurity 11 CAS# 718612-49-8 M.F.: C22H17D3N2O5 M.W.: 395.42 |
| |
QA164180 | Avanafil Impurity 54 CAS# NA M.F.: C28H30ClN9O3 M.W.: 576.05 |
| |
QA164179 | Avanafil Impurity 53 CAS# 2520113-98-6 M.F.: C24H24ClN7O4 M.W.: 509.94 |
| |
QA164173 | Avanafil Impurity 47 CAS# NA M.F.: C18H19ClN4O5 M.W.: 406.82 |
| |
QA164172 | Avanafil Impurity 46 CAS# NA M.F.: C20H23ClN4O5 M.W.: 434.87 |
| |
QA164170 | Avanafil Impurity 44 CAS# NA M.F.: C18H19ClN4O5 M.W.: 406.82 |
| |
QA164167 | Avanafil Impurity 41 CAS# 56633-75-1 M.F.: C6H11NO2 M.W.: 129.16 |
| |
QA164165 | Avanafil Impurity 39 CAS# 1624833-89-1 M.F.: C19H19ClN6O4S M.W.: 462.91 |
| |
QA164164 | Avanafil Impurity 38 CAS# NA M.F.: C14H14ClN3O5S M.W.: 371.80 |
| |
QA164163 | Avanafil Impurity 37 CAS# NA M.F.: C14H14ClN3O4S M.W.: 355.80 |
| |
QA164160 | Avanafil Impurity 34 CAS# NA M.F.: C26H22Cl2N6O7 M.W.: 601.39 |
| |
QA164159 | Avanafil Impurity 33 CAS# NA M.F.: C30H30Cl2N6O7 M.W.: 657.50 |
| |
QA164158 | Avanafil Impurity 32 CAS# 330786-34-0 M.F.: C14H14ClN3O3S M.W.: 339.80 |
| |
QA164156 | Avanafil Impurity 30 CAS# NA M.F.: C16H17Cl2N3O3S M.W.: 402.30 |
| |
QN151852 | Noradrenaline (Norepinephrine) Impurity 52 CAS# NA M.F.: C8H11NO3 M.W.: 169.18 |
| |
QN151851 | Noradrenaline (Norepinephrine) Impurity 51 CAS# 4779-94-6(HCl salt) M.F.: C8H11NO2 M.W.: 153.18 |
| |
QN151850 | Noradrenaline (Norepinephrine) Impurity 50 CAS# NA M.F.: C8H11NO4 M.W.: 185.18 |
| |
QN151849 | Noradrenaline (Norepinephrine) Impurity 49 CAS# NA M.F.: C8H11NO4 M.W.: 185.18 |
| |
QN151848 | Noradrenaline (Norepinephrine) Impurity 48 CAS# NA M.F.: C8H11NO4 M.W.: 185.18 |
| |
QN151847 | Noradrenaline (Norepinephrine) Impurity 47 CAS# NA M.F.: C8H11NO3 M.W.: 169.18 |
| |
QN151846 | Noradrenaline (Norepinephrine) Impurity 46 CAS# 94593-04-1 M.F.: C8H9NO3 M.W.: 167.16 |
| |
QN151845 | Noradrenaline (Norepinephrine) Impurity 45 CAS# 117883-03-1 M.F.: C8H7NO3 M.W.: 165.15 |
| |
QN151844 | Noradrenaline (Norepinephrine) Impurity 44 CAS# NA M.F.: C8H7NO3 M.W.: 165.15 |
| |
QN151843 | Noradrenaline (Norepinephrine) Impurity 43 CAS# NA M.F.: C10H8Cl2O4 M.W.: 263.07 |
| |
QN151842 | Noradrenaline (Norepinephrine) Impurity 42 CAS# NA M.F.: C8H5ClO3 M.W.: 184.58 |
| |
QS201218 | Sertraline Impurity 18 CAS# NA M.F.: C17H17Cl2NO M.W.: 322.23 |
| |
QR052213 | Revefenacin Impurity 13 CAS# 90-41-5 M.F.: C12H11N M.W.: 169.22 |
| |
QB051316 | Bempedoic acid Impurity 16 CAS# 36635-61-7 M.F.: C9H9NO2S M.W.: 195.24 |
| |
QB051315 | Bempedoic acid Impurity 15 CAS# NA M.F.: C18H18N2O4S2 M.W.: 390.48 |
| |
QB051314 | Bempedoic acid Impurity 14 CAS# 36635-56-0 M.F.: C9H11NO3S M.W.: 213.25 |
| |
QB051313 | Bempedoic acid Impurity 13 CAS# NA M.F.: C21H38O5 M.W.: 370.52 |
| |
QB051312 | Bempedoic acid Impurity 12 CAS# NA M.F.: C20H36O5 M.W.: 356.50 |
| |
QB051311 | Bempedoic acid Impurity 11 CAS# NA M.F.: C21H38O5 M.W.: 370.52 |
| |
QB051310 | Bempedoic acid Impurity 10 CAS# 123469-92-1 M.F.: C11H21BrO2 M.W.: 265.19 |
| |
QB051309 | Bempedoic acid Impurity 9 CAS# NA M.F.: C12H22O3 M.W.: 214.30 |
| |
QB051308 | Bempedoic acid Impurity 8 CAS# NA M.F.: C20H29NO4S M.W.: 379.51 |
| |
QB051307 | Bempedoic acid Impurity 7 CAS# NA M.F.: C17H32O4 M.W.: 300.43 |
| |
QB051306 | Bempedoic acid Impurity 6 CAS# NA M.F.: C11H21BrO2 M.W.: 265.19 |
| |
QB051305 | Bempedoic acid Impurity 5 CAS# 413624-71-2 M.F.: C19H34O5 M.W.: 342.47 |
| |
QB051304 | Bempedoic acid Impurity 4 CAS# 738606-43-4 M.F.: C23H42O5 M.W.: 398.58 |
| |
QB051303 | Bempedoic acid Impurity 3 CAS# NA M.F.: C31H49NO6S M.W.: 563.79 |
| |
QB051302 | Bempedoic acid Impurity 2 CAS# 2280838-78-8 M.F.: C11H22O3 M.W.: 202.29 |
| |
QB051301 | Bempedoic acid Impurity 1 CAS# 7443-29-0 M.F.: C9H17BrO2 M.W.: 237.13 |
| |
QV307772 | Vitamin K1 Impurity 72 CAS# NA M.F.: C31H46O4 M.W.: 482.69 |
| |
QV307770 | Vitamin K1 Impurity 70 CAS# 22399-39-9 M.F.: C13H10O3 M.W.: 214.22 |
| |
QL151413 | Lornoxicam Impurity 13 CAS# 59804-27-2 M.F.: C7H9NO4S2 M.W.: 235.28 |
| |
QL151412 | Lornoxicam Impurity 12 CAS# NA M.F.: C6H5ClO5S2 M.W.: 256.68 |
| |
QI191918 | Isosorbide Impurity 18 CAS# 100402-56-0;27299-12-3(free base) M.F.: C6H12O5 C6H12O6 M.W.: 164.16 180.16 |
| |
QI191917 | Isosorbide Impurity 17 CAS# 13042-38-1 M.F.: C10H14O6 M.W.: 230.21 |
| |
QI191916 | Isosorbide Impurity 16 CAS# 65940-93-4 M.F.: C8H12O5 M.W.: 188.18 |
| |
QL051510 | Calcium Levofolinate Impurity 10; Calcium Folinate Hydrate EP Impurity B CAS# 98814-60-9 M.F.: C21H23N7O8 M.W.: 501.45 |
| |
QT0307174 | Ticagrelor Impurity 174 CAS# 3721-26-4 M.F.: C9H11N M.W.: 133.19 |
| |
QT1406157 | Tenofovir Impurity 157 CAS# NA M.F.: C21H29N6O5P M.W.: 476.47 |
| |
QE200376 | Entacapone Impurity 76 CAS# 158693-01-7 M.F.: C10H7N3O5 M.W.: 249.18 |
| |
QE200375 | Entacapone Impurity 75 CAS# NA M.F.: C14H16N2O7 M.W.: 324.29 |
| |
QP090315 | Sodium Picosulfate Impurity 15 CAS# NA M.F.: C18H13NNa2O8S2 M.W.: 481.41 |
| |
QA202298 | Atorvastatin EP Impurity J CAS# NA M.F.: C33H33FN2O4 M.W.: 540.62 |
| |
QF012226 | Favipiravir Impurity 26 CAS# NA M.F.: C5H2FN3O M.W.: 139.09 |
| |
QL162031 | Lapatinib Impurity 31 CAS# 202196-46-1 M.F.: C26H19N3O3 M.W.: 421.45 |
| |
QI091629 | Ipratropium Bromide Impurity 29 CAS# 3423-23-2;94217-34-2(HCl salt) M.F.: C10H19NO M.W.: 169.26 |
| |
QV200104 | Vitamin A epoxide CAS# 512-39-0 M.F.: C20H30O2 M.W.: 302.45 |
| |
QA122613 | Alprazolam Impurity 13 CAS# NA M.F.: C15H13ClN4 M.W.: 284.74 |
| |
QA122612 | Alprazolam Impurity 12 CAS# 5220-83-7 M.F.: C15H11ClN2O M.W.: 270.71 |
| |
QM031626 | Mycophenolate Impurity 26 CAS# NA M.F.: C17H20O7 M.W.: 336.34 |
| |
QT012800 | Taurocholic Acid Sodium Salt Hydrate CAS# 345909-26-4; 81-24-3(free base);145-42-6(Na salt) M.F.: C26H44NNaO7S XH2O M.W.: 537.68 X18.02 |
| |
QF120318 | Folic Acid Impurity 18 CAS# NA M.F.: C7H7N5O2 M.W.: 193.16 |
| |
QF120317 | Folic Acid Impurity 17 CAS# 948-60-7 M.F.: C7H5N5O3 M.W.: 207.15 |
| |
QF120316 | Folic Acid Impurity 16 CAS# 708-75-8 M.F.: C7H7N5O M.W.: 177.16 |
| |
QD050120 | Dexrazoxane Impurity 20 CAS# NA M.F.: C14H24N2O8 M.W.: 348.35 |
| |
QE042849 | Edoxaban Impurity 49 CAS# NA M.F.: C8H11IN2OS2 M.W.: 342.22 |
| |
QT183100 | Trihydroxycoprostanic Acid CAS# 547-98-8 M.F.: C27H46O5 M.W.: 450.65 |
| |
QP020382 | Palbociclib Impurity 82 CAS# 1023594-50-4 M.F.: C14H22N4O2 M.W.: 278.35 |
| |
QA1624147 | Apixaban Impurity 147 CAS# NA M.F.: C27H28N4O5 M.W.: 488.54 |
| |
QA1624146 | Apixaban Impurity 146 CAS# NA M.F.: C25H25N5O4 M.W.: 459.50 |
| |
QD160768 | Dapagliflozin Impurity 68 CAS# NA M.F.: C10H20O6 M.W.: 236.26 |
| |
QD160766 | Dapagliflozin Impurity 66 CAS# NA M.F.: C15H14ClIO2 M.W.: 388.63 |
| |
QS060287 | Sofosbuvir Impurity 87 CAS# NA M.F.: C31H26FN3O7 M.W.: 571.55 |
| |
QC242034 | Cefoxitin Impurity 34 CAS# NA M.F.: C10H14N2O3S M.W.: 242.29 |
| |
QA142703 | Androstenediol Impurity 3 CAS# 68539-12-8 M.F.: C19H24O2 M.W.: 284.39 |
| |
QF051805 | Ferulic acid Impurity 5 CAS# 32263-14-2 M.F.: C9H10O3 M.W.: 166.17 |
| |
QF051804 | Ferulic acid Impurity 4 CAS# 2931-90-0 M.F.: C9H8O4 M.W.: 180.16 |
| |
QP184001 | Pregnanediol-3alpha-glucuronide CAS# 1852-49-9 M.F.: C27H44O8 M.W.: 496.63 |
| |
QO192071 | Oseltamivir Impurity 71 CAS# NA M.F.: C22H32N2O6 M.W.: 420.50 |
| |
QV050308 | Vecuronium Bromide Impurity 8 CAS# 13522-16-2 M.F.: C29H50N2O2 M.W.: 458.72 |
| |
QV050307 | Vecuronium Bromide Impurity 7 CAS# 13522-14-0 M.F.: C29H48N2O2 M.W.: 456.70 |
| |
QL091663 | Lipoic Acid Impurity 37 CAS# NA M.F.: C8H14O3S2 M.W.: 222.32 |
| |
QT180673 | Tirofiban Impurity 73 CAS# 10147-36-1 M.F.: C3H7ClO2S M.W.: 142.60 |
| |
QV010714 | Valganciclovir EP Impurity P CAS# 897937-73-4 M.F.: C19H31N7O6 M.W.: 453.49 |
| |
QP180781 | Pregabalin Impurity 81 CAS# NA M.F.: C8H14N2O M.W.: 154.21 |
| |
QL091662 | Lipoic Acid Impurity 36 CAS# 188783-96-2 M.F.: C8H14O3S2 M.W.: 222.32 |
| |
QL091661 | Lipoic Acid Impurity 35 CAS# NA M.F.: C8H14O3S2 M.W.: 222.32 |
| |
QL091660 | Lipoic Acid Impurity 34 CAS# NA M.F.: C8H14O3S2 M.W.: 222.32 |
| |
QL091659 | Lipoic Acid Impurity 33 CAS# 188745-24-6 M.F.: C8H14O3S2 M.W.: 222.32 |
| |
QL091658 | Lipoic Acid Impurity 32 CAS# 119365-69-4 M.F.: C8H16O2S2 M.W.: 208.34 |
| |
QK201632 | Ketoprofen Impurity 32 CAS# 1853132-06-5 M.F.: C26H32O3 M.W.: 392.53 |
| |
QC0303106 | Cinacalcet Impurity 106 CAS# 217483-10-8 M.F.: C17H20O3S M.W.: 304.40 |
| |
QD182400 | Droxidopa CAS# 23651-95-8 M.F.: C9H11NO5 M.W.: 213.19 |
| |
QD050400 | Dehydrocholic acid CAS# 81-23-2 M.F.: C24H34O5 M.W.: 402.52 |
| |
QE161242 | Epalrestat Impurity 16 CAS# 1151944-57-8 M.F.: C12H9NO3S2 M.W.: 279.33 |
| |
QC022023 | Cabazitaxel Impurity 23 CAS# NA M.F.: C44H55NO14 M.W.: 821.91 |
| |
QI201511 | Itopride Impurity K CAS# 3943-77-9 M.F.: C11H14O4 M.W.: 210.23 |
| |
QT180624 | Tirofiban Impurity X CAS# NA M.F.: C22H35ClN2O5S HCl M.W.: 475.04 36.46 |
| |
QU190432 | Ursodeoxycholic Acid Impurity 32 CAS# 108179-87-9 M.F.: C24H40O5 M.W.: 408.57 |
| |
QU190431 | Ursodeoxycholic Acid Impurity 31 CAS# 80434-32-8 M.F.: C24H40O5 M.W.: 408.57 |
| |
QU190430 | Ursodeoxycholic Acid Impurity 30 CAS# 2393-59-1 M.F.: C24H40O5 M.W.: 408.57 |
| |
QU190429 | Ursodeoxycholic Acid Impurity 29 CAS# 2393-58-0 M.F.: C24H40O5 M.W.: 408.57 |
| |
QU190428 | Ursodeoxycholic Acid Impurity 28 CAS# 6830-03-1 M.F.: C24H40O5 M.W.: 408.57 |
| |
QU190427 | Ursodeoxycholic Acid Impurity 27 CAS# 3338-16-7 M.F.: C24H40O5 M.W.: 408.57 |
| |
QU190426 | Ursodeoxycholic Acid Impurity 26 CAS# 570-62-7 M.F.: C24H40O4 M.W.: 392.57 |
| |
QC080302 | Cholic Acid Impurity 2 CAS# 566-24-5 M.F.: C24H40O4 M.W.: 392.57 |
| |
QC080301 | Cholic Acid Impurity 1 CAS# 89238-74-4 M.F.: C24H40O4 M.W.: 392.57 |
| |
QE201933 | Sacubitril Impurity 33 CAS# NA M.F.: C25H33NO5 M.W.: 427.53 |
| |
QS212500 | Suxamethonium chloride CAS# 6101-15-1 M.F.: C14H34Cl2N2O6 M.W.: 397.34 |
| |
QV307761 | Vitamin B6 Impurity 61 CAS# 58947-70-9 M.F.: C8H9NO3 M.W.: 167.16 |
| |
QF051803 | Ferulic acid Impurity 3 CAS# 4475-29-0 M.F.: C11H10O6 M.W.: 238.19 |
| |
QF051802 | trans-Ferulic acid CAS# 537-98-4 M.F.: C10H10O4 M.W.: 194.18 |
| |
QF051801 | Ferulic acid (cis) CAS# 1014-83-1 M.F.: C10H10O4 M.W.: 194.18 |
| |
QB131602 | Bimatoprost Impurity B CAS# NA M.F.: C25H37NO5 M.W.: 431.56 |
| |
QB131601 | Bimatoprost CAS# 155206-00-1 M.F.: C25H37NO4 M.W.: 415.57 |
| |
QP1824106 | Parecoxib Sodium Impurity 80 CAS# 198470-82-5 M.F.: C20H20N2O4S M.W.: 384.45 |
| |
QL050325 | Lercanidipine Impurity 25 CAS# NA M.F.: C23H35NOSi M.W.: 369.62 |
| |
QV220504 | Vedaprofen EP Impurity D CAS# NA M.F.: C19H22O2 M.W.: 282.38 |
| |
QP261633 | Pazopanib Impurity 33 CAS# 1226500-00-0 M.F.: C28H30N4O2S M.W.: 486.63 |
| |
QP261630 | Pazopanib Impurity 30 CAS# 1036585-24-6 M.F.: C7H10N2O2S M.W.: 186.23 |
| |
QI091628 | Ipratropium Bromide Impurity 28 CAS# 30833-12-6 M.F.: C10H17NO3 M.W.: 199.25 |
| |
QV220501 | Vedaprofen EP Impurity A CAS# NA M.F.: C20H24O2 M.W.: 296.40 |
| |
QV220103 | Valnemulin hydrochloride EP Impurity C CAS# NA M.F.: C36H61N3O6S M.W.: 663.95 |
| |
QV220102 | Valnemulin hydrochloride EP Impurity B CAS# NA M.F.: C26H43NO4S M.W.: 465.69 |
| |
QV220101 | Valnemulin hydrochloride EP Impurity A CAS# NA M.F.: C31H52N2O6S M.W.: 580.82 |
| |
QV220100 | Valnemulin hydrochloride CAS# 133868-46-9 M.F.: C31H53ClN2O5S M.W.: 601.28 |
| |
QU140400 | Undecylenic acid CAS# 112-38-9 M.F.: C11H20O2 M.W.: 184.28 |
| |
QT181007 | Trimipramine maleate EP Impurity G CAS# NA M.F.: C15H15N M.W.: 209.29 |
| |
QT181005 | Trimipramine maleate EP Impurity E CAS# NA M.F.: C25H37N3 M.W.: 379.58 |
| |
QT181003 | Trimipramine maleate EP Impurity C CAS# NA M.F.: C20H24N2 M.W.: 292.42 |
| |
QT181002 | Trimipramine maleate EP Impurity B CAS# NA M.F.: C19H24N2 M.W.: 280.41 |
| |
QT181001 | Trimipramine maleate EP Impurity A CAS# NA M.F.: C20H26N2O M.W.: 310.43 |
| |
QT181000 | Trimipramine maleate CAS# 521-78-8 M.F.: C24H30N2O4 M.W.: 410.51 |
| |
QT011302 | Tramazoline hydrochloride monohydrate EP Impurity B CAS# NA M.F.: C30H38N6O2 M.W.: 514.66 |
| |
QT011301 | Tramazoline hydrochloride monohydrate EP Impurity A CAS# NA M.F.: C13H13N3 M.W.: 211.26 |
| |
QT011300 | Tramazoline hydrochloride monohydrate CAS# 74195-73-6 M.F.: C13H20ClN3O M.W.: 269.77 |
| |
QT151700 | Tosylchloramide sodium CAS# NA M.F.: C7H13ClNNaO5S M.W.: 281.69 |
| |
QT151504 | Tolnaftate EP Impurity D CAS# NA M.F.: C8H11N M.W.: 121.18 |
| |
QT151502 | Tolnaftate EP Impurity B CAS# 127084-74-6 M.F.: C21H14O2S M.W.: 330.40 |
| |
QT151403 | Tolfenamic acid EP Impurity C CAS# NA M.F.: C14H10ClNO M.W.: 243.69 |
| |
QT151402 | Tolfenamic acid EP Impurity B CAS# 87-60-5 M.F.: C7H8ClN M.W.: 141.60 |
| |
QT151400 | Tolfenamic acid CAS# 13710-19-5 M.F.: C14H12ClNO2 M.W.: 261.70 |
| |
QT151303 | Tolbutamide EP Impurity C CAS# NA M.F.: C14H21N3O3S M.W.: 311.40 |
| |
QT090803 | Tioconazole EP Impurity C CAS# 119386-76-4 M.F.: C16H12BrCl3N2OS M.W.: 466.61 |
| |
QT090801 | Tioconazole EP Impurity A CAS# NA M.F.: C16H14Cl2N2OS M.W.: 353.27 |
| |
QT090706 | Tiaprofenic acid EP Impurity F CAS# NA M.F.: C11H7BrOS M.W.: 267.14 |
| |
QT090705 | Tiaprofenic acid EP Impurity E CAS# NA M.F.: C7H8O2S M.W.: 156.20 |
| |
QT090703 | Tiaprofenic acid EP Impurity C CAS# NA M.F.: C14H12O3S M.W.: 260.31 |
| |
QT090702 | Tiaprofenic acid EP Impurity B CAS# NA M.F.: C13H10O2S M.W.: 230.28 |
| |
QT090701 | Tiaprofenic acid EP Impurity A CAS# NA M.F.: C13H12OS M.W.: 216.30 |
| |
QT090700 | Tiaprofenic acid CAS# 33005-95-7 M.F.: C14H12O3S M.W.: 260.31 |
| |
QT090505 | Tianeptine sodium EP Impurity E CAS# NA M.F.: C28H37ClN2O6S M.W.: 565.12 |
| |
QT090504 | Tianeptine sodium EP Impurity D CAS# NA M.F.: C21H23ClN2O4S M.W.: 434.94 |
| |
QT090503 | Tianeptine sodium EP Impurity C CAS# NA M.F.: C14H10ClNO3S M.W.: 307.75 |
| |
QT090502 | Tianeptine sodium EP Impurity B CAS# NA M.F.: C23H29ClN2O4S M.W.: 465.01 |
| |
QT090501 | Tianeptine sodium EP Impurity A CAS# NA M.F.: C9H17BrO2 M.W.: 237.13 |
| |
QT090500 | Tianeptine sodium CAS# 30123-17-2;66981-73-5(free base) M.F.: C21H24ClN2NaO4S M.W.: 458.93 |
| |
QA070278 | Argatroban Impurity 52 CAS# NA M.F.: C24H38N6O5S M.W.: 522.66 |
| |
QT081604 | Thiopental sodium and sodium carbonate EP Impurity D CAS# NA M.F.: C11H20N2O3S M.W.: 260.35 |
| |
QT081603 | Thiopental sodium and sodium carbonate EP Impurity C CAS# NA M.F.: C11H18N2O2S M.W.: 242.34 |
| |
QT081601 | Thiopental sodium and sodium carbonate EP Impurity A CAS# NA M.F.: C9H14N2O2S M.W.: 214.28 |
| |
QT081600 | Thiopental sodium and sodium carbonate CAS# NA M.F.: C11H17N2NaO2S M.W.: 264.32 |
| |
QT052301 | Tetryzoline hydrochloride EP Impurity A CAS# NA M.F.: C11H11N M.W.: 157.21 |
| |
QT052300 | Tetryzoline hydrochloride CAS# 522-48-5 M.F.: C13H17ClN2 M.W.: 236.74 |
| |
QT052203 | Tetracaine hydrochloride EP Impurity C CAS# 71839-12-8 M.F.: C12H17NO2 M.W.: 207.27 |
| |
QT052202 | Tetracaine hydrochloride EP Impurity B CAS# 4740-24-3 M.F.: C11H15NO2 M.W.: 193.24 |
| |
QT052200 | Tetracaine hydrochloride CAS# 136-47-0;94-24-6(free base) M.F.: C15H25ClN2O2 M.W.: 300.82 |
| |
QT052110 | Terfenadine EP Impurity J CAS# NA M.F.: C22H35NO3 M.W.: 361.52 |
| |
QT052108 | Terfenadine EP Impurity H CAS# NA M.F.: C32H41NO M.W.: 455.67 |
| |
QT052104 | Terfenadine EP Impurity D CAS# NA M.F.: C32H39NO M.W.: 453.66 |
| |
QT052103 | Terfenadine EP Impurity C CAS# NA M.F.: C32H41NO3 M.W.: 487.67 |
| |
QT052102 | Terfenadine EP Impurity B CAS# NA M.F.: C32H41NO M.W.: 455.67 |
| |
QM050610 | Mefenamic Acid Impurity 10 CAS# NA M.F.: C13H8Cl2O2 M.W.: 267.11 |
| |
QT052101 | Terfenadine EP Impurity A CAS# NA M.F.: C32H39NO2 M.W.: 469.66 |
| |
QT130107 | Temazepam EP Impurity G CAS# 93329-92-1 M.F.: C17H15ClN2O2 M.W.: 314.77 |
| |
QT130106 | Temazepam EP Impurity F CAS# 3294-96-0 M.F.: C16H13ClN2O2 M.W.: 300.74 |
| |
QT130105 | Controlled Substance (Temazepam EP Impurity E) CAS# 2888-64-4 M.F.: C16H13ClN2O2 M.W.: 300.74 |
| |
QT130104 | Temazepam EP Impurity D CAS# 17191-70-7 M.F.: C17H15ClN2O2 M.W.: 314.77 |
| |
QT130102 | Controlled Substance (Temazepam EP Impurity B) CAS# 604-75-1 M.F.: C15H11ClN2O2 M.W.: 286.71 |
| |
QS211703 | Sulindac EP Impurity C CAS# 49627-27-2 M.F.: C20H17FO2S M.W.: 340.41 |
| |
QS211702 | Sulindac EP Impurity B CAS# 59973-80-7 M.F.: C20H17FO4S M.W.: 372.41 |
| |
QS211701 | Sulindac EP Impurity A CAS# 53933-60-1 M.F.: C20H17FO3S M.W.: 356.41 |
| |
QI192222 | Isavuconazole Impurity 22 CAS# NA M.F.: C29H35ClF2N8O5S M.W.: 681.15 |
| |
QS211601 | Sulfinpyrazone EP Impurity A CAS# NA M.F.: C23H20N2O4S M.W.: 420.48 |
| |
QS211405 | Sulfadimidine EP Impurity E CAS# 144-80-9 M.F.: C8H10N2O3S M.W.: 214.24 |
| |
QS211400 | Sulfadimidine CAS# 57-68-1 M.F.: C12H14N4O2S M.W.: 278.33 |
| |
QS211205 | Sulfadiazine EP Impurity E CAS# 127-74-2 M.F.: C12H12N4O3S M.W.: 292.31 |
| |
QS211201 | Sulfadiazine EP Impurity A CAS# 109-12-6 M.F.: C4H5N3 M.W.: 95.10 |
| |
QS531507 | Sucralose EP Impurity G CAS# NA M.F.: C12H18Cl2O8 M.W.: 361.17 |
| |
QS531506 | Sucralose EP Impurity F CAS# NA M.F.: C12H20Cl2O9 M.W.: 379.19 |
| |
QS531505 | Sucralose EP Impurity E CAS# NA M.F.: C12H20Cl2O9 M.W.: 379.19 |
| |
QS531502 | Sucralose EP Impurity B CAS# NA M.F.: C12H19Cl3O8 M.W.: 397.63 |
| |
QS201800 | Streptomycin sulfate CAS# 3810-74-0;57-92-1(free base) M.F.: C42H84N14O36S3 M.W.: 1457.38 |
| |
QP1903103 | Posaconazole Impurity 103 CAS# 81445-44-5 M.F.: C10H12O2 M.W.: 164.20 |
| |
QS201402 | Stanozolol EP Impurity B CAS# NA M.F.: C21H32O3 M.W.: 332.48 |
| |
QS201400 | Stanozolol CAS# 10418-03-8 M.F.: C21H32N2O M.W.: 328.49 |
| |
QS152004 | Sotalol hydrochloride EP Impurity D CAS# 2724689-38-5;2724689-39-6(HCl salt) M.F.: C12H20N2O3S M.W.: 272.36 |
| |
QS152003 | Sotalol hydrochloride EP Impurity C CAS# 83922-54-7 M.F.: C8H9NO3S M.W.: 199.23 |
| |
QS152002 | Sotalol hydrochloride EP Impurity B CAS# 60735-85-5;5576-49-8(HCl salt) M.F.: C12H18N2O3S M.W.: 270.35 |
| |
QS152001 | Sotalol hydrochloride EP Impurity A CAS# 16974-42-8;16974-44-0(HCl salt) M.F.: C12H20N2O2S M.W.: 256.36 |
| |
QS152000 | Sotalol hydrochloride CAS# 959-24-0;3930-20-9(free base); 366-80-3(2HCl salt);1350271-32-7(HBr salt) M.F.: C12H21ClN2O3S M.W.: 308.82 |
| |
QC051400 | Cefalotin Sodium CAS# 58-71-9 M.F.: C16H15N2NaO6S2 M.W.: 418.42 |
| |
QS151100 | Sodium salicylate CAS# 54-21-7 M.F.: C7H5NaO3 M.W.: 160.10 |
| |
QS151000 | Sodium propionate CAS# 137-40-6 M.F.: C3H5NaO2 M.W.: 96.06 |
| |
QS150900 | Ethylparaben sodium;Sodium ethyl parahydroxybenzoate CAS# 35285-68-8 M.F.: C9H9NaO3 M.W.: 188.16 |
| |
QS150810 | Sodium caprylate EP Impurity J; Caprylic acid EP Impurity J CAS# NA M.F.: C8H14O2 M.W.: 142.20 |
| |
QS150809 | Sodium caprylate EP Impurity I; Caprylic acid EP Impurity I CAS# NA M.F.: C11H22O2 M.W.: 170.29 |
| |
QS150808 | Sodium caprylate EP Impurity H; Caprylic acid EP Impurity H CAS# 110-42-9 M.F.: C11H22O2 M.W.: 186.29 |
| |
QS150807 | Sodium caprylate EP Impurity G; Caprylic acid EP Impurity G CAS# NA M.F.: C10H20O2 M.W.: 172.26 |
| |
QS150806 | Sodium caprylate EP Impurity F; Caprylic acid EP Impurity F CAS# 111-11-5 M.F.: C9H18O2 M.W.: 158.24 |
| |
QS150804 | Sodium caprylate EP Impurity D; Caprylic acid EP Impurity D;Decanoic acid CAS# NA M.F.: C10H20O2 M.W.: 172.26 |
| |
QS150803 | Sodium caprylate EP Impurity C; Caprylic acid EP Impurity C;Nonanoic acid CAS# NA M.F.: C9H18O2 M.W.: 158.24 |
| |
QS150802 | Sodium caprylate EP Impurity B CAS# NA M.F.: C7H14O2 M.W.: 130.18 |
| |
QS150801 | Sodium caprylate EP Impurity A CAS# NA M.F.: C6H12O2 M.W.: 116.16 |
| |
QS150800 | Sodium caprylate CAS# 1984-06-1 M.F.: C8H15NaO2 M.W.: 166.19 |
| |
QS150701 | Sodium calcium edetate EP Impurity A CAS# 139-13-9 M.F.: C6H9NO6 M.W.: 191.14 |
| |
QS150700 | Sodium calcium edetate CAS# 62-33-9 M.F.: C10H12CaN2Na2O8,xH2O M.W.: 374.27,x18.02 |
| |
QZ090300 | Zinc undecylenate CAS# 557-08-4 M.F.: C22H38O4Zn M.W.: 431.91 |
| |
QZ091403 | Zinc acexamate EP Impurity C CAS# 1888-91-1 M.F.: C8H13NO2 M.W.: 155.19 |
| |
QZ091401 | Zinc acexamate EP Impurity A CAS# NA M.F.: C14H26N2O4 M.W.: 286.37 |
| |
QZ091400 | Zinc acexamate CAS# 70020-71-2 M.F.: C16H28N2O6Zn M.W.: 409.78 |
| |
QY151205 | Yohimbine hydrochloride EP Impurity E CAS# NA M.F.: C22H28N2O3 M.W.: 368.47 |
| |
QS150600 | Sodium aminosalicylate dihydrate CAS# 6018-19-5 M.F.: C7H10NNaO5 M.W.: 211.15 |
| |
QS150502 | Sodium amidotrizoate EP Impurity B; Amidotrizoic Acid EP Impurity B CAS# NA M.F.: C11H10I2N2O4 M.W.: 488.02 |
| |
QS150500 | Sodium amidotrizoate CAS# 737-31-5 M.F.: C11H8I3N2NaO4 M.W.: 635.90 |
| |
QS150400 | Sodium alendronate trihydrate CAS# 121268-17-5 M.F.: C4H18NNaO10P2 M.W.: 325.12 |
| |
QS052000 | Sertaconazole nitrate CAS# 99592-39-9 M.F.: C20H16Cl3N3O4S M.W.: 500.78 |
| |
QS051300 | Selenium disulfide CAS# 7488-56-4 M.F.: S2Se M.W.: 143.09 |
| |
QS011708 | Saquinavir mesilate EP Impurity H CAS# NA M.F.: C38H47N5O5 M.W.: 653.81 |
| |
QS011707 | Saquinavir mesilate EP Impurity G CAS# NA M.F.: C39H51N5O6 M.W.: 685.85 |
| |
QS011706 | Saquinavir mesilate EP Impurity F CAS# NA M.F.: C38H48N6O4 M.W.: 652.83 |
| |
QS011705 | Saquinavir mesilate EP Impurity E CAS# NA M.F.: C38H49N5O6 M.W.: 671.83 |
| |
QS011704 | Saquinavir mesilate EP Impurity D CAS# NA M.F.: C38H50N6O5 M.W.: 670.84 |
| |
QS011703 | Saquinavir mesilate EP Impurity C CAS# NA M.F.: C24H39N3O2 M.W.: 401.59 |
| |
QS011702 | Saquinavir mesilate EP Impurity B CAS# NA M.F.: C16H17N3O4 M.W.: 315.32 |
| |
QS011701 | Saquinavir mesilate EP Impurity A CAS# NA M.F.: C14H13N3O4 M.W.: 287.27 |
| |
QS011700 | Saquinavir mesilate CAS# 149845-06-7 M.F.: C39H54N6O8S M.W.: 766.95 |
| |
QS011230 | Salmeterol xinafoate CAS# 94749-08-3;89365-50-4(free base) M.F.: C36H45NO7 M.W.: 603.75 |
| |
QS010410 | Saccharin sodium CAS# 128-44-9 M.F.: C7H4NNaO3S M.W.: 205.17 |
| |
QR212203 | Rutoside trihydrate EP Impurity C;Quercetin CAS# 117-39-5 M.F.: C15H10O7 M.W.: 302.24 |
| |
QR212202 | Rutoside trihydrate EP Impurity B; Nicotiflorin;Kaempferol-3-O-rutinoside CAS# 17650-84-9 M.F.: C27H30O15 M.W.: 594.52 |
| |
QR212201 | Rutoside trihydrate EP Impurity A CAS# 21637-25-2 M.F.: C21H20O12 M.W.: 464.38 |
| |
QR212200 | Rutoside trihydrate CAS# 250249-75-3 M.F.: C27H36O19 M.W.: 664.56 |
| |
QR091905 | Risedronate sodium 2.5-hydrate EP Impurity E CAS# 75755-10-1 M.F.: C7H11NO6P2 M.W.: 267.11 |
| |
QR091904 | Risedronate sodium 2.5-hydrate EP Impurity D CAS# 501-81-5 M.F.: C7H7NO2 M.W.: 137.14 |
| |
QR091903 | Risedronate sodium 2.5-hydrate EP Impurity C CAS# 105462-25-7 M.F.: C7H11NO7P2 M.W.: 283.11 |
| |
QR091902 | Risedronate sodium 2.5-hydrate EP Impurity B CAS# 105462-23-5;1220806-40-5(monohydrate) M.F.: C7H11NO7P2 M.W.: 283.11 |
| |
QR091901 | Risedronate sodium 2.5-hydrate EP Impurity A CAS# NA M.F.: C14H18N2O12P4 M.W.: 530.19 |
| |
QR091900 | Risedronate sodium 2.5-hydrate CAS# 329003-65-8 M.F.: C7H10NNaO7P2,2½H2O M.W.: 350.13 |
| |
QM040139 | Midazolam Impurity 13 CAS# 60656-76-0 M.F.: C16H11ClFN3O3 M.W.: 347.73 |
| |
QR091303 | Rilmenidine dihydrogen phosphate EP Impurity C CAS# NA M.F.: C17H26N2O M.W.: 274.40 |
| |
QR091302 | Rilmenidine dihydrogen phosphate EP Impurity B CAS# NA M.F.: C10H17ClN2O M.W.: 216.71 |
| |
QR091301 | Rilmenidine dihydrogen phosphate EP Impurity A CAS# NA M.F.: C10H18N2O2 M.W.: 198.26 |
| |
QR091300 | Rilmenidine dihydrogen phosphate CAS# 85409-38-7 M.F.: C10H19N2O5P M.W.: 278.24 |
| |
QR090705 | Rifabutin EP Impurity E CAS# 100324-63-8 M.F.: C44H60N4O10 M.W.: 804.97 |
| |
QR090704 | Rifabutin EP Impurity D CAS# 62041-01-4 M.F.: C37H47N3O11 M.W.: 709.78 |
| |
QR090702 | Rifabutin EP Impurity B CAS# 51756-80-0 M.F.: C37H46N2O12 M.W.: 710.77 |
| |
QR090701 | Rifabutin EP Impurity A CAS# NA M.F.: C9H17NO M.W.: 155.24 |
| |
QQ211403 | Quinidine sulfate EP Impurity C CAS# NA M.F.: C20H26N2O2 M.W.: 326.43 |
| |
QQ211402 | Quinidine sulfate EP Impurity B CAS# NA M.F.: C19H22N2O M.W.: 294.39 |
| |
QQ211401 | Quinidine sulfate EP Impurity A CAS# NA M.F.: C20H24N2O2 M.W.: 324.42 |
| |
QP252002 | Pyridostigmine bromide EP Impurity B CAS# NA M.F.: C6H8NO M.W.: 110.13 |
| |
QP252001 | Pyridostigmine bromide EP Impurity A CAS# 51581-32-9 M.F.: C8H10N2O2 M.W.: 166.18 |
| |
QP252000 | Pyridostigmine bromide CAS# 101-26-8;155-97-5(cation form) M.F.: C9H13BrN2O2 M.W.: 261.12 |
| |
QP251903 | Pyrantel embonate EP Impurity C CAS# NA M.F.: C5H4OS M.W.: 112.15 |
| |
QP251902 | Pyrantel embonate EP Impurity B CAS# NA M.F.: C11H16N2OS M.W.: 224.32 |
| |
QP251901 | Pyrantel embonate EP Impurity A CAS# 36700-38-6 M.F.: C11H14N2S M.W.: 206.31 |
| |
QP251900 | Pyrantel embonate CAS# 22204-24-6 M.F.: C34H30N2O6S M.W.: 594.68 |
| |
QP152104 | Protirelin EP Impurity D CAS# NA M.F.: C16H21N5O5 M.W.: 363.37 |
| |
QP152102 | Protirelin EP Impurity B CAS# NA M.F.: C16H22N6O4 M.W.: 362.38 |
| |
QP152101 | Protirelin EP Impurity A CAS# NA M.F.: C16H22N6O4 M.W.: 362.38 |
| |
QP151802 | Propyphenazone EP Impurity B CAS# NA M.F.: C14H18N2O M.W.: 230.31 |
| |
QP151800 | Propyphenazone CAS# 479-92-5 M.F.: C14H18N2O M.W.: 230.31 |
| |
QP151700 | Propantheline bromide CAS# 50-34-0 M.F.: C23H30BrNO3 M.W.: 448.39 |
| |
QP151600 | Propacetamol hydrochloride CAS# 66532-86-3 M.F.: C14H20N2O3.HCl M.W.: 264.32 36.46 |
| |
QP151501 | Promazine hydrochloride EP Impurity A CAS# NA M.F.: C17H20N2OS M.W.: 300.42 |
| |
QP150704 | Proguanil hydrochloride EP Impurity D CAS# NA M.F.: C8H19N5 M.W.: 185.27 |
| |
QP150703 | Proguanil hydrochloride EP Impurity C CAS# NA M.F.: C14H13Cl2N5 M.W.: 322.19 |
| |
QP150701 | Proguanil hydrochloride EP Impurity A CAS# NA M.F.: C5H10N4 M.W.: 126.16 |
| |
QP150700 | Proguanil hydrochloride CAS# 637-32-1 M.F.: C11H17Cl2N5 M.W.: 290.19 |
| |
QP150300 | Prochlorperazine maleate CAS# 84-02-6 M.F.: C28H32ClN3O8S M.W.: 606.09 |
| |
QP150204 | Probenecid EP Impurity D CAS# 70190-76-0 M.F.: C15H23NO4S M.W.: 313.41 |
| |
QM050609 | Mefenamic Acid Impurity 9 CAS# NA M.F.: C14H9ClO4 M.W.: 276.67 |
| |
QP150203 | Probenecid EP Impurity C CAS# NA M.F.: C19H32N2O3S M.W.: 368.53 |
| |
QM050608 | Mefenamic Acid Impurity 8 CAS# NA M.F.: C13H8Cl2O2 M.W.: 267.11 |
| |
QM050607 | Mefenamic Acid Impurity 7 CAS# NA M.F.: C13H8Cl2O2 M.W.: 267.11 |
| |
QP150201 | Probenecid EP Impurity A CAS# 636-78-2 M.F.: C7H6O5S M.W.: 202.18 |
| |
QP150200 | Probenecid CAS# 57-66-9 M.F.: C13H19NO4S M.W.: 285.36 |
| |
QM050606 | Mefenamic Acid Impurity 6 CAS# NA M.F.: C13H8Cl2O2 M.W.: 267.11 |
| |
QT211500 | Taurochenodeoxycholic Acid CAS# 516-35-8;6009-98-9(Na salt) M.F.: C26H45NO6S M.W.: 499.70 |
| |
QF012218 | Favipiravir Impurity 18 CAS# 2305633-62-7 M.F.: C5H2BrN3O M.W.: 199.99 |
| |
QT0307166 | Ticagrelor Impurity 166 CAS# 187666-88-2 M.F.: C7H10N2O2S M.W.: 186.23 |
| |
QC031612 | Cefcapene pivoxil Impurity 12 CAS# NA M.F.: C22H27N5O8S2 M.W.: 553.61 |
| |
QC031611 | Cefcapene pivoxil Impurity 11 CAS# 105889-80-3 M.F.: C28H37N5O10S2 M.W.: 667.75 |
| |
QC031609 | Cefcapene pivoxil Impurity 9 CAS# NA M.F.: C24H30N4O8S2 M.W.: 566.65 |
| |
QC031608 | Cefcapene pivoxil Impurity 8 CAS# NA M.F.: C22H28N4O7S2 M.W.: 524.61 |
| |
QC031607 | Cefcapene pivoxil Impurity 7 CAS# NA M.F.: C23H31N5O9S2 M.W.: 585.65 |
| |
QC031606 | Cefcapene pivoxil Impurity 6 CAS# NA M.F.: C23H29N5O9S2 M.W.: 583.63 |
| |
QC031605 | Cefcapene pivoxil Impurity 5 CAS# NA M.F.: C39H45N9O12S4 M.W.: 960.09 |
| |
QC031604 | Cefcapene pivoxil Impurity 4 CAS# NA M.F.: C17H19N5O6S2 M.W.: 453.49 |
| |
QC031603 | Cefcapene pivoxil Impurity 3 CAS# NA M.F.: C23H29N5O8S2 M.W.: 567.64 |
| |
QC031602 | Cefcapene pivoxil Impurity 2 CAS# NA M.F.: C23H29N5O8S2 M.W.: 567.64 |
| |
QC031601 | Cefcapene pivoxil Impurity 1 CAS# NA M.F.: C16H16N4O4S2 M.W.: 392.45 |
| |
QC031600 | Cefcapene pivoxil CAS# 105889-45-0;147816-23-7(HCl salt); 147816-24-8(H2O HCl salt) M.F.: C23H29N5O8S2 M.W.: 567.64 |
| |
QC250223 | Cytarabine Impurity 23 CAS# 6698-20-0 M.F.: C9H11N3O4 M.W.: 225.20 |
| |
QT142424 | Tranexamic Acid Impurity 24 CAS# NA M.F.: C16H28N2O3 M.W.: 296.41 |
| |
QT142423 | Tranexamic Acid Impurity 23 CAS# NA M.F.: C16H16N2O3 M.W.: 284.31 |
| |
QT142422 | Tranexamic Acid Impurity 22 CAS# 98270-32-7 M.F.: C24H21NO6 M.W.: 419.43 |
| |
QT142421 | Tranexamic Acid Impurity 21 CAS# 14900-61-9 M.F.: C16H15NO4 M.W.: 285.29 |
| |
QT142420 | Tranexamic Acid Impurity 20 CAS# 179076-85-8 M.F.: C8H9NO3 M.W.: 167.16 |
| |
QT142419 | Tranexamic Acid Impurity 19 CAS# 165530-43-8;549531-01-3(HCl salt) M.F.: C8H8ClNO2 M.W.: 185.61 |
| |
QT142418 | Tranexamic Acid Impurity 18 CAS# 100-21-0 M.F.: C8H6O4 M.W.: 166.13 |
| |
QT142417 | Tranexamic Acid Impurity 17 CAS# 121-91-5 M.F.: C8H6O4 M.W.: 166.13 |
| |
QT142416 | Tranexamic Acid Impurity 16 CAS# 85888-81-9 M.F.: C8H7ClO2 M.W.: 170.59 |
| |
QT142415 | Tranexamic Acid Impurity 15 CAS# 31719-77-4 M.F.: C8H7ClO2 M.W.: 170.59 |
| |
QT142414 | Tranexamic Acid Impurity 14 CAS# 5264-40-4 M.F.: C8H5Cl3O2 M.W.: 239.48 |
| |
QT142413 | Tranexamic Acid Impurity 13 CAS# 5278-91-1 M.F.: C8H6Cl2O2 M.W.: 205.04 |
| |
QT142412 | Tranexamic Acid Impurity 12 CAS# NA M.F.: C8H6Cl2O2 M.W.: 205.04 |
| |
QR1922104 | Rosuvastatin Impurity 104 CAS# NA M.F.: C29H42FN3O7S M.W.: 595.72 |
| |
QP092302 | Pivmecillinam hydrochloride EP Impurity B CAS# NA M.F.: C21H35N3O6S M.W.: 457.58 |
| |
QP092301 | Pivmecillinam hydrochloride EP Impurity A CAS# NA M.F.: C14H22N2O5S M.W.: 330.40 |
| |
QP092203 | Pivampicillin EP Impurity C CAS# NA M.F.: C44H58N6O12S2 M.W.: 927.09 |
| |
QP092002 | Piretanide EP Impurity B CAS# NA M.F.: C21H25N3O5S M.W.: 431.51 |
| |
QP091903 | Pirenzepine EP Impurity C CAS# NA M.F.: C19H21N5O2 M.W.: 351.40 |
| |
QC182559 | Canagliflozin Impurity 59 CAS# NA M.F.: C24H25FO6S M.W.: 460.52 |
| |
QL130621 | Lamivudine Impurity 21 CAS# 147027-10-9 M.F.: C18H27N3O4S M.W.: 381.49 |
| |
QP161510 | Piperazine hydrate CAS# 142-63-2 M.F.: C4H22N2O6 M.W.: 194.23 |
| |
QP131605 | Pimozide EP Impurity E CAS# NA M.F.: C28H29F2N3O2 M.W.: 477.55 |
| |
QP131603 | Pimozide EP Impurity C CAS# NA M.F.: C28H29F2N3O M.W.: 461.55 |
| |
QP131602 | Pimozide EP Impurity B CAS# NA M.F.: C28H30FN3O M.W.: 443.56 |
| |
QA162971 | Apremilast Impurity 71 CAS# NA M.F.: C21H24N2O8S M.W.: 464.49 |
| |
QP131501 | Pimobendan EP Impurity A CAS# NA M.F.: C19H18N2O4 M.W.: 338.36 |
| |
QC012501 | Neochlorogenic acid CAS# 906-33-2 M.F.: C16H18O9 M.W.: 354.31 |
| |
QL051509 | Calcium Levofolinate Impurity 9 CAS# 2800-34-2 M.F.: C20H23N7O7 M.W.: 473.44 |
| |
QR152418 | Roxadustat Nitroso Impurity 1 CAS# 20689-96-7 M.F.: C9H12N2O M.W.: 164.20 |
| |
QA180243 | Arbidol Impurity 43 CAS# 153633-07-9 M.F.: C16H21BrN2O3 M.W.: 369.25 |
| |
QS010256 | Salbutamol Impurity 30 CAS# NA M.F.: C13H22BNO3 M.W.: 251.13 |
| |
QD241346 | Dexamethasone sodium phosphate EP Impurity C CAS# NA M.F.: C22H30FO8P M.W.: 472.44 |
| |
QI222037 | Itraconazole Impurity 37 CAS# NA M.F.: C34H35Cl3N8O4 M.W.: 726.05 |
| |
QB151435 | Bromfenac Impurity 9 CAS# 845276-75-7 M.F.: C13H10BrNO M.W.: 276.13 |
| |
QC061618 | Cefpodoxime Proxetil Impurity 18 CAS# NA M.F.: C25H33N5O11S2 M.W.: 643.69 |
| |
QT201620 | Tiotropium bromide Impurity 20 CAS# 1508-46-9 M.F.: C9H16BrNO2 M.W.: 250.13 |
| |
QP091704 | Picotamide monohydrate EP Impurity D CAS# NA M.F.: C6H8N2 M.W.: 108.14 |
| |
QP091703 | Picotamide monohydrate EP Impurity C CAS# NA M.F.: C15H14N2O4 M.W.: 286.28 |
| |
QP091702 | Picotamide monohydrate EP Impurity B CAS# NA M.F.: C15H14N2O4 M.W.: 286.28 |
| |
QP091700 | Picotamide monohydrate CAS# NA M.F.: C21H22N4O4 M.W.: 394.42 |
| |
QP082600 | Physostigmine salicylate CAS# 57-64-7 M.F.: C22H27N3O5 M.W.: 413.47 |
| |
QP081605 | Pholcodine EP Impurity E CAS# NA M.F.: C23H30N2O5 M.W.: 414.49 |
| |
QP081604 | Pholcodine EP Impurity D CAS# NA M.F.: C29H41N3O5 M.W.: 511.65 |
| |
QP050809 | Pethidine EP Impurity I CAS# NA M.F.: C15H19NO2 M.W.: 245.32 |
| |
QP050801 | Pethidine EP Impurity A CAS# 774-52-7 M.F.: C12H17N M.W.: 175.27 |
| |
QP181701 | Perphenazine EP Impurity A CAS# 10078-25-8 M.F.: C21H26ClN3O2S M.W.: 419.97 |
| |
QP050702 | Pergolide mesilate EP Impurity B CAS# NA M.F.: C19H26N2O2S M.W.: 346.49 |
| |
QR457038 | Rocuronium bromide Impurity 38 CAS# NA M.F.: C32H53BrN2O5 M.W.: 625.68 |
| |
QR457037 | Rocuronium bromide Impurity 37 CAS# 159325-45-8 M.F.: C23H35NO2 M.W.: 357.53 |
| |
QR457036 | Rocuronium bromide Impurity 36 CAS# NA M.F.: C23H36BrNO3 M.W.: 454.44 |
| |
QR457035 | Rocuronium bromide Impurity 35 CAS# NA M.F.: C23H37NO3 M.W.: 375.54 |
| |
QR457034 | Rocuronium bromide Impurity 34 CAS# NA M.F.: C19H28O2 M.W.: 288.42 |
| |
QR457033 | Rocuronium bromide Impurity 33 CAS# 50588-22-2 M.F.: C21H30O4 M.W.: 346.46 |
| |
QP051601 | Penbutolol sulfate EP Impurity A CAS# NA M.F.: C18H27NO2 M.W.: 289.41 |
| |
QR457032 | Rocuronium bromide Impurity 32 CAS# 10429-07-9 M.F.: C26H36O4S M.W.: 444.63 |
| |
QT140206 | Trandolapril EP Impurity F CAS# NA M.F.: C24H34N2O5 M.W.: 430.54 |
| |
QT140205 | Trandolapril EP Impurity E CAS# 87679-71-8 M.F.: C22H30N2O5 M.W.: 402.48 |
| |
QT140204 | Trandolapril EP Impurity D CAS# 149881-40-3 M.F.: C24H32N2O4 M.W.: 412.52 |
| |
QT140203 | Trandolapril EP Impurity C CAS# NA M.F.: C24H40N2O5 M.W.: 436.58 |
| |
QT140202 | Trandolapril EP Impurity B CAS# NA M.F.: C25H36N2O5 M.W.: 444.56 |
| |
QT140201 | Trandolapril EP Impurity A CAS# 118194-41-5 M.F.: C23H32N2O5 M.W.: 416.51 |
| |
QT010901 | Trapidil EP Impurity A CAS# 2503-56-2 M.F.: C6H6N4O M.W.: 150.14 |
| |
QT040900 | Trehalose dihydrate CAS# 6138-23-4 M.F.: C12H22O11,2H2O M.W.: 342.30 36.03 |
| |
QT041265 | Tadalafil Impurity 65 CAS# 1356345-67-9 M.F.: C23H23N3O4 M.W.: 405.45 |
| |
QL091657 | Lipoic Acid Impurity 31 CAS# NA M.F.: C8H14O3S2 M.W.: 222.32 |
| |
QL091656 | Lipoic Acid Impurity 30 CAS# NA M.F.: C8H14O3S2 M.W.: 222.32 |
| |
QO240204 | Oxybutynin hydrochloride EP Impurity D CAS# 4335-77-7 M.F.: C14H18O3 M.W.: 234.29 |
| |
QO240202 | Oxybutynin hydrochloride EP Impurity B CAS# 14943-53-4 M.F.: C22H25NO3 M.W.: 351.44 |
| |
QT022103 | Tributyl Acetylcitrate EP Impurity C CAS# NA M.F.: C20H34O8 M.W.: 402.48 |
| |
QT022102 | Tributyl Acetylcitrate EP Impurity B CAS# 7568-58-3 M.F.: C18H30O6 M.W.: 342.43 |
| |
QT022101 | Tributyl Acetylcitrate EP Impurity A CAS# 77-94-1 M.F.: C18H32O7 M.W.: 360.44 |
| |
QT022100 | Tributyl Acetylcitrate CAS# 77-90-7 M.F.: C20H34O8 M.W.: 402.48 |
| |
QO240200 | Oxybutynin hydrochloride CAS# 1508-65-2 M.F.: C22H32ClNO3 M.W.: 393.95 |
| |
QO241703 | Oxolinic acid EP Impurity C CAS# NA M.F.: C12H9NO5 M.W.: 247.20 |
| |
QO241702 | Oxolinic acid EP Impurity B CAS# NA M.F.: C15H15NO5 M.W.: 289.28 |
| |
QO241701 | Oxolinic acid EP Impurity A CAS# NA M.F.: C11H7NO5 M.W.: 233.18 |
| |
QO241003 | Oxitropium bromide EP Impurity C CAS# NA M.F.: C19H26NO4 M.W.: 332.41 |
| |
QO240504 | Oxeladin hydrogen citrate EP Impurity D CAS# 18109-81-4(citrate salt) M.F.: C18H29NO3 M.W.: 307.43 |
| |
QO240502 | Oxeladin hydrogen citrate EP Impurity B CAS# NA M.F.: C12H16O2 M.W.: 192.25 |
| |
QO242605 | Oxazepam EP Impurity E; Chlordiazepoxide EP Impurity A CAS# 963-39-3 M.F.: C15H11ClN2O2 M.W.: 286.71 |
| |
QO242603 | Oxazepam EP Impurity C CAS# 5958-05-4 M.F.: C15H9ClN2O M.W.: 268.70 |
| |
QO181606 | Orphenadrine citrate EP Impurity F CAS# 19804-27-4 M.F.: C18H23NO M.W.: 269.38 |
| |
QO181605 | Orphenadrine citrate EP Impurity E CAS# 21945-86-8 M.F.: C18H23NO M.W.: 269.38 |
| |
QO181604 | Orphenadrine citrate EP Impurity D CAS# NA M.F.: C17H21NO M.W.: 255.35 |
| |
QA130308 | Aminocaproic acid Impurity H CAS# 4775-98-8 M.F.: C6H11NO M.W.: 113.16 |
| |
QO181603 | Orphenadrine citrate EP Impurity C CAS# 17349-96-1;17752-32-8(HCl salt) M.F.: C16H19NO M.W.: 241.33 |
| |
QA130307 | Aminocaproic acid Impurity G CAS# 22993-71-1 M.F.: C12H20N2O M.W.: 208.30 |
| |
QO181602 | Orphenadrine citrate EP Impurity B CAS# NA M.F.: C14H12O M.W.: 196.24 |
| |
QA130306 | Aminocaproic acid Impurity F CAS# NA M.F.: C12H25NO7 M.W.: 295.33 |
| |
QO181601 | Orphenadrine citrate EP Impurity A CAS# NA M.F.: C14H14O M.W.: 198.26 |
| |
QA130305 | Aminocaproic acid Impurity E CAS# NA M.F.: C12H19NO8 HCl M.W.: 305.28 36.46 |
| |
QA130304 | Aminocaproic acid Impurity D CAS# 1675217-42-1 M.F.: C12H19NO8 M.W.: 305.28 |
| |
QA130303 | Aminocaproic acid Impurity C CAS# 5776-78-3 M.F.: C18H35N3O4 M.W.: 357.49 |
| |
QP160619 | Propofol Impurity 19 CAS# 859034-02-9 M.F.: C10H12O3 M.W.: 180.20 |
| |
QO180302 | Orciprenaline sulfate EP Impurity B CAS# NA M.F.: C11H15NO3 M.W.: 209.24 |
| |
QO180301 | Orciprenaline sulfate EP Impurity A CAS# NA M.F.: C12H17NO3 M.W.: 223.27 |
| |
QO180300 | Orciprenaline sulfate CAS# 5874-97-5 M.F.: C11H17NO3.1/2H2SO4 M.W.: 211.26 49.04 |
| |
QO180207 | Orbifloxacin EP Impurity G CAS# NA M.F.: C18H20F3N3O M.W.: 351.37 |
| |
QO180206 | Orbifloxacin EP Impurity F CAS# NA M.F.: C13H7F4NO3 M.W.: 301.19 |
| |
QO180204 | Orbifloxacin EP Impurity D CAS# NA M.F.: C19H21F2N3O4 M.W.: 393.38 |
| |
QO180201 | Orbifloxacin EP Impurity A CAS# NA M.F.: C25H33F2N5O3 M.W.: 489.56 |
| |
QN182007 | Nortriptyline hydrochloride EP Impurity G CAS# 16234-88-1 M.F.: C22H25NO2 M.W.: 335.44 |
| |
QT180209 | Tri-n-butyl Phosphate EP Impurity I CAS# NA M.F.: C20H45O5P M.W.: 396.54 |
| |
QT180208 | Tri-n-butyl Phosphate EP Impurity H CAS# NA M.F.: C13H29O4P M.W.: 280.34 |
| |
QT180207 | Tri-n-butyl Phosphate EP Impurity G CAS# NA M.F.: C12H27O4P M.W.: 266.31 |
| |
QT180206 | Tri-n-butyl Phosphate EP Impurity F CAS# NA M.F.: C11H25O4P M.W.: 252.29 |
| |
QT180205 | Tri-n-butyl Phosphate EP Impurity E CAS# NA M.F.: C10H23O4P M.W.: 238.26 |
| |
QT180204 | Tri-n-butyl Phosphate EP Impurity D CAS# 7242-59-3 M.F.: C9H21O4P M.W.: 224.23 |
| |
QT180202 | Tri-n-butyl Phosphate EP Impurity B CAS# 85391-11-3 M.F.: C4H11O4P M.W.: 154.10 |
| |
QT180201 | Tri-n-butyl Phosphate EP Impurity A CAS# NA M.F.: C8H19O4P M.W.: 210.21 |
| |
QT180200 | Tri-n-butyl Phosphate CAS# 126-73-8 M.F.: C12H27O4P M.W.: 266.31 |
| |
QS040659 | Sildenafil Impurity 59 CAS# NA M.F.: C24H26N4O5 M.W.: 450.49 |
| |
QA190400 | Ascaridole CAS# 512-85-6 M.F.: C10H16O2 M.W.: 168.23 |
| |
QE200239 | Eltrombopag Impurity 13 CAS# 18048-64-1 M.F.: C12H14N2O M.W.: 202.25 |
| |
QA1624132 | Apixaban Impurity 132 CAS# NA M.F.: C10H16Cl2O3 M.W.: 255.14 |
| |
QR1922100 | Rosuvastatin Impurity 100 CAS# 1007871-86-4(Na salt) M.F.: C22H28FN3O6S M.W.: 481.54 |
| |
QP132070 | Pemetrexed Impurity 44 CAS# NA M.F.: C17H23N5O3 M.W.: 345.40 |
| |
QM201814 | Metaraminol Impurity 14 CAS# 7619-17-2 M.F.: C9H13NO2 M.W.: 167.21 |
| |
QG121802 | 18α-Glycyrrhizic Acid Ammonium Salt CAS# 80287-34-9;83896-44-0(free base) M.F.: C42H62O16 NH3 M.W.: 822.93 17.03 |
| |
QL142664 | Linezolid Impurity 64 CAS# NA M.F.: C22H25FN4O4 M.W.: 428.46 |
| |
QL142662 | Linezolid Impurity 62 CAS# NA M.F.: C22H25FN4O4 M.W.: 428.46 |
| |
QT182104 | Triflusal EP Impurity D CAS# NA M.F.: C18H10F6O6 M.W.: 436.26 |
| |
QT182103 | Triflusal EP Impurity C CAS# NA M.F.: C12H9F3O5 M.W.: 290.19 |
| |
QT182102 | Triflusal EP Impurity B CAS# 328-90-5 M.F.: C8H5F3O3 M.W.: 206.12 |
| |
QT182101 | Triflusal EP Impurity A CAS# NA M.F.: C10H8O6 M.W.: 224.17 |
| |
QN032012 | Nicotinic acid Impurity 12 CAS# 536-78-7 M.F.: C7H9N M.W.: 107.15 |
| |
QC042012 | Cefditoren pivoxil Impurity 12 CAS# NA M.F.: C27H32N6O8S3 M.W.: 664.77 |
| |
QC042009 | Cefditoren pivoxil Impurity 9 CAS# NA M.F.: C19H17N6NaO5S3 M.W.: 528.56 |
| |
QC042008 | Cefditoren pivoxil Impurity 8 CAS# NA M.F.: C19H17N6NaO5S3 M.W.: 528.56 |
| |
QC042007 | Cefditoren pivoxil Impurity 7 CAS# NA M.F.: C13H13N3O3S2 M.W.: 323.39 |
| |
QC042006 | Cefditoren pivoxil Impurity 6 CAS# NA M.F.: C13H13N3O3S2 M.W.: 323.39 |
| |
QA201615 | Atropine Impurity 15 CAS# 102312-28-7 M.F.: C9H18N2 M.W.: 154.25 |
| |
QR161416 | Ropinirole Impurity 16 CAS# 1027600-42-5 M.F.: C17H26N2O2 M.W.: 290.40 |
| |
QV041412 | Vardenafil Impurity 12 CAS# 1009013-42-6 M.F.: C19H25N5O4S M.W.: 419.50 |
| |
QT142411 | Tranexamic Acid Impurity 11 CAS# 4331-54-8 M.F.: C8H14O2 M.W.: 142.20 |
| |
QS180102 | Strontium ranelate Impurity 2 CAS# NA M.F.: C10H10N2O4S M.W.: 254.26 |
| |
QS180101 | Strontium ranelate Impurity 1 CAS# NA M.F.: C11H10N2O6S M.W.: 298.27 |
| |
QD032048 | Docetaxel Impurity 48 CAS# 172018-16-5 M.F.: C29H36O10 M.W.: 544.59 |
| |
QV192085 | Valsartan Impurity 85 CAS# NA M.F.: C18H21NO2 M.W.: 283.36 |
| |
QS200767 | Sitagliptin Impurity 67 CAS# 60470-15-7 M.F.: C12H16O3 M.W.: 208.25 |
| |
QV140200 | Vinblastine Sulfate CAS# 143-67-9 M.F.: C46H60N4O13S M.W.: 909.05 |
| |
QA201611 | Atropine Impurity 11 CAS# NA M.F.: C8H15NO2 M.W.: 157.21 |
| |
QT192053 | Telmisartan Impurity 27 CAS# 39627-24-2 M.F.: C14H13NO M.W.: 211.26 |
| |
QT0307165 | Ticagrelor Impurity 165 CAS# NA M.F.: C9H9F2N M.W.: 169.17 |
| |
QP1824105 | Parecoxib Sodium Impurity 79 CAS# NA M.F.: C19H18N2O4S M.W.: 370.42 |
| |
QL091655 | Lipoic Acid Impurity 29 CAS# 1700-12-5 M.F.: C10H18O6 M.W.: 234.25 |
| |
QL091654 | Lipoic Acid Impurity 28 CAS# 91009-30-2 M.F.: C10H20O2S2 M.W.: 236.39 |
| |
QL091653 | Lipoic Acid Impurity 27 CAS# 90435-60-2 M.F.: C8H15ClO3 M.W.: 194.66 |
| |
QL091652 | Lipoic Acid Impurity 26 CAS# 74903-53-0 M.F.: C8H16O4 M.W.: 176.21 |
| |
QL091651 | (S)-Lipoic acid CAS# 1077-27-6 M.F.: C8H14O2S2 M.W.: 206.33 |
| |
QL091650 | Lipoic Acid Impurity 24 CAS# 50628-92-7 M.F.: C10H16O3 M.W.: 184.23 |
| |
QT090308 | Thioctic Acid Impurity 8 CAS# 1070-65-1 M.F.: C10H19ClO3 M.W.: 222.71 |
| |
QT090307 | Thioctic Acid Impurity 7 CAS# 50628-91-6 M.F.: C10H17ClO3 M.W.: 220.69 |
| |
QL151407 | Lornoxicam Impurity 7 CAS# 70415-50-8 M.F.: C9H8ClNO5S2 M.W.: 309.75 |
| |
QA121900 | Allisartan Isoproxil CAS# 947331-05-7 M.F.: C27H29ClN6O5 M.W.: 553.01 |
| |
QA121905 | Allisartan Isoproxil Impurity 5 CAS# NA M.F.: C28H27ClN6O8 M.W.: 611.00 |
| |
QA121904 | Allisartan Isoproxil Impurity 4 CAS# NA M.F.: C23H21ClN6O5 M.W.: 496.90 |
| |
QA121903 | Allisartan Isoproxil Impurity 3 CAS# NA M.F.: C25H25ClN6O5 M.W.: 524.96 |
| |
QA152408 | Amphotericin B-13C6 CAS# 1397-89-3 (non-labelled) M.F.: C4113C6H73NO17 M.W.: 930.03 |
| |
QA152407 | Amphotericin B-13C6 Methyl Ester CAS# 36148-89-7 (non-labelled) M.F.: C4213C6H75NO17 M.W.: 944.06 |
| |
QA152406 | Amphotericin B Methyl Ester CAS# 36148-89-7 M.F.: C48H75NO17 M.W.: 938.11 |
| |
QA152405 | Amphotericin B Impurity E CAS# NA M.F.: C48H73NO18 M.W.: 952.09 |
| |
QA152403 | Amphotericin B EP Impurity C; Amphotericin X2 (13-O-Ethyl Amphotericin B) CAS# NA M.F.: C49H77NO17 M.W.: 952.13 |
| |
QA152402 | Amphotericin B EP Impurity B; Amphotericin X1 (13-O-Methyl Amphotericin B) CAS# 136135-57-4 M.F.: C48H75NO17 M.W.: 938.11 |
| |
QA152401 | Amphotericin B EP Impurity A;Amphotericin A CAS# 1405-32-9 M.F.: C47H75NO17 M.W.: 926.09 |
| |
QC160324 | Capecitabine Impurity 24 CAS# NA M.F.: C13H15FN2O7 M.W.: 330.27 |
| |
QS010601 | Safflor Yellow A CAS# 85532-77-0 M.F.: C27H30O15 M.W.: 594.52 |
| |
QA030318 | Acetylcysteine Impurity 18 CAS# 20960-91-2 M.F.: C5H9NO6S M.W.: 211.19 |
| |
QT022009 | Terbutaline Impurity 9 CAS# NA M.F.: C12H17NO4 M.W.: 239.27 |
| |
QC051503 | Cefonicid Sodium Impurity 3 CAS# NA M.F.: C2H4N4O3S2 M.W.: 196.21 |
| |
QC182700 | Sodium Cromoglicate CAS# 15826-37-6;16110-51-3(free base) M.F.: C23H14Na2O11 M.W.: 512.33 |
| |
QP080300 | Phytolaccagenic acid CAS# 54928-05-1 M.F.: C31H48O6 M.W.: 516.71 |
| |
QN151945 | Norflurane EP Impurity SS CAS# 75-10-5 M.F.: CH2F2 M.W.: 52.02 |
| |
QN151943 | Norflurane EP Impurity QQ CAS# 75-46-7 M.F.: CHF3 M.W.: 70.01 |
| |
QN151942 | Norflurane EP Impurity PP CAS# 353-36-6 M.F.: C2H5F M.W.: 48.06 |
| |
QN151939 | Norflurane EP Impurity MM CAS# 354-33-6 M.F.: C2HF5 M.W.: 120.02 |
| |
QN151938 | Norflurane EP Impurity LL CAS# 1645-83-6 M.F.: C3H2F4 M.W.: 114.04 |
| |
QN151936 | Norflurane EP Impurity JJ CAS# 75-38-7 M.F.: C2H2F2 M.W.: 64.03 |
| |
QN151935 | Norflurane EP Impurity II CAS# 359-11-5 M.F.: C2HF3 M.W.: 82.02 |
| |
QN151933 | Norflurane EP Impurity GG CAS# 75-45-6 M.F.: CHClF2 M.W.: 86.47 |
| |
QN151930 | Norflurane EP Impurity DD CAS# 354-25-6 M.F.: C2HClF4 M.W.: 136.48 |
| |
QN151929 | Norflurane EP Impurity CC CAS# 354-23-4 M.F.: C2HCl2F3 M.W.: 152.93 |
| |
QN151927 | Norflurane EP Impurity AA CAS# 2268-32-8 M.F.: C2H2ClF M.W.: 80.49 |
| |
QN151926 | Norflurane EP Impurity Z CAS# 2268-31-7 M.F.: C2H2ClF M.W.: 80.49 |
| |
QN151925 | Norflurane EP Impurity Y CAS# 359-04-6 M.F.: C2HClF2 M.W.: 98.48 |
| |
QN151924 | Norflurane EP Impurity X CAS# NA M.F.: C2HCl2F M.W.: 114.93 |
| |
QN151920 | Norflurane EP Impurity T CAS# 1516-64-9 M.F.: C4F8 M.W.: 200.03 |
| |
QN151919 | Norflurane EP Impurity S CAS# 1516-65-0 M.F.: C4F8 M.W.: 200.03 |
| |
QN151918 | Norflurane EP Impurity R CAS# 354-55-2 M.F.: C2BrF5 M.W.: 198.92 |
| |
QN151917 | Norflurane EP Impurity Q CAS# 76-18-6 M.F.: C3ClF7 M.W.: 204.47 |
| |
QN151916 | Norflurane EP Impurity P CAS# 75-72-9 M.F.: CClF3 M.W.: 104.46 |
| |
QN151915 | Norflurane EP Impurity O CAS# 353-59-3 M.F.: CBrClF2 M.W.: 165.36 |
| |
QN151914 | Norflurane EP Impurity N CAS# 76-15-3 M.F.: C2ClF5 M.W.: 154.47 |
| |
QN151913 | Norflurane EP Impurity M CAS# 374-07-2 M.F.: C2Cl2F4 M.W.: 170.92 |
| |
QN151909 | Norflurane EP Impurity I CAS# 677-21-4 M.F.: C3H3F3 M.W.: 96.05 |
| |
QS091303 | Simethicone Impurity 3 CAS# 556-67-2 M.F.: C8H24O4Si4 M.W.: 296.62 |
| |
QN151907 | Norflurane EP Impurity G CAS# 359-10-4 M.F.: C2HClF2 M.W.: 98.48 |
| |
QN151906 | Norflurane EP Impurity F CAS# 79-35-6 M.F.: C2Cl2F2 M.W.: 132.92 |
| |
QN151905 | Norflurane EP Impurity E CAS# 75-37-6 M.F.: C2H4F2 M.W.: 66.05 |
| |
QN151904 | Norflurane EP Impurity D CAS# 420-46-2 M.F.: C2H3F3 M.W.: 84.04 |
| |
QN151903 | Norflurane EP Impurity C CAS# 359-35-3 M.F.: C2H2F4 M.W.: 102.03 |
| |
QN151902 | Norflurane EP Impurity B CAS# 2837-89-0 M.F.: C2HClF4 M.W.: 136.48 |
| |
QN151900 | Controlled Substance (Norflurane) CAS# 811-97-2 M.F.: C2H2F4 M.W.: 102.03 |
| |
QN151301 | Nomegestrol acetate EP Impurity A CAS# NA M.F.: C23H32O4 M.W.: 372.50 |
| |
QN151300 | Nomegestrol acetate CAS# 58652-20-3 M.F.: C23H30O4 M.W.: 370.48 |
| |
QN092204 | Nitrazepam EP Impurity D CAS# NA M.F.: C23H15N3O6 M.W.: 429.38 |
| |
QN092203 | Nitrazepam EP Impurity C CAS# NA M.F.: C15H11BrN2O4 M.W.: 363.16 |
| |
QN092202 | Nitrazepam EP Impurity B CAS# 1775-95-7 M.F.: C13H10N2O3 M.W.: 242.23 |
| |
QN092201 | Nitrazepam EP Impurity A CAS# 36020-93-6 M.F.: C15H11N3O3 M.W.: 281.27 |
| |
QN091400 | Nimodipine CAS# 66085-59-4 M.F.: C21H26N2O7 M.W.: 418.44 |
| |
QN091304 | Nilutamide EP Impurity D CAS# NA M.F.: C15H8F6N4O5 M.W.: 438.24 |
| |
QN091301 | Nilutamide EP Impurity A CAS# NA M.F.: C12H11F3N4O3 M.W.: 316.24 |
| |
QN091300 | Nilutamide CAS# 63612-50-0 M.F.: C12H10F3N3O4 M.W.: 317.22 |
| |
QN092104 | Nifuroxazide EP Impurity D CAS# NA M.F.: C10H6N4O6 M.W.: 278.18 |
| |
QI091627 | Ipratropium Bromide Impurity 27 CAS# 3423-25-4 M.F.: C10H19NO M.W.: 169.26 |
| |
QN092101 | Nifuroxazide EP Impurity A CAS# NA M.F.: C7H8N2O2 M.W.: 152.15 |
| |
QN051607 | Neohesperidin-dihydrochalcone EP Impurity G CAS# NA M.F.: C16H16O6 M.W.: 304.29 |
| |
QN090706 | Niflumic acid EP Impurity F CAS# NA M.F.: C14H11F3N2O2 M.W.: 296.24 |
| |
QN090705 | Niflumic acid EP Impurity E CAS# NA M.F.: C13H9F3N2O2 M.W.: 282.22 |
| |
QN090702 | Niflumic acid EP Impurity B CAS# NA M.F.: C13H9F3N2O2 M.W.: 282.22 |
| |
QN090700 | Niflumic acid CAS# 4394-00-7 M.F.: C13H9F3N2O2 M.W.: 282.22 |
| |
QN051606 | Neohesperidin-dihydrochalcone EP Impurity F CAS# NA M.F.: C22H26O11 M.W.: 466.44 |
| |
QN051605 | Neohesperidin-dihydrochalcone EP Impurity E CAS# NA M.F.: C28H36O15 M.W.: 612.58 |
| |
QN011512 | Nandrolone decanoate EP Impurity L CAS# NA M.F.: C27H42O3 M.W.: 414.62 |
| |
QN011511 | Nandrolone decanoate EP Impurity K CAS# NA M.F.: C26H40O3 M.W.: 400.59 |
| |
QN011510 | Nandrolone decanoate EP Impurity J CAS# NA M.F.: C38H64O4 M.W.: 584.91 |
| |
QN011509 | Nandrolone decanoate EP Impurity I CAS# NA M.F.: C30H48O3 M.W.: 456.70 |
| |
QN011508 | Nandrolone decanoate EP Impurity H CAS# NA M.F.: C29H46O3 M.W.: 442.67 |
| |
QN011507 | Nandrolone decanoate EP Impurity G CAS# NA M.F.: C28H42O3 M.W.: 426.63 |
| |
QN011506 | Nandrolone decanoate EP Impurity F CAS# NA M.F.: C28H42O4 M.W.: 442.63 |
| |
QN011505 | Nandrolone decanoate EP Impurity E CAS# NA M.F.: C28H44O4 M.W.: 444.65 |
| |
QN011504 | Nandrolone decanoate EP Impurity D CAS# 434-22-0 M.F.: C18H26O2 M.W.: 274.40 |
| |
QN011503 | Nandrolone decanoate EP Impurity C CAS# NA M.F.: C30H52O4 M.W.: 476.73 |
| |
QN011502 | Nandrolone decanoate EP Impurity B CAS# NA M.F.: C29H44O3 M.W.: 440.66 |
| |
QN011501 | Nandrolone decanoate EP Impurity A CAS# NA M.F.: C28H46O3 M.W.: 430.66 |
| |
QB201454 | Bortezomib Impurity 54 CAS# 514820-48-5 M.F.: C21H44BNO2Si2 M.W.: 409.56 |
| |
QO192055 | Oseltamivir EP Impurity E CAS# 208720-71-2;208720-78-9(HCl salt) M.F.: C15H26N2O4 M.W.: 298.38 |
| |
QN011500 | Nandrolone decanoate CAS# 360-70-3 M.F.: C28H44O3 M.W.: 428.65 |
| |
QP1824103 | Parecoxib Sodium Impurity 77 CAS# NA M.F.: C16H13NO7S2 M.W.: 395.41 |
| |
QP1824102 | Parecoxib Sodium Impurity 76 CAS# NA M.F.: C16H13ClN2O3S M.W.: 348.80 |
| |
QA1624126 | Apixaban Impurity 126 CAS# 942142-51-0 M.F.: C26H41ClN4O5 M.W.: 525.08 |
| |
QN011403 | Nalidixic acid EP Impurity C CAS# 87-13-8 M.F.: C10H16O5 M.W.: 216.23 |
| |
QN011402 | Nalidixic acid EP Impurity B CAS# NA M.F.: C12H12N2O3 M.W.: 232.24 |
| |
QN011401 | Nalidixic acid EP Impurity A CAS# NA M.F.: C6H8N2 M.W.: 108.14 |
| |
QN011400 | Nalidixic acid CAS# 389-08-2 M.F.: C12H12N2O3 M.W.: 232.24 |
| |
QT260423 | Trazodone hydrochloride Impurity W CAS# 55290-67-0 M.F.: C19H24ClN5O3 M.W.: 405.88 |
| |
QN012006 | Naftidrofuryl hydrogen oxalate EP Impurity F CAS# NA M.F.: C24H33NO3 M.W.: 383.52 |
| |
QN012005 | Naftidrofuryl hydrogen oxalate EP Impurity E CAS# NA M.F.: C24H29NO3 M.W.: 379.49 |
| |
QN012004 | Naftidrofuryl hydrogen oxalate EP Impurity D CAS# NA M.F.: C13H25NO3 M.W.: 243.34 |
| |
QN012003 | Naftidrofuryl hydrogen oxalate EP Impurity C CAS# NA M.F.: C30H33NO2 M.W.: 439.59 |
| |
QN012002 | Naftidrofuryl hydrogen oxalate EP Impurity B CAS# NA M.F.: C20H24O3 M.W.: 312.40 |
| |
QN012001 | Naftidrofuryl hydrogen oxalate EP Impurity A CAS# NA M.F.: C18H20O3 M.W.: 284.35 |
| |
QN012000 | Naftidrofuryl hydrogen oxalate CAS# 3200-06-4 M.F.: C26H35NO7 M.W.: 473.56 |
| |
QN010407 | Nadolol EP Impurity G CAS# NA M.F.: C17H27NO2 M.W.: 277.40 |
| |
QN010406 | Nadolol EP Impurity F CAS# NA M.F.: C17H23NO2 M.W.: 273.37 |
| |
QN010405 | Nadolol EP Impurity E CAS# NA M.F.: C17H26INO4 M.W.: 435.30 |
| |
QN010404 | Nadolol EP Impurity D CAS# NA M.F.: C30H43NO8 M.W.: 545.66 |
| |
QN010403 | Nadolol EP Impurity C CAS# NA M.F.: C23H28O7 M.W.: 416.46 |
| |
QN010402 | Nadolol EP Impurity B CAS# NA M.F.: C14H20O5 M.W.: 268.31 |
| |
QN010401 | Nadolol EP Impurity A CAS# NA M.F.: C13H18O5 M.W.: 254.28 |
| |
QN010205 | Nabumetone EP Impurity E CAS# NA M.F.: C27H26O3 M.W.: 398.49 |
| |
QN010204 | Nabumetone EP Impurity D CAS# 127053-22-9 M.F.: C15H14O2 M.W.: 226.27 |
| |
QN010203 | Nabumetone EP Impurity C CAS# NA M.F.: C15H18O2 M.W.: 230.30 |
| |
QN010202 | Nabumetone EP Impurity B CAS# NA M.F.: C18H18O2 M.W.: 266.33 |
| |
QM251502 | myo-Inositol EP Impurity B CAS# NA M.F.: C3H8O3 M.W.: 92.09 |
| |
QB052804 | Benzocaine EP Impurity D CAS# 87-25-2 M.F.: C9H11NO2 M.W.: 165.19 |
| |
QT012700 | Taurohyodeoxycholic acid CAS# 2958-04-5;38411-85-7(Na salt) M.F.: C26H45NO6S M.W.: 499.70 |
| |
QH252400 | Hyodeoxycholic acid CAS# 83-49-8 M.F.: C24H40O4 M.W.: 392.57 |
| |
QM152503 | Moxonidine EP Impurity C CAS# NA M.F.: C9H13N5O2 M.W.: 223.23 |
| |
QM152501 | Moxonidine EP Impurity A CAS# NA M.F.: C8H9Cl2N5 M.W.: 246.10 |
| |
QM180105 | Morantel hydrogen tartrate EP Impurity E CAS# NA M.F.: C6H6OS M.W.: 126.18 |
| |
QM180104 | Morantel hydrogen tartrate EP Impurity D CAS# NA M.F.: C12H18N2OS M.W.: 238.35 |
| |
QM180103 | Morantel hydrogen tartrate EP Impurity C; Pyrantel embonate EP Impurity D CAS# 4271-96-9 M.F.: C6H12N2 M.W.: 112.17 |
| |
QM180102 | Morantel hydrogen tartrate EP Impurity B CAS# NA M.F.: C12H16N2S M.W.: 220.33 |
| |
QM180101 | Morantel hydrogen tartrate EP Impurity A CAS# NA M.F.: C12H16N2S M.W.: 220.33 |
| |
QM180100 | Morantel hydrogen tartrate CAS# 26155-31-7 M.F.: C16H22N2O6S M.W.: 370.42 |
| |
QM091406 | Mianserin hydrochloride EP Impurity F CAS# NA M.F.: C24H24N2 M.W.: 340.46 |
| |
QM091404 | Mianserin hydrochloride EP Impurity D CAS# NA M.F.: C24H26N2O M.W.: 358.48 |
| |
QM091402 | Mianserin hydrochloride EP Impurity B CAS# NA M.F.: C18H20N2O3S M.W.: 344.43 |
| |
QM091400 | Mianserin hydrochloride CAS# 21535-47-7 M.F.: C18H21ClN2 M.W.: 300.83 |
| |
QM052702 | Metixene hydrochloride EP Impurity B CAS# NA M.F.: C13H8OS M.W.: 212.27 |
| |
QM052701 | Metixene hydrochloride EP Impurity A CAS# NA M.F.: C13H10S M.W.: 198.28 |
| |
QM052700 | Metixene hydrochloride CAS# 7081-40-5 M.F.: C20H26ClNOS M.W.: 363.94 |
| |
QM052600 | Methylrosanilinium chloride CAS# 548-62-9 M.F.: C25H30ClN3 M.W.: 407.98 |
| |
QM052306 | Methylphenidate hydrochloride EP Impurity F CAS# 7251-52-7 M.F.: C13H12N2O M.W.: 212.25 |
| |
QM052305 | Methylphenidate hydrochloride EP Impurity E CAS# NA M.F.: C15H21NO2 M.W.: 247.33 |
| |
QM052304 | Methylphenidate hydrochloride EP Impurity D CAS# NA M.F.: C13H18N2O M.W.: 218.29 |
| |
QM052303 | Methylphenidate hydrochloride EP Impurity C CAS# NA M.F.: C13H18N2O M.W.: 218.29 |
| |
QM052302 | Methylphenidate hydrochloride EP Impurity B CAS# NA M.F.: C14H19NO2 M.W.: 233.31 |
| |
QM052301 | Methylphenidate hydrochloride EP Impurity A CAS# NA M.F.: C13H17NO2 M.W.: 219.28 |
| |
QM052300 | Controlled Substance (Methylphenidate hydrochloride) CAS# 298-59-9 M.F.: C14H20ClNO2 M.W.: 269.77 |
| |
QS060281 | Sofosbuvir Impurity 81 CAS# 2524-64-3 M.F.: C12H10ClO3P M.W.: 268.63 |
| |
QM052209 | Methylergometrine maleate EP Impurity I CAS# 724767-21-9 M.F.: C20H25N3O2 M.W.: 339.43 |
| |
QM052208 | Methylergometrine maleate EP Impurity H CAS# 29477-88-1 M.F.: C20H25N3O2 M.W.: 339.43 |
| |
QM052207 | Methylergometrine maleate EP Impurity G CAS# 361-37-5 M.F.: C21H27N3O2 M.W.: 353.46 |
| |
QM052206 | Methylergometrine maleate EP Impurity F CAS# 479-00-5 M.F.: C19H23N3O2 M.W.: 325.40 |
| |
QM052205 | Methylergometrine maleate EP Impurity E CAS# 2889-26-1 M.F.: C16H17N3O M.W.: 267.33 |
| |
QM052204 | Methylergometrine maleate EP Impurity D CAS# NA M.F.: C19H23N3O2 M.W.: 325.40 |
| |
QM052203 | Methylergometrine maleate EP Impurity C CAS# 478-94-4 M.F.: C16H17N3O M.W.: 267.33 |
| |
QM052202 | Methylergometrine maleate EP Impurity B CAS# 478-95-5 M.F.: C16H16N2O2 M.W.: 268.31 |
| |
QM052201 | Methylergometrine maleate EP Impurity A CAS# NA M.F.: C16H16N2O2 M.W.: 268.31 |
| |
QM052200 | Methylergometrine maleate CAS# 57432-61-8;113-42-8(free base) M.F.: C24H29N3O6 M.W.: 455.50 |
| |
QM052104 | Methyldopa EP Impurity D CAS# NA M.F.: C10H13NO4 M.W.: 211.21 |
| |
QM052103 | Methyldopa EP Impurity C CAS# NA M.F.: C12H17NO4 M.W.: 239.27 |
| |
QM052101 | Methyldopa EP Impurity A CAS# 6739-31-7 M.F.: C11H15NO4 M.W.: 225.24 |
| |
QM200213 | Metacresol EP Impurity M CAS# 697-82-5 M.F.: C9H12O M.W.: 136.19 |
| |
QM200212 | Metacresol EP Impurity L CAS# 95-65-8 M.F.: C8H10O M.W.: 122.16 |
| |
QM200211 | Metacresol EP Impurity K CAS# 123-07-9 M.F.: C8H10O M.W.: 122.16 |
| |
QM200210 | Metacresol EP Impurity J CAS# 108-68-9 M.F.: C8H10O M.W.: 122.16 |
| |
QM200209 | Metacresol EP Impurity I CAS# 526-75-0 M.F.: C8H10O M.W.: 122.16 |
| |
QM200208 | Metacresol EP Impurity H CAS# NA M.F.: C9H12O M.W.: 136.19 |
| |
QM200206 | Metacresol EP Impurity F CAS# NA M.F.: C8H10O M.W.: 122.16 |
| |
QM200205 | Metacresol EP Impurity E CAS# 90-00-6 M.F.: C8H10O M.W.: 122.16 |
| |
QM192002 | Mesterolone EP Impurity B CAS# NA M.F.: C20H34O2 M.W.: 306.48 |
| |
QM051905 | Mesna EP Impurity E CAS# 1391054-56-0 M.F.: C5H9N5O3S2 M.W.: 251.29 |
| |
QM051904 | Mesna EP Impurity D CAS# 45127-11-5;16208-51-8(2Na salt) M.F.: C4H10O6S4 M.W.: 282.38 |
| |
QM051903 | Mesna EP Impurity C CAS# 69536-71-6 M.F.: C4H8O4S2 M.W.: 184.23 |
| |
QM051902 | Mesna EP Impurity B CAS# 1391053-66-9 M.F.: C4H10N4O3S2 M.W.: 226.28 |
| |
QM051901 | Mesna EP Impurity A CAS# 25985-57-3 M.F.: C3H8N2O3S2 M.W.: 184.24 |
| |
QM051801 | Mercaptopurine EP Impurity A; Hypoxanthine CAS# 68-94-0 M.F.: C5H4N4O M.W.: 136.11 |
| |
QM162503 | Mepyramine maleate EP Impurity C; Tenoxicam EP Impurity A CAS# 504-29-0 M.F.: C5H6N2 M.W.: 94.11 |
| |
QM162501 | Mepyramine maleate EP Impurity A CAS# NA M.F.: C13H14N2O M.W.: 214.26 |
| |
QM162500 | Mepyramine maleate CAS# 59-33-6 M.F.: C21H27N3O5 M.W.: 401.46 |
| |
QM011806 | Marbofloxacin EP Impurity F CAS# NA M.F.: C17H19FN4O5 M.W.: 378.35 |
| |
QM011804 | Marbofloxacin EP Impurity D CAS# NA M.F.: C16H19FN4O4 M.W.: 350.34 |
| |
QM011803 | Marbofloxacin EP Impurity C CAS# NA M.F.: C16H18F2N4O3 M.W.: 352.34 |
| |
QM011802 | Marbofloxacin EP Impurity B CAS# NA M.F.: C12H8F2N2O4 M.W.: 282.20 |
| |
QM011801 | Marbofloxacin EP Impurity A CAS# NA M.F.: C11H8F2N2O4 M.W.: 270.19 |
| |
QM011605 | Maprotiline hydrochloride EP Impurity E CAS# NA M.F.: C21H25N M.W.: 291.43 |
| |
QM011604 | Maprotiline hydrochloride EP Impurity D CAS# NA M.F.: C20H21N M.W.: 275.39 |
| |
QM011603 | Maprotiline hydrochloride EP Impurity C CAS# NA M.F.: C19H21N M.W.: 263.38 |
| |
QM011602 | Maprotiline hydrochloride EP Impurity B CAS# NA M.F.: C39H41N M.W.: 523.75 |
| |
QM011601 | Maprotiline hydrochloride EP Impurity A CAS# NA M.F.: C19H16O M.W.: 260.33 |
| |
QM011600 | Maprotiline hydrochloride CAS# 10347-81-6 M.F.: C20H24ClN M.W.: 313.86 |
| |
QM120903 | Malathion EP Impurity C CAS# NA M.F.: C9H17O6PS2 M.W.: 316.33 |
| |
QM120902 | Malathion EP Impurity B CAS# NA M.F.: C10H19O7PS M.W.: 314.29 |
| |
QM120901 | Malathion EP Impurity A CAS# NA M.F.: C10H19O6PS2 M.W.: 330.36 |
| |
QP090402 | Magnesium pidolate EP Impurity B CAS# 29227-92-7 M.F.: C10H14N2O6 M.W.: 258.23 |
| |
QP090400 | Magnesium pidolate CAS# 62003-27-4 M.F.: C10H12MgN2O6 M.W.: 280.52 |
| |
QL252004 | Lysine acetate EP Impurity D;Valine CAS# 72-18-4 M.F.: C5H11NO2 M.W.: 117.15 |
| |
QL252000 | Lysine acetate CAS# 57282-49-2;56-87-1(free base) M.F.: C8H18N2O4 M.W.: 206.24 |
| |
QL251403 | Lynestrenol EP Impurity C CAS# NA M.F.: C20H30O M.W.: 286.45 |
| |
QL251402 | Lynestrenol EP Impurity B CAS# NA M.F.: C20H28O M.W.: 284.44 |
| |
QL251401 | Lynestrenol EP Impurity A CAS# NA M.F.: C20H28O M.W.: 284.44 |
| |
QL251307 | Lymecycline EP Impurity G CAS# NA M.F.: C22H23ClN2O8 M.W.: 478.88 |
| |
QL120608 | Lufenuron EP Impurity H CAS# NA M.F.: C19H8Cl4F12N2O3 M.W.: 682.07 |
| |
QL120607 | Lufenuron EP Impurity G CAS# NA M.F.: C21H12Cl2F2N2O5 M.W.: 481.23 |
| |
QL120606 | Lufenuron EP Impurity F CAS# NA M.F.: C17H9Cl2F7N2O3 M.W.: 493.16 |
| |
QL120605 | Lufenuron EP Impurity E CAS# NA M.F.: C17H8Cl3F7N2O3 M.W.: 527.60 |
| |
QL120604 | Lufenuron EP Impurity D CAS# NA M.F.: C17H9ClF8N2O3 M.W.: 476.71 |
| |
QL120603 | Lufenuron EP Impurity C CAS# NA M.F.: C17H9ClF8N2O3 M.W.: 476.71 |
| |
QL120602 | Lufenuron EP Impurity B CAS# NA M.F.: C14H8Cl2F2N2O3 M.W.: 361.13 |
| |
QL120601 | Lufenuron EP Impurity A CAS# NA M.F.: C7H5F2NO M.W.: 157.12 |
| |
QL120600 | Lufenuron CAS# 103055-07-8 M.F.: C17H8Cl2F8N2O3 M.W.: 511.15 |
| |
QI091626 | Ipratropium Bromide Impurity 26 CAS# NA M.F.: C20H30BrNO4 M.W.: 428.36 |
| |
QI091625 | Ipratropium Bromide Impurity 25 CAS# NA M.F.: C20H30BrNO4 M.W.: 428.36 |
| |
QI091624 | Ipratropium Bromide Impurity 24 CAS# NA M.F.: C20H30BrNO4 M.W.: 428.36 |
| |
QM154250 | Mirabegron Impurity 24 CAS# NA M.F.: C9H10N2O5S M.W.: 258.25 |
| |
QL161418 | Lopinavir EP Impurity R CAS# NA M.F.: C47H58N4O7 M.W.: 790.99 |
| |
QL161416 | Lopinavir EP Impurity P CAS# NA M.F.: C37H48N4O5 M.W.: 628.80 |
| |
QL161415 | Lopinavir EP Impurity O CAS# NA M.F.: C46H62N6O7 M.W.: 811.02 |
| |
QL161414 | Lopinavir EP Impurity N CAS# NA M.F.: C38H50N4O5 M.W.: 642.83 |
| |
QL161413 | Lopinavir EP Impurity M CAS# NA M.F.: C38H50N4O5 M.W.: 642.83 |
| |
QL161412 | Lopinavir EP Impurity L CAS# NA M.F.: C22H26N2O4 M.W.: 382.45 |
| |
QL161411 | Lopinavir EP Impurity K CAS# NA M.F.: C37H48N4O5 M.W.: 628.80 |
| |
QL161410 | Lopinavir EP Impurity J CAS# NA M.F.: C37H48N4O5 M.W.: 628.80 |
| |
QL161409 | Lopinavir EP Impurity I CAS# NA M.F.: C37H48N4O5 M.W.: 628.80 |
| |
QL161408 | Lopinavir EP Impurity H CAS# NA M.F.: C29H32N2O4 M.W.: 472.58 |
| |
QL161407 | Lopinavir EP Impurity G CAS# NA M.F.: C30H36N2O4 M.W.: 488.62 |
| |
QL161405 | Lopinavir EP Impurity E CAS# NA M.F.: C28H34N2O3 M.W.: 446.58 |
| |
QL161403 | Lopinavir EP Impurity C CAS# NA M.F.: C36H52N6O5 M.W.: 648.84 |
| |
QL161402 | Lopinavir EP Impurity B CAS# NA M.F.: C28H38N4O4 M.W.: 494.63 |
| |
QL161401 | Lopinavir EP Impurity A CAS# NA M.F.: C27H38N4O3 M.W.: 466.62 |
| |
QL052706 | Levomethadone hydrochloride EP Impurity F CAS# NA M.F.: C12H15NO6S M.W.: 301.32 |
| |
QL052701 | Levomethadone hydrochloride EP Impurity A CAS# NA M.F.: C21H27NO M.W.: 309.45 |
| |
QL052700 | Levomethadone hydrochloride CAS# 5967-73-7 M.F.: C21H28ClNO M.W.: 345.91 |
| |
QL052600 | Levomepromazine hydrochloride CAS# 1236-99-3;7104-38-3(maleate) M.F.: C19H25ClN2OS M.W.: 364.93 |
| |
QL052503 | Levodropropizine EP Impurity C CAS# NA M.F.: C3H6O2 M.W.: 74.08 |
| |
QL052502 | Levodropropizine EP Impurity B CAS# 92-54-6;153121-53-0(HBr salt) M.F.: C10H14N2 M.W.: 162.23 |
| |
QL052501 | Levodropropizine EP Impurity A CAS# NA M.F.: C13H20N2O2 M.W.: 236.31 |
| |
QL052500 | Levodropropizine CAS# 99291-25-5 M.F.: C13H20N2O2 M.W.: 236.31 |
| |
QL052412 | Levocabastine hydrochloride EP Impurity L CAS# NA M.F.: C26H29FN2O3 M.W.: 436.52 |
| |
QL052411 | Levocabastine hydrochloride EP Impurity K CAS# NA M.F.: C25H24FN2 M.W.: 371.47 |
| |
QL052410 | Levocabastine hydrochloride EP Impurity J CAS# NA M.F.: C26H29FN2O3 M.W.: 436.52 |
| |
QL052409 | Levocabastine hydrochloride EP Impurity I CAS# NA M.F.: C26H29FN2O2 M.W.: 420.52 |
| |
QL052408 | Levocabastine hydrochloride EP Impurity H CAS# NA M.F.: C13H12FNO M.W.: 217.24 |
| |
QL052407 | Levocabastine hydrochloride EP Impurity G CAS# NA M.F.: C26H31FN2O3 M.W.: 438.53 |
| |
QL052406 | Levocabastine hydrochloride EP Impurity F CAS# NA M.F.: C13H17NO2 M.W.: 219.28 |
| |
QL052405 | Levocabastine hydrochloride EP Impurity E CAS# NA M.F.: C26H29FN2O2 M.W.: 420.52 |
| |
QL052404 | Levocabastine hydrochloride EP Impurity D CAS# NA M.F.: C25H27FN2O2 M.W.: 406.49 |
| |
QL052403 | Levocabastine hydrochloride EP Impurity C CAS# NA M.F.: C26H29FN2O2 M.W.: 420.52 |
| |
QL052402 | Levocabastine hydrochloride EP Impurity B CAS# NA M.F.: C26H29FN2O2 M.W.: 420.52 |
| |
QL052401 | Levocabastine hydrochloride EP Impurity A CAS# NA M.F.: C26H30N2O2 M.W.: 402.53 |
| |
QL052400 | Levocabastine hydrochloride CAS# 79547-78-7;79516-68-0(free base) M.F.: C26H30ClFN2O2 M.W.: 456.98 |
| |
QL052305 | Levamisole EP Impurity E CAS# 32190-36-6 M.F.: C22H26N4O2S2 M.W.: 442.60 |
| |
QL052304 | Levamisole EP Impurity D CAS# 4335-28-8;4335-29-9(HCl salt) M.F.: C11H10N2S M.W.: 202.28 |
| |
QL052303 | Levamisole EP Impurity C CAS# 32190-33-3 M.F.: C11H14N2OS M.W.: 222.31 |
| |
QL052301 | Levamisole EP Impurity A CAS# 32190-34-4 M.F.: C11H14N2OS M.W.: 222.31 |
| |
QL052300 | Levamisole CAS# 14769-73-4 M.F.: C11H12N2S M.W.: 204.29 |
| |
QK201505 | Ketobemidone hydrochloride EP Impurity E CAS# NA M.F.: C13H16N2O M.W.: 216.28 |
| |
QK201504 | Ketobemidone hydrochloride EP Impurity D CAS# NA M.F.: C16H23NO2 M.W.: 261.36 |
| |
QK201503 | Ketobemidone hydrochloride EP Impurity C CAS# NA M.F.: C14H19NO2 M.W.: 233.31 |
| |
QK201502 | Ketobemidone hydrochloride EP Impurity B CAS# NA M.F.: C14H19NO2 M.W.: 233.31 |
| |
QK201501 | Ketobemidone hydrochloride EP Impurity A CAS# NA M.F.: C15H21NO3 M.W.: 263.33 |
| |
QK201500 | Ketobemidone hydrochloride CAS# 5965-49-1 M.F.: C15H22ClNO2 M.W.: 283.79 |
| |
QJ151911 | Josamycin EP Impurity K CAS# NA M.F.: C40H65NO15 M.W.: 799.94 |
| |
QJ151910 | Josamycin EP Impurity J CAS# NA M.F.: C43H71NO15 M.W.: 842.02 |
| |
QJ151909 | Josamycin EP Impurity I CAS# NA M.F.: C38H63NO14 M.W.: 757.91 |
| |
QJ151908 | Josamycin EP Impurity H CAS# NA M.F.: C40H67NO14 M.W.: 785.96 |
| |
QJ151907 | Josamycin EP Impurity G CAS# NA M.F.: C37H61NO14 M.W.: 743.88 |
| |
QJ151906 | Josamycin EP Impurity F CAS# NA M.F.: C35H59NO13 M.W.: 701.84 |
| |
QJ151905 | Josamycin EP Impurity E CAS# NA M.F.: C43H71NO15 M.W.: 842.02 |
| |
QJ151904 | Josamycin EP Impurity D CAS# NA M.F.: C42H69NO15 M.W.: 827.99 |
| |
QJ151902 | Josamycin EP Impurity B CAS# NA M.F.: C42H71NO15 M.W.: 830.01 |
| |
QJ151901 | Josamycin EP Impurity A CAS# NA M.F.: C41H67NO15 M.W.: 813.97 |
| |
QI191705 | Isopropyl alcohol EP Impurity E CAS# 67-56-1 M.F.: CH4O M.W.: 32.04 |
| |
QI191704 | Isopropyl alcohol EP Impurity D CAS# NA M.F.: C4H10O M.W.: 74.12 |
| |
QA165127 | Azithromycin Impurity 27 CAS# 67342-52-3 M.F.: C10H13NO3S M.W.: 227.28 |
| |
QI191701 | Isopropyl alcohol EP Impurity A CAS# NA M.F.: C3H6O M.W.: 58.08 |
| |
QI191700 | Isopropyl alcohol CAS# 67-63-0 M.F.: C3H8O M.W.: 60.10 |
| |
QI152408 | Ioxaglic acid EP Impurity H CAS# NA M.F.: C35H28I9N7O13 M.W.: 1896.78 |
| |
QI152407 | Ioxaglic acid EP Impurity G CAS# NA M.F.: C26H23I6N5O9 M.W.: 1310.92 |
| |
QI152405 | Ioxaglic acid EP Impurity E CAS# NA M.F.: C36H31I9N8O12 M.W.: 1909.82 |
| |
QI152404 | Ioxaglic acid EP Impurity D CAS# NA M.F.: C25H23I6N5O8 M.W.: 1282.91 |
| |
QI152402 | Ioxaglic acid EP Impurity B CAS# NA M.F.: C24H22I5N5O8 M.W.: 1142.98 |
| |
QI152401 | Ioxaglic acid EP Impurity A CAS# NA M.F.: C10H9I3N2O4 M.W.: 601.90 |
| |
QI152400 | Ioxaglic acid CAS# 59017-64-0 M.F.: C24H21I6N5O8 M.W.: 1268.88 |
| |
QI152110 | Iotrolan EP Impurity J CAS# NA M.F.: C49H64I6N6O18 M.W.: 1786.49 |
| |
QI152109 | Iotrolan EP Impurity I CAS# NA M.F.: C46H60I6N6O18 M.W.: 1746.42 |
| |
QI152108 | Iotrolan EP Impurity H CAS# NA M.F.: C43H56I6N6O18 M.W.: 1706.36 |
| |
QI152107 | Iotrolan EP Impurity G CAS# NA M.F.: C21H8Cl4I6N2O6 M.W.: 1287.54 |
| |
QI152106 | Iotrolan EP Impurity F CAS# NA M.F.: C21H12I6N2O10 M.W.: 1213.75 |
| |
QI152105 | Iotrolan EP Impurity E CAS# NA M.F.: C17H24I3N3O8 M.W.: 779.10 |
| |
QI152104 | Iotrolan EP Impurity D CAS# NA M.F.: C33H39I6N5O16 M.W.: 1523.11 |
| |
QI152103 | Iotrolan EP Impurity C CAS# NA M.F.: C20H26I3N3O11 M.W.: 865.15 |
| |
QI152102 | Iotrolan EP Impurity B CAS# NA M.F.: C19H26I3N3O9 M.W.: 821.14 |
| |
QI152101 | Iotrolan EP Impurity A CAS# NA M.F.: C40H52I6N6O18 M.W.: 1666.30 |
| |
QI152100 | Iotrolan CAS# 79770-24-4 M.F.: C37H48I6N6O18 M.W.: 1626.23 |
| |
QI160100 | Iopanoic acid CAS# NA M.F.: C11H12I3NO2 M.W.: 570.93 |
| |
QI140505 | Indinavir sulfate EP Impurity E CAS# NA M.F.: C51H65N5O7 M.W.: 860.09 |
| |
QI140504 | Indinavir sulfate EP Impurity D CAS# NA M.F.: C27H36N4O3 M.W.: 464.60 |
| |
QI140503 | Indinavir sulfate EP Impurity C CAS# NA M.F.: C36H47N5O4 M.W.: 613.79 |
| |
QI140502 | Indinavir sulfate EP Impurity B CAS# NA M.F.: C30H42N4O4 M.W.: 522.68 |
| |
QI140501 | Indinavir sulfate EP Impurity A CAS# NA M.F.: C9H11NO M.W.: 149.19 |
| |
QI140500 | Indinavir sulfate CAS# 157810-81-6 M.F.: C38H55N5O9S M.W.: 757.94 |
| |
QI131003 | Imipramine hydrochloride EP Impurity C CAS# NA M.F.: C18H20N2O M.W.: 280.36 |
| |
QI131002 | Imipramine hydrochloride EP Impurity B CAS# NA M.F.: C19H22N2 M.W.: 278.39 |
| |
QI131001 | Imipramine hydrochloride EP Impurity A CAS# NA M.F.: C18H22N2 M.W.: 266.38 |
| |
QI131000 | Imipramine hydrochloride CAS# 113-52-0 M.F.: C19H25ClN2 M.W.: 316.87 |
| |
QI061506 | Ifosfamide EP Impurity F CAS# NA M.F.: C5H10Cl2NO2P M.W.: 218.02 |
| |
QI061505 | Ifosfamide EP Impurity E CAS# 42453-19-0 M.F.: C5H11Cl2N M.W.: 156.05 |
| |
QI061503 | Ifosfamide EP Impurity C; Carmustine EP Impurity B CAS# 689-98-5;870-24-6(HCl salt) M.F.: C2H6ClN M.W.: 79.53 |
| |
QI061502 | Ifosfamide EP Impurity B CAS# 241482-18-8 M.F.: C10H24Cl2N2O7P2 M.W.: 417.16 |
| |
QI061501 | Ifosfamide EP Impurity A CAS# 22608-58-8 M.F.: C5H13ClNO4P M.W.: 217.59 |
| |
QI041700 | Idoxuridine CAS# 54-42-2 M.F.: C9H11IN2O5 M.W.: 354.10 |
| |
QH250601 | Hydroxyethyl salicylate EP Impurity A CAS# NA M.F.: C7H6O3 M.W.: 138.12 |
| |
QH250600 | Hydroxyethyl salicylate CAS# 87-28-5 M.F.: C9H10O4 M.W.: 182.17 |
| |
QH250504 | Hydromorphone hydrochloride EP Impurity D CAS# NA M.F.: C17H21NO3 M.W.: 287.35 |
| |
QH250502 | Hydromorphone hydrochloride EP Impurity B CAS# NA M.F.: C17H19NO4 M.W.: 301.34 |
| |
QH250501 | Hydromorphone hydrochloride EP Impurity A CAS# NA M.F.: C34H36N2O6 M.W.: 568.66 |
| |
QH250500 | Hydromorphone hydrochloride CAS# 71-68-1 M.F.: C17H20ClNO3 M.W.: 321.80 |
| |
QH151401 | Homatropine hydrobromide EP Impurity A CAS# NA M.F.: C16H19NO3 M.W.: 273.33 |
| |
QH151400 | Homatropine hydrobromide; Homatropine methylbromide EP Impurity B CAS# 51-56-9 M.F.: C16H21NO3.HBr M.W.: 275.34 80.91 |
| |
QH091900 | Histamine dihydrochloride CAS# 56-92-8 M.F.: C5H11Cl2N3 M.W.: 184.07 |
| |
QH052604 | Hexylresorcinol EP Impurity D CAS# NA M.F.: C12H16O3 M.W.: 208.25 |
| |
QH052603 | Hexylresorcinol EP Impurity C CAS# NA M.F.: C11H16O2 M.W.: 180.24 |
| |
QH052504 | Hexetidine EP Impurity D CAS# 81-04-9 M.F.: C10H8O6S2 M.W.: 288.30 |
| |
QH052503 | Hexetidine EP Impurity C CAS# NA M.F.: C22H45N3 M.W.: 351.61 |
| |
QH052502 | Hexetidine EP Impurity B CAS# NA M.F.: C20H45N3 M.W.: 327.59 |
| |
QT150201 | Deoxystreptamine-kanosaminide CAS# 20744-51-8 M.F.: C12H25N3O7 M.W.: 323.34 |
| |
QH051601 | Heptaminol hydrochloride EP Impurity A CAS# NA M.F.: C8H17N M.W.: 127.23 |
| |
QH051600 | Heptaminol hydrochloride CAS# 543-15-7 M.F.: C8H20ClNO M.W.: 181.7 |
| |
QH011309 | Halothane EP Impurity I CAS# NA M.F.: C2BrCl2F3 M.W.: 231.83 |
| |
QH011307 | Halothane EP Impurity G CAS# NA M.F.: C2BrClF2 M.W.: 177.38 |
| |
QH011304 | Halothane EP Impurity D CAS# NA M.F.: C4HBrF6 M.W.: 242.95 |
| |
QH011303 | Halothane EP Impurity C CAS# NA M.F.: C8Cl4F12 M.W.: 465.88 |
| |
QH011302 | Halothane EP Impurity B CAS# NA M.F.: C8H2Cl2F12 M.W.: 396.99 |
| |
QH121503 | Halofantrine hydrochloride EP Impurity C CAS# NA M.F.: C16H9Cl2F3O M.W.: 345.14 |
| |
QH121502 | Halofantrine hydrochloride EP Impurity B CAS# NA M.F.: C26H31ClF3NO M.W.: 465.98 |
| |
QH121501 | Halofantrine hydrochloride EP Impurity A CAS# NA M.F.: C26H31ClF3NO M.W.: 465.98 |
| |
QH121500 | Halofantrine hydrochloride CAS# 36167-63-2 M.F.: C26H31Cl3F3NO M.W.: 536.88 |
| |
QG210300 | Guanethidine monosulfate CAS# 645-43-2 M.F.: C10H24N4O4S M.W.: 296.39 |
| |
QG210208 | Guaiacol EP Impurity H CAS# NA M.F.: C7H8O2 M.W.: 124.14 |
| |
QG210207 | Guaiacol EP Impurity G CAS# 150-76-5 M.F.: C7H8O2 M.W.: 124.14 |
| |
QG210206 | Guaiacol EP Impurity F CAS# NA M.F.: C8H10O2 M.W.: 138.16 |
| |
QG210203 | Guaiacol EP Impurity C CAS# 91-16-7 M.F.: C8H10O2 M.W.: 138.16 |
| |
QG210202 | Guaiacol EP Impurity B CAS# 108-95-2 M.F.: C6H6O M.W.: 94.11 |
| |
QG180900 | Griseofulvin CAS# 126-07-8 M.F.: C17H17ClO6 M.W.: 352.77 |
| |
QG122200 | Glutamic acid; Lysine acetate EP Impurity B; Pemetrexed Impurity M; Asparagine EP Impurity B;Magnesium pidolate EP Impurity A;Aspartic acid EP Impurity C;Alanine EP Impurity B CAS# 56-86-0 M.F.: C5H9NO4 M.W.: 147.13 |
| |
QG011206 | Galantamine hydrobromide EP Impurity F CAS# 60384-53-4 M.F.: C17H21NO3 M.W.: 287.35 |
| |
QG011205 | Galantamine hydrobromide EP Impurity E CAS# 41303-74-6 M.F.: C16H19NO3 M.W.: 273.33 |
| |
QG011204 | Galantamine hydrobromide EP Impurity D CAS# 664995-65-7 M.F.: C17H19NO2 M.W.: 269.34 |
| |
QG011203 | Galantamine hydrobromide EP Impurity C; Dihydro Galantamine CAS# 21133-52-8 M.F.: C17H23NO3 M.W.: 289.37 |
| |
QG011201 | Galantamine hydrobromide EP Impurity A CAS# 510-77-0 M.F.: C17H19NO3 M.W.: 285.34 |
| |
QG011200 | Galantamine hydrobromide CAS# 1953-04-4;357-70-0(free base) M.F.: C17H22BrNO3 M.W.: 368.27 |
| |
QF180107 | Framycetin sulfate EP Impurity G;Neomycin sulfate EP Impurity G;Neomycin B-LP CAS# 54617-40-2 M.F.: C25H48N6O14 M.W.: 656.68 |
| |
QF180106 | Framycetin sulfate EP Impurity F;Neomycin sulfate EP Impurity F CAS# 51795-47-2 M.F.: C23H45N5O14 M.W.: 615.63 |
| |
QF180105 | Framycetin sulfate EP Impurity E; Neomycin sulfate EP Impurity E CAS# 7542-37-2;1263-89-4(xH2SO4 salt) M.F.: C23H45N5O14 M.W.: 615.63 |
| |
QF180104 | Framycetin sulfate EP Impurity D;Neomycin sulfate EP Impurity D CAS# 534-47-4 M.F.: C12H25N3O7 M.W.: 323.34 |
| |
QF180103 | Framycetin sulfate EP Impurity C; Neomycin C;Neomycin sulfate EP Impurity C CAS# 66-86-4 M.F.: C23H46N6O13 M.W.: 614.64 |
| |
QF180102 | Framycetin sulfate EP Impurity B;Neomycin sulfate EP Impurity B CAS# NA M.F.: C14H28N4O7 M.W.: 364.39 |
| |
QF180101 | Framycetin sulfate EP Impurity A;Neomycin sulfate EP Impurity A CAS# 3947-65-7 M.F.: C12H26N4O6 M.W.: 322.36 |
| |
QF180100 | Framycetin sulfate CAS# NA M.F.: C23H46N6O13 M.W.: 614.64 |
| |
QF151904 | Foscarnet sodium hexahydrate EP Impurity D CAS# 1474-78-8 M.F.: C7H15O5P M.W.: 210.16 |
| |
QF151902 | Foscarnet sodium hexahydrate EP Impurity B CAS# 55920-24-6 M.F.: C3H5Na2O5P M.W.: 198.02 |
| |
QF151903 | Foscarnet sodium hexahydrate EP Impurity C CAS# 72304-94-0 M.F.: C5H10NaO5P M.W.: 204.09 |
| |
QF151901 | Foscarnet sodium hexahydrate EP Impurity A CAS# 72305-00-1 M.F.: C3H5Na2O5P M.W.: 198.02 |
| |
QF151900 | Foscarnet sodium hexahydrate CAS# 34156-56-4 M.F.: CH12Na3O11P M.W.: 300.04 |
| |
QF123303 | Fluspirilene EP Impurity C CAS# NA M.F.: C30H33F2N3O2 M.W.: 505.60 |
| |
QF123302 | Fluspirilene EP Impurity B CAS# NA M.F.: C29H31F2N3O M.W.: 475.57 |
| |
QF123203 | Flurazepam monohydrochloride EP Impurity C CAS# NA M.F.: C17H14ClFN2O2 M.W.: 332.76 |
| |
QF123202 | Flurazepam monohydrochloride EP Impurity B CAS# NA M.F.: C15H10ClFN2O M.W.: 288.70 |
| |
QF123201 | Flurazepam monohydrochloride EP Impurity A CAS# NA M.F.: C19H22ClFN2O M.W.: 348.84 |
| |
QF123200 | Flurazepam monohydrochloride CAS# 36105-20-1 M.F.: C21H24Cl2FN3O M.W.: 424.34 |
| |
QF211607 | Fluphenazine decanoate EP Impurity G; Fluphenazine enantate EP Impurity G; fluphenazine dodecanoate CAS# NA M.F.: C34H48F3N3O2S M.W.: 619.82 |
| |
QF211606 | Fluphenazine decanoate EP Impurity F; Fluphenazine enantate EP Impurity F; Fluphenazine undecanoate CAS# NA M.F.: C33H46F3N3O2S M.W.: 605.80 |
| |
QF211604 | Fluphenazine decanoate EP Impurity D; Fluphenazine enantate EP Impurity D; Fluphenazine octanoate CAS# NA M.F.: C30H40F3N3O2S M.W.: 563.72 |
| |
QF211605 | Fluphenazine decanoate EP Impurity E; Fluphenazine enantate EP Impurity E; Fluphenazine nonanoate CAS# NA M.F.: C31H42F3N3O2S M.W.: 577.74 |
| |
QF211603 | Fluphenazine decanoate EP Impurity C; Fluphenazine enantate CAS# 2746-81-8 M.F.: C29H38F3N3O2S M.W.: 549.69 |
| |
QF211602 | Fluphenazine decanoate EP Impurity B; Fluphenazine enantate EP Impurity B; Fluphenazine CAS# 146-56-5(2HCl salt) M.F.: C22H26F3N3OS M.W.: 437.52 |
| |
QF211601 | Fluphenazine decanoate EP Impurity A; Fluphenazine dihydrochloride EP Impurity A; Fluphenazine enantate EP Impurity A; Fluphenazine S-oxide CAS# 1674-76-6 M.F.: C22H26F3N3O2S M.W.: 453.52 |
| |
QF211600 | Fluphenazine decanoate; Fluphenazine enantate EP Impurity C CAS# 5002-47-1 M.F.: C32H44F3N3O2S M.W.: 591.77 |
| |
QF211504 | Fluocortolone pivalate EP Impurity D CAS# NA M.F.: C27H39FO5 M.W.: 462.59 |
| |
QF211503 | Fluocortolone pivalate EP Impurity C CAS# NA M.F.: C27H35FO5 M.W.: 458.56 |
| |
QF211502 | Fluocortolone pivalate EP Impurity B CAS# NA M.F.: C27H38O7 M.W.: 474.59 |
| |
QF211501 | Fluocortolone pivalate EP Impurity A CAS# 152-97-6 M.F.: C22H29FO4 M.W.: 376.46 |
| |
QF211500 | Fluocortolone pivalate CAS# 29205-06-9 M.F.: C27H37FO5 M.W.: 460.58 |
| |
QF211404 | Flunixin meglumine EP Impurity D CAS# NA M.F.: C16H15F3N2O2 M.W.: 324.30 |
| |
QF211403 | Flunixin meglumine EP Impurity C CAS# NA M.F.: C8H8ClNO2 M.W.: 185.61 |
| |
QF211402 | Flunixin meglumine EP Impurity B CAS# NA M.F.: C8H8F3N M.W.: 175.15 |
| |
QF211400 | Flunixin meglumine CAS# 42461-84-7 M.F.: C21H28F3N3O7 M.W.: 491.46 |
| |
QM092207 | Mivacurium chloride Impurity 7 CAS# NA M.F.: C58H80Cl2N2O14 M.W.: 1100.17 |
| |
QM092206 | Mivacurium chloride Impurity 6 CAS# NA M.F.: C58H80Cl2N2O14 M.W.: 1100.17 |
| |
QM092205 | Mivacurium chloride Impurity 5 CAS# NA M.F.: C58H80Cl2N2O14 M.W.: 1100.17 |
| |
QM092204 | Mivacurium chloride Impurity 4 CAS# NA M.F.: C25H36ClNO6 M.W.: 482.01 |
| |
QM092203 | Mivacurium chloride Impurity 3 CAS# 107740-64-7 M.F.: C25H36ClNO6 M.W.: 482.01 |
| |
QM092202 | Mivacurium chloride Impurity 2 CAS# NA M.F.: C33H46ClNO9 M.W.: 636.17 |
| |
QM092201 | Mivacurium chloride Impurity 1 CAS# NA M.F.: C33H46ClNO9 M.W.: 636.17 |
| |
QF122304 | Flunitrazepam EP Impurity D CAS# NA M.F.: C14H11FN2O3 M.W.: 274.25 |
| |
QF122303 | Flunitrazepam EP Impurity C CAS# NA M.F.: C16H12FN3O3 M.W.: 313.28 |
| |
QF122302 | Flunitrazepam EP Impurity B CAS# NA M.F.: C15H10FN3O3 M.W.: 299.26 |
| |
QF121704 | Flumetasone pivalate EP Impurity D CAS# NA M.F.: C27H36ClFO6 M.W.: 511.02 |
| |
QF121703 | Flumetasone pivalate EP Impurity C CAS# 1926-94-9 M.F.: C27H37FO6 M.W.: 476.58 |
| |
QF121702 | Flumetasone pivalate EP Impurity B CAS# NA M.F.: C24H30F2O6 M.W.: 452.49 |
| |
QF121701 | Flumetasone pivalate EP Impurity A CAS# 2135-17-3 M.F.: C22H28F2O5 M.W.: 410.45 |
| |
QF121700 | Flumetasone pivalate CAS# 2002-29-1 M.F.: C27H36F2O6 M.W.: 494.57 |
| |
QF120805 | Flecainide acetate EP Impurity E CAS# NA M.F.: C17H14F6N2O3 M.W.: 408.30 |
| |
QF120804 | Flecainide acetate EP Impurity D CAS# NA M.F.: C11H8F6O4 M.W.: 318.17 |
| |
QF120803 | Flecainide acetate EP Impurity C CAS# NA M.F.: C17H20F6N2O4 M.W.: 430.34 |
| |
QF120802 | Flecainide acetate EP Impurity B CAS# NA M.F.: C6H14N2 M.W.: 114.19 |
| |
QF120801 | Flecainide acetate EP Impurity A CAS# NA M.F.: C17H18F6N2O2 M.W.: 396.33 |
| |
QF120800 | Flecainide acetate CAS# 54143-56-5 M.F.: C19H24F6N2O5 M.W.: 474.39 |
| |
QF120703 | Flavoxate hydrochloride EP Impurity C CAS# NA M.F.: C20H18O4 M.W.: 322.35 |
| |
QF120702 | Flavoxate hydrochloride EP Impurity B CAS# NA M.F.: C19H16O4 M.W.: 308.33 |
| |
QF120701 | Flavoxate hydrochloride EP Impurity A CAS# NA M.F.: C17H12O4 M.W.: 280.27 |
| |
QF120700 | Flavoxate hydrochloride CAS# 3717-88-2 M.F.: C24H26ClNO4 M.W.: 427.92 |
| |
QF051900 | Ferrous fumarate CAS# 141-01-5 M.F.: C4H2FeO4 M.W.: 169.9 |
| |
QF052003 | Fenticonazole nitrate EP Impurity C CAS# NA M.F.: C24H20Cl2N2O3S M.W.: 487.40 |
| |
QF052002 | Fenticonazole nitrate EP Impurity B CAS# NA M.F.: C24H20Cl2N2O2S M.W.: 471.40 |
| |
QF052001 | Fenticonazole nitrate EP Impurity A; Tioconazole EP Impurity D; Isoconazole EP Impurity B CAS# NA M.F.: C11H10Cl2N2O M.W.: 257.12 |
| |
QF052000 | Fenticonazole nitrate CAS# 73151-29-8 M.F.: C24H21Cl2N3O4S M.W.: 518.41 |
| |
QF051603 | Fenoterol hydrobromide EP Impurity C CAS# NA M.F.: C18H23NO4 M.W.: 317.38 |
| |
QF051602 | Fenoterol hydrobromide EP Impurity B CAS# NA M.F.: C17H19NO4 M.W.: 301.34 |
| |
QF051601 | Fenoterol hydrobromide EP Impurity A CAS# NA M.F.: C17H21NO4 M.W.: 303.35 |
| |
QF051600 | Fenoterol hydrobromide CAS# 1944-12-3 M.F.: C17H22BrNO4 M.W.: 384.26 |
| |
QF051504 | Fenbufen EP Impurity D CAS# NA M.F.: C16H14O4 M.W.: 270.28 |
| |
QF051502 | Fenbufen EP Impurity B CAS# NA M.F.: C16H12O3 M.W.: 252.26 |
| |
QF051201 | Felbinac EP Impurity A CAS# NA M.F.: C14H12O2 M.W.: 196.24 |
| |
QF051200 | Felbinac CAS# 5728-52-9 M.F.: C14H12O2 M.W.: 212.24 |
| |
QE151617 | Etoposide EP Impurity Q CAS# NA M.F.: C21H16O7 M.W.: 380.35 |
| |
QE151616 | Etoposide EP Impurity P CAS# NA M.F.: C21H16O8 M.W.: 396.35 |
| |
QE151614 | Etoposide EP Impurity N CAS# NA M.F.: C50H50O20 M.W.: 970.92 |
| |
QE151612 | Etoposide EP Impurity L CAS# NA M.F.: C21H20O8 M.W.: 400.38 |
| |
QE151609 | Etoposide EP Impurity I CAS# NA M.F.: C30H34O13 M.W.: 602.58 |
| |
QE151608 | Etoposide EP Impurity H CAS# NA M.F.: C23H24O8 M.W.: 428.43 |
| |
QE151607 | Etoposide EP Impurity G CAS# NA M.F.: C39H38O17 M.W.: 778.71 |
| |
QE151606 | Etoposide EP Impurity F CAS# NA M.F.: C37H38O15 M.W.: 722.69 |
| |
QE151604 | Etoposide EP Impurity D CAS# 23363-35-1 M.F.: C27H30O13 M.W.: 562.52 |
| |
QE151603 | Etoposide EP Impurity C CAS# 100007-53-2 M.F.: C29H32O13 M.W.: 588.56 |
| |
QE151602 | Etoposide EP Impurity B CAS# 100007-56-5 M.F.: C29H32O13 M.W.: 588.56 |
| |
QE151601 | Etoposide EP Impurity A CAS# 124151-67-3 M.F.: C37H38O15 M.W.: 722.69 |
| |
QE202006 | Etilefrine hydrochloride EP Impurity F CAS# NA M.F.: C9H13N M.W.: 135.21 |
| |
QE202005 | Etilefrine hydrochloride EP Impurity E CAS# NA M.F.: C8H8O2 M.W.: 136.15 |
| |
QE202004 | Etilefrine hydrochloride EP Impurity D CAS# NA M.F.: C17H19NO2 M.W.: 269.34 |
| |
QE202003 | Etilefrine hydrochloride EP Impurity C CAS# NA M.F.: C8H11NO2 M.W.: 153.18 |
| |
QE202002 | Etilefrine hydrochloride EP Impurity B; Phenylephrine CAS# 1477-63-0;154-86-9(HCl salt) M.F.: C9H13NO2 M.W.: 167.21 |
| |
QE202001 | Etilefrine hydrochloride EP Impurity A CAS# 22510-12-9 M.F.: C10H13NO2 M.W.: 179.22 |
| |
QE202000 | Etilefrine hydrochloride CAS# 943-17-9 M.F.: C10H16ClNO2 M.W.: 217.69 |
| |
QE201100 | Etidronate disodium CAS# 7414-83-7 M.F.: C2H6Na2O7P2 M.W.: 249.99 |
| |
QE052001 | Ethosuximide EP Impurity A CAS# NA M.F.: C7H12O4 M.W.: 160.17 |
| |
QE052000 | Ethosuximide CAS# 77-67-8 M.F.: C7H11NO2 M.W.: 141.17 |
| |
QE201003 | Ethacridine lactate monohydrate EP Impurity C CAS# NA M.F.: C17H18N2O3 M.W.: 298.34 |
| |
QE201002 | Ethacridine lactate monohydrate EP Impurity B CAS# NA M.F.: C15H13ClN2O M.W.: 272.73 |
| |
QE201001 | Ethacridine lactate monohydrate EP Impurity A CAS# NA M.F.: C15H14N2O2 M.W.: 254.28 |
| |
QE201000 | Ethacridine lactate monohydrate CAS# 6402-23-9 M.F.: C18H23N3O5 M.W.: 361.39 |
| |
QE201701 | Etamsylate EP Impurity A CAS# NA M.F.: C6H6O2 M.W.: 110.11 |
| |
QE011803 | Etacrynic acid EP Impurity C CAS# NA M.F.: C26H24Cl4O8 M.W.: 606.28 |
| |
QE011802 | Etacrynic acid EP Impurity B CAS# NA M.F.: C13H13Cl3O4 M.W.: 339.60 |
| |
QE011801 | Etacrynic acid EP Impurity A CAS# NA M.F.: C12H12Cl2O4 M.W.: 291.13 |
| |
QE011800 | Etacrynic acid CAS# 58-54-8 M.F.: C13H12Cl2O4 M.W.: 303.14 |
| |
QE191104 | Esketamine hydrochloride EP Impurity D CAS# NA M.F.: C13H16ClNO M.W.: 237.73 |
| |
QE191103 | Esketamine hydrochloride EP Impurity C CAS# 90717-17-2 M.F.: C12H13ClO2 M.W.: 224.68 |
| |
QE191102 | Esketamine hydrochloride EP Impurity B CAS# NA M.F.: C12H13ClO2 M.W.: 224.68 |
| |
QE191101 | Esketamine hydrochloride EP Impurity A CAS# NA M.F.: C13H16ClNO M.W.: 237.73 |
| |
QE191100 | Esketamine hydrochloride CAS# 33795-24-3 M.F.: C13H17Cl2NO M.W.: 274.19 |
| |
QE051903 | Ergotamine tartrate EP Impurity C CAS# NA M.F.: C34H37N5O5 M.W.: 595.69 |
| |
QE051902 | Ergotamine tartrate EP Impurity B CAS# NA M.F.: C33H35N5O5 M.W.: 581.66 |
| |
QE051901 | Ergotamine tartrate EP Impurity A CAS# NA M.F.: C33H35N5O6 M.W.: 597.66 |
| |
QE051900 | Ergotamine tartrate CAS# 379-79-3 M.F.: C70H76N10O16 M.W.: 1313.41 |
| |
QE091807 | Epirubicin hydrochloride EP Impurity G; Epirubicin dimer CAS# 1046827-43-3 M.F.: C54H58N2O22 M.W.: 1087.04 |
| |
QE091806 | Epirubicin hydrochloride EP Impurity F CAS# 56390-08-0(HCl salt) M.F.: C27H29NO10 M.W.: 527.52 |
| |
QL142269 | Lenvatinib Impurity 69 CAS# 108-43-0 M.F.: C6H5ClO M.W.: 128.56 |
| |
QE091805 | Epirubicin hydrochloride EP Impurity E CAS# NA M.F.: C27H31NO10 M.W.: 529.54 |
| |
QE091803 | Epirubicin hydrochloride EP Impurity C;Daunorubicin EP Impurity D CAS# NA M.F.: C27H29NO11 M.W.: 543.52 |
| |
QE091802 | Epirubicin hydrochloride EP Impurity B; Daunorubicin EP Impurity A CAS# 21794-55-8 M.F.: C21H18O8 M.W.: 398.36 |
| |
QE091800 | Epirubicin hydrochloride CAS# 56390-09-1;56420-45-2(free base) M.F.: C27H30ClNO11 M.W.: 579.98 |
| |
QV180379 | Voriconazole Impurity 53 CAS# NA M.F.: C8H14N4 M.W.: 166.22 |
| |
QE140906 | Enilconazole EP Impurity F CAS# NA M.F.: C14H14Cl2N2O M.W.: 297.18 |
| |
QE140904 | Enilconazole EP Impurity D CAS# NA M.F.: C15H17Cl2NO2 M.W.: 314.21 |
| |
QE140903 | Enilconazole EP Impurity C CAS# NA M.F.: C12H13Cl2NO2 M.W.: 274.14 |
| |
QE140902 | Enilconazole EP Impurity B CAS# NA M.F.: C14H17Cl2NO M.W.: 286.2 |
| |
QE140901 | Enilconazole EP Impurity A CAS# NA M.F.: C11H13Cl2NO M.W.: 246.13 |
| |
QE130400 | Emedastine difumarate CAS# 87233-62-3;87233-61-2(free base) M.F.: C17H26N4O.2C4H4O4 M.W.: 302.42 232.14 |
| |
QE041800 | Edrophonium chloride CAS# 116-38-1 M.F.: C10H16ClNO M.W.: 201.69 |
| |
QE040601 | Edetic acid EP Impurity A CAS# NA M.F.: C6H9NO6 M.W.: 191.14 |
| |
QE040600 | Edetic acid CAS# 60-00-4 M.F.: C10H16N2O8 M.W.: 292.24 |
| |
QD250403 | Dydrogesterone EP Impurity C CAS# 246038-13-1 M.F.: C21H28O2 M.W.: 312.45 |
| |
QD250401 | Dydrogesterone EP Impurity A CAS# 23035-53-2 M.F.: C21H26O2 M.W.: 310.43 |
| |
QD250400 | Dydrogesterone CAS# 152-62-5 M.F.: C21H28O2 M.W.: 312.45 |
| |
QD181710 | Drospirenone EP Impurity K CAS# 889652-31-7 M.F.: C24H30O3 M.W.: 366.49 |
| |
QD181709 | Drospirenone EP Impurity I CAS# 2896199-04-3 M.F.: C24H32O3 M.W.: 368.51 |
| |
QD181708 | Drospirenone EP Impurity H CAS# 932388-89-1 M.F.: C24H31ClO3 M.W.: 402.95 |
| |
QD181707 | Drospirenone EP Impurity G CAS# 932388-90-4 M.F.: C24H31ClO3 M.W.: 402.95 |
| |
QD181704 | Drospirenone EP Impurity D CAS# 67372-69-4 M.F.: C23H28O3 M.W.: 352.47 |
| |
QD181703 | Drospirenone EP Impurity C CAS# 116298-21-6 M.F.: C21H26O2 M.W.: 310.43 |
| |
QD181702 | Drospirenone EP Impurity B CAS# NA M.F.: C24H32O4 M.W.: 384.51 |
| |
QD181701 | Drospirenone EP Impurity A CAS# 67372-68-3 M.F.: C23H30O3 M.W.: 354.48 |
| |
QD240102 | Doxapram hydrochloride EP Impurity B CAS# 1688-76-2 M.F.: C22H28N2O2 M.W.: 352.47 |
| |
QD240101 | Doxapram hydrochloride EP Impurity A CAS# 3192-64-1 M.F.: C20H22ClNO M.W.: 327.85 |
| |
QD240100 | Doxapram hydrochloride CAS# 7081-53-0 M.F.: C24H33ClN2O3 M.W.: 432.98 |
| |
QD152005 | Dosulepin hydrochloride EP Impurity E CAS# NA M.F.: C19H21NS M.W.: 295.44 |
| |
QD152004 | Dosulepin hydrochloride EP Impurity D CAS# NA M.F.: C19H21NO2S M.W.: 327.44 |
| |
QD152003 | Dosulepin hydrochloride EP Impurity C CAS# NA M.F.: C19H23NOS M.W.: 313.46 |
| |
QD152002 | Dosulepin hydrochloride EP Impurity B CAS# 1531-77-7 M.F.: C14H10OS M.W.: 226.29 |
| |
QD152001 | Dosulepin hydrochloride EP Impurity A CAS# NA M.F.: C19H21NOS M.W.: 311.44 |
| |
QD152000 | Dosulepin hydrochloride CAS# 897-15-4 M.F.: C19H22ClNS M.W.: 331.9 |
| |
QD150701 | Dodecyl gallate EP Impurity A; Octyl gallate EP Impurity A CAS# 149-91-7;5995-86-8(monohydrate) M.F.: C7H6O5 M.W.: 170.12 |
| |
QD150700 | Dodecyl gallate CAS# 1166-52-5 M.F.: C19H30O5 M.W.: 338.44 |
| |
QD092104 | Disopyramide EP Impurity D CAS# NA M.F.: C13H10N2 M.W.: 194.23 |
| |
QD092103 | Disopyramide EP Impurity C CAS# NA M.F.: C18H23N3O M.W.: 297.39 |
| |
QD092102 | Disopyramide EP Impurity B CAS# NA M.F.: C20H28N2 M.W.: 296.45 |
| |
QD092101 | Disopyramide EP Impurity A CAS# NA M.F.: C21H27N3 M.W.: 321.46 |
| |
QD161502 | Controlled Substance (Dipotassium clorazepate EP Impurity B) CAS# 1088-11-5 M.F.: C15H11ClN2O M.W.: 270.71 |
| |
QD161500 | Dipotassium clorazepate CAS# 57109-90-7 M.F.: C16H11ClK2N2O4 M.W.: 408.92 |
| |
QD141706 | Dinoprostone EP Impurity F CAS# 26441-05-4 M.F.: C20H30O5 M.W.: 350.45 |
| |
QD141704 | Dinoprostone EP Impurity D CAS# 13345-50-1 M.F.: C20H30O4 M.W.: 334.45 |
| |
QD141702 | Dinoprostone EP Impurity B CAS# 27415-25-4 M.F.: C20H32O5 M.W.: 352.47 |
| |
QD141701 | Dinoprostone EP Impurity A CAS# 38873-82-4 M.F.: C20H32O5 M.W.: 352.47 |
| |
QD141700 | Dinoprostone;Alprostadil EP Impurity G CAS# 363-24-6 M.F.: C20H32O5 M.W.: 352.47 |
| |
QD141504 | Dinoprost trometamol EP Impurity D CAS# NA M.F.: C20H34O5 M.W.: 354.48 |
| |
QD141502 | Dinoprost trometamol EP Impurity B CAS# 37658-84-7 M.F.: C20H34O5 M.W.: 354.48 |
| |
QD141501 | Dinoprost trometamol EP Impurity A CAS# 36150-01-3 M.F.: C20H34O5 M.W.: 354.48 |
| |
QD141500 | Dinoprost trometamol CAS# 38562-01-5;551-11-1(free base) M.F.: C24H45NO8 M.W.: 475.62 |
| |
QD131900 | Dimethyl sulfoxide CAS# 67-68-5 M.F.: C2H6OS M.W.: 78.13 |
| |
QD093303 | Dihydrotachysterol EP Impurity C CAS# NA M.F.: C28H48O M.W.: 400.68 |
| |
QD093302 | Dihydrotachysterol EP Impurity B CAS# NA M.F.: C28H46O M.W.: 398.66 |
| |
QD093301 | Dihydrotachysterol EP Impurity A CAS# NA M.F.: C28H46O M.W.: 398.66 |
| |
QD093300 | Dihydrotachysterol CAS# 67-96-9 M.F.: C28H46O M.W.: 398.66 |
| |
QD093205 | Dihydroergotamine mesilate EP Impurity E CAS# NA M.F.: C35H41N5O5 M.W.: 611.73 |
| |
QD093204 | Dihydroergotamine mesilate EP Impurity D CAS# NA M.F.: C33H37N5O5 M.W.: 583.68 |
| |
QD093203 | Dihydroergotamine mesilate EP Impurity C CAS# NA M.F.: C33H37N5O6 M.W.: 599.68 |
| |
QD093201 | Dihydroergotamine mesilate EP Impurity A CAS# NA M.F.: C33H35N5O5 M.W.: 581.66 |
| |
QD093200 | Dihydroergotamine mesilate CAS# 6190-39-2 M.F.: C34H41N5O8S M.W.: 679.78 |
| |
QD093112 | Dihydroergocristine mesilate EP Impurity L CAS# NA M.F.: C35H41N5O6 M.W.: 627.73 |
| |
QD093111 | Dihydroergocristine mesilate EP Impurity K; Ergotamine tartrate EP Impurity D CAS# NA M.F.: C35H39N5O5 M.W.: 609.71 |
| |
QD093110 | Dihydroergocristine mesilate EP Impurity J CAS# NA M.F.: C36H43N5O5 M.W.: 625.76 |
| |
QD093109 | Dihydroergocristine mesilate EP Impurity I CAS# NA M.F.: C32H43N5O5 M.W.: 577.71 |
| |
QD093108 | Dihydroergocristine mesilate EP Impurity H CAS# NA M.F.: C32H43N5O5 M.W.: 577.71 |
| |
QD093107 | Dihydroergocristine mesilate EP Impurity G; Dihydroergotamine mesilate EP Impurity B CAS# NA M.F.: C34H39N5O5 M.W.: 597.70 |
| |
QD093106 | Dihydroergocristine mesilate EP Impurity F CAS# NA M.F.: C31H41N5O5 M.W.: 563.69 |
| |
QD093105 | Dihydroergocristine mesilate EP Impurity E CAS# NA M.F.: C33H37N5O5 M.W.: 583.68 |
| |
QD093104 | Dihydroergocristine mesilate EP Impurity D CAS# NA M.F.: C29H37N5O5 M.W.: 535.63 |
| |
QD093102 | Dihydroergocristine mesilate EP Impurity B CAS# NA M.F.: C16H19N3O M.W.: 269.34 |
| |
QD093101 | Dihydroergocristine mesilate EP Impurity A CAS# NA M.F.: C16H19N3O M.W.: 269.34 |
| |
QD093100 | Dihydroergocristine mesilate CAS# 24730-10-7 M.F.: C36H45N5O8S M.W.: 707.84 |
| |
QD093004 | Dihydrocodeine hydrogen tartrate EP Impurity D CAS# NA M.F.: C19H25NO3 M.W.: 315.41 |
| |
QD093003 | Dihydrocodeine hydrogen tartrate EP Impurity C; Oxycodone hydrochloride EP Impurity E CAS# NA M.F.: C18H21NO3 M.W.: 299.36 |
| |
QD093002 | Dihydrocodeine hydrogen tartrate EP Impurity B CAS# NA M.F.: C17H19NO3 M.W.: 285.34 |
| |
QD093000 | Dihydrocodeine hydrogen tartrate CAS# 5965-13-9 M.F.: C22H29NO9 M.W.: 451.47 |
| |
QD052200 | Diethylstilbestrol CAS# 56-53-1 M.F.: C18H20O2 M.W.: 268.35 |
| |
QD091100 | Diethylcarbamazine citrate CAS# 1642-54-2 M.F.: C16H29N3O8 M.W.: 391.42 |
| |
QD091004 | Dicloxacillin sodium EP Impurity D CAS# 3919-76-4 M.F.: C11H7Cl2NO3 M.W.: 272.08 |
| |
QD091003 | Dicloxacillin sodium EP Impurity C CAS# 551-16-6 M.F.: C8H12N2O3S M.W.: 216.26 |
| |
QD091002 | Dicloxacillin sodium EP Impurity B CAS# NA M.F.: C18H19Cl2N3O4S M.W.: 444.33 |
| |
QD091001 | Dicloxacillin sodium EP Impurity A CAS# 2088415-70-5 M.F.: C19H19Cl2N3O6S M.W.: 488.34 |
| |
QD091000 | Dicloxacillin sodium CAS# 13412-64-1;3116-76-5(free base) M.F.: C19H18Cl2N3NaO6S M.W.: 510.32 |
| |
QD090707 | Diclazuril EP Impurity G CAS# NA M.F.: C22H17Cl3N4O4 M.W.: 507.75 |
| |
QD090706 | Diclazuril EP Impurity F CAS# NA M.F.: C16H10Cl3N3O2 M.W.: 382.63 |
| |
QD090705 | Diclazuril EP Impurity E CAS# NA M.F.: C14H9Cl3N2 M.W.: 311.59 |
| |
QD090704 | Diclazuril EP Impurity D CAS# NA M.F.: C16H8Cl3N3O3 M.W.: 396.61 |
| |
QD090703 | Diclazuril EP Impurity C CAS# NA M.F.: C18H10Cl3N5O3 M.W.: 450.66 |
| |
QD090702 | Diclazuril EP Impurity B CAS# NA M.F.: C17H10Cl2N4O3 M.W.: 389.19 |
| |
QD090701 | Diclazuril EP Impurity A CAS# NA M.F.: C18H9Cl3N4O4 M.W.: 451.65 |
| |
QD090202 | Dibrompropamidine diisetionate EP Impurity B CAS# NA M.F.: C17H19BrN4O2 M.W.: 391.26 |
| |
QD090201 | Dibrompropamidine diisetionate EP Impurity A CAS# NA M.F.: C17H17Br2N3O3 M.W.: 471.14 |
| |
QD090200 | Dibrompropamidine diisetionate CAS# 614-87-9 M.F.: C21H30Br2N4O10S2 M.W.: 722.42 |
| |
QD052906 | Dextropropoxyphene hydrochloride EP Impurity F CAS# NA M.F.: C13H18O M.W.: 190.28 |
| |
QD052904 | Dextropropoxyphene hydrochloride EP Impurity D CAS# NA M.F.: C22H29NO2 M.W.: 339.47 |
| |
QD052903 | Dextropropoxyphene hydrochloride EP Impurity C CAS# NA M.F.: C23H31NO2 M.W.: 353.50 |
| |
QD052902 | Dextropropoxyphene hydrochloride EP Impurity B CAS# NA M.F.: C21H27NO2 M.W.: 325.44 |
| |
QD052901 | Dextropropoxyphene hydrochloride EP Impurity A CAS# NA M.F.: C19H25NO M.W.: 283.41 |
| |
QD052900 | Dextropropoxyphene hydrochloride CAS# 1639-60-7 M.F.: C22H30ClNO2 M.W.: 375.93 |
| |
QD052800 | Dextromoramide tartrate CAS# 2922-44-3 M.F.: C29H38N2O8 M.W.: 542.62 |
| |
QD052602 | Dexchlorpheniramine maleate EP Impurity B CAS# 32188-09-3 M.F.: C16H19ClN2 M.W.: 274.79 |
| |
QD052601 | Dexchlorpheniramine maleate EP Impurity A CAS# NA M.F.: C16H20N2 M.W.: 240.34 |
| |
QD052600 | Dexchlorpheniramine maleate CAS# 2438-32-6 M.F.: C20H23ClN2O4 M.W.: 390.86 |
| |
QD191500 | Desoxycortone acetate CAS# 56-47-3 M.F.: C23H32O4 M.W.: 372.5 |
| |
QD051600 | Desipramine hydrochloride CAS# 58-28-6 M.F.: C18H23ClN2 M.W.: 302.84 |
| |
QD052108 | Desflurane EP Impurity H CAS# 67-64-1 M.F.: C3H6O M.W.: 58.08 |
| |
QD052103 | Desflurane EP Impurity C CAS# 75-43-4 M.F.: CHCl2F M.W.: 102.92 |
| |
QD052102 | Desflurane EP Impurity B CAS# NA M.F.: C3H2ClF5O M.W.: 184.49 |
| |
QD052101 | Desflurane EP Impurity A CAS# NA M.F.: C4H2F8O M.W.: 218.05 |
| |
QD051305 | Dembrexine hydrochloride monohydrate EP Impurity E CAS# 118-79-6 M.F.: C6H3Br3O M.W.: 330.80 |
| |
QD051704 | Deptropine citrate EP Impurity D CAS# NA M.F.: C22H25NO M.W.: 319.44 |
| |
QD051703 | Deptropine citrate EP Impurity C; Nortriptyline hydrochloride EP Impurity I; Amitriptyline EP Impurity G CAS# 1210-34-0 M.F.: C15H14O M.W.: 210.27 |
| |
QD051702 | Deptropine citrate EP Impurity B CAS# NA M.F.: C23H27NO M.W.: 333.47 |
| |
QD051700 | Deptropine citrate CAS# 2169-75-7 M.F.: C29H35NO8 M.W.: 525.59 |
| |
QD051303 | Dembrexine hydrochloride monohydrate EP Impurity C CAS# NA M.F.: C7H4Br2O2 M.W.: 279.91 |
| |
QD051302 | Dembrexine hydrochloride monohydrate EP Impurity B CAS# NA M.F.: C13H17Br2NO2 M.W.: 379.09 |
| |
QD051301 | Dembrexine hydrochloride monohydrate EP Impurity A CAS# NA M.F.: C13H15Br2NO2 M.W.: 377.07 |
| |
QD051300 | Dembrexine hydrochloride monohydrate CAS# 52702-51-9 M.F.: C13H20Br2ClNO3 M.W.: 433.56 |
| |
QD010303 | Dacarbazine EP Impurity C CAS# 1314929-56-0 M.F.: C4H5N5O M.W.: 139.12 |
| |
QC251710 | Cyproterone acetate EP Impurity J CAS# 15423-97-9 M.F.: C24H30O5 M.W.: 398.49 |
| |
QC251709 | Cyproterone acetate EP Impurity I; Chlormadinone acetate EP Impurity D CAS# 13698-49-2 M.F.: C23H27ClO4 M.W.: 402.91 |
| |
QC251708 | Cyproterone acetate EP Impurity H CAS# 2668-74-8 M.F.: C23H30O4 M.W.: 370.48 |
| |
QC251707 | Cyproterone acetate EP Impurity G CAS# 23814-84-8 M.F.: C24H31ClO5 M.W.: 434.95 |
| |
QC251706 | Cyproterone acetate EP Impurity F CAS# 2098-66-0 M.F.: C22H27ClO3 M.W.: 374.90 |
| |
QC251705 | Cyproterone acetate EP Impurity E CAS# 17184-05-3 M.F.: C24H30O5 M.W.: 398.49 |
| |
QC251704 | Cyproterone acetate EP Impurity D CAS# NA M.F.: C24H31ClO5 M.W.: 434.95 |
| |
QC251703 | Cyproterone acetate EP Impurity C CAS# 17183-98-1 M.F.: C24H30Cl2O4 M.W.: 453.4 |
| |
QC251702 | Cyproterone acetate EP Impurity B CAS# NA M.F.: C25H32O5 M.W.: 412.52 |
| |
QC251701 | Cyproterone acetate EP Impurity A CAS# 2701-50-0 M.F.: C24H30O4 M.W.: 382.49 |
| |
QC251700 | Cyproterone acetate CAS# 427-51-0 M.F.: C24H29ClO4 M.W.: 416.94 |
| |
QC250503 | Cyclopentolate hydrochloride EP Impurity C CAS# 36882-00-5;113079-81-5(HCl salt) M.F.: C12H17NO2 M.W.: 207.27 |
| |
QC250501 | Cyclopentolate hydrochloride EP Impurity A CAS# NA M.F.: C13H16O3 M.W.: 220.26 |
| |
QC250500 | Cyclopentolate hydrochloride CAS# 5870-29-1 M.F.: C17H26ClNO3 M.W.: 327.85 |
| |
QC250402 | Cyclizine hydrochloride EP Impurity B CAS# 91-01-0 M.F.: C13H12O M.W.: 184.23 |
| |
QC250400 | Cyclizine hydrochloride CAS# 305-25-3;82-92-8(free base) M.F.: C18H23ClN2 M.W.: 302.84 |
| |
QM041847 | Minodronic Acid Impurity 21 CAS# NA M.F.: C18H14N4O3 M.W.: 334.33 |
| |
QM041846 | Minodronic Acid Impurity 20 CAS# NA M.F.: C9H7ClN2O M.W.: 194.62 |
| |
QM041845 | Minodronic Acid Impurity 19 CAS# NA M.F.: C9H12N2O8P2 M.W.: 338.15 |
| |
QC030203 | Cocaine hydrochloride EP Impurity C CAS# NA M.F.: C38H46N2O8 M.W.: 658.78 |
| |
QC030202 | Cocaine hydrochloride EP Impurity B CAS# NA M.F.: C38H46N2O8 M.W.: 658.78 |
| |
QC030201 | Cocaine hydrochloride EP Impurity A CAS# NA M.F.: C19H23NO4 M.W.: 329.39 |
| |
QC030200 | Cocaine hydrochloride CAS# 53-21-4 M.F.: C17H22ClNO4 M.W.: 339.81 |
| |
QC152010 | Closantel sodium dihydrate EP Impurity J CAS# NA M.F.: C44H27Cl3I4N4O4 M.W.: 1289.69 |
| |
QC152009 | Closantel sodium dihydrate EP Impurity I CAS# NA M.F.: C22H15Cl2IN2O2 M.W.: 537.18 |
| |
QC152008 | Closantel sodium dihydrate EP Impurity H CAS# NA M.F.: C23H17Cl2I2NO4 M.W.: 696.10 |
| |
QC152007 | Closantel sodium dihydrate EP Impurity G CAS# NA M.F.: C23H18Cl2I2N2O3 M.W.: 695.12 |
| |
QC152006 | Closantel sodium dihydrate EP Impurity F CAS# NA M.F.: C21H13Cl2I2NO3 M.W.: 652.05 |
| |
QC152005 | Closantel sodium dihydrate EP Impurity E CAS# NA M.F.: C22H14Cl3IN2O2 M.W.: 571.62 |
| |
QC152004 | Closantel sodium dihydrate EP Impurity D CAS# NA M.F.: C22H16Cl2I2N2O3 M.W.: 681.09 |
| |
QC152003 | Closantel sodium dihydrate EP Impurity C CAS# NA M.F.: C22H15Cl2I2NO4 M.W.: 682.07 |
| |
QC152002 | Closantel sodium dihydrate EP Impurity B CAS# NA M.F.: C15H12Cl2N2 M.W.: 291.18 |
| |
QC152001 | Closantel sodium dihydrate EP Impurity A CAS# NA M.F.: C7H4I2O3 M.W.: 389.91 |
| |
QC152000 | Closantel sodium dihydrate CAS# 61438-64-0 M.F.: C22H17Cl2I2N2NaO4 M.W.: 721.09 |
| |
QC151608 | Clopamide EP Impurity H CAS# NA M.F.: C17H25ClN4O3S M.W.: 400.92 |
| |
QC151607 | Clopamide EP Impurity G CAS# NA M.F.: C13H18ClN3O3S M.W.: 331.82 |
| |
QC151601 | Clopamide EP Impurity A CAS# NA M.F.: C14H20ClN3O3S M.W.: 345.84 |
| |
QC151502 | Clonazepam EP Impurity B CAS# 55198-89-5 M.F.: C15H10ClN3O3 M.W.: 315.71 |
| |
QC151306 | Clomifene citrate EP Impurity F CAS# 47648-28-2 M.F.: C26H27Cl2NO M.W.: 440.40 |
| |
QC151305 | Clomifene citrate EP Impurity E CAS# 117884-82-9 M.F.: C26H27Cl2NO M.W.: 440.40 |
| |
QC151304 | Clomifene citrate EP Impurity D CAS# 1391054-64-0 M.F.: C38H46N2O3 M.W.: 578.78 |
| |
QC151303 | Clomifene citrate EP Impurity C CAS# 5635-70-1(HCl salt) M.F.: C26H29NO2 M.W.: 387.51 |
| |
QC151302 | Clomifene citrate EP Impurity B CAS# 796-77-0 M.F.: C19H23NO2 M.W.: 297.39 |
| |
QC151301 | Clomifene citrate EP Impurity A CAS# 19957-52-9;74056-26-1(HCl salt) M.F.: C26H29NO M.W.: 371.51 |
| |
QC151300 | Clomifene citrate CAS# 50-41-9 M.F.: C32H36ClNO8 M.W.: 598.08 |
| |
QC150509 | Clobetasone butyrate EP Impurity I CAS# NA M.F.: C26H32ClFO5 M.W.: 478.98 |
| |
QC150508 | Clobetasone butyrate EP Impurity H CAS# NA M.F.: C25H30ClFO5 M.W.: 464.95 |
| |
QC150507 | Clobetasone butyrate EP Impurity G CAS# NA M.F.: C29H37FO7 M.W.: 516.6 |
| |
QC150506 | Clobetasone butyrate EP Impurity F CAS# NA M.F.: C26H32ClFO5 M.W.: 478.98 |
| |
QC150505 | Clobetasone butyrate EP Impurity E CAS# NA M.F.: C26H34ClFO5 M.W.: 481 |
| |
QC150504 | Clobetasone butyrate EP Impurity D CAS# NA M.F.: C26H31BrClFO5 M.W.: 557.88 |
| |
QC150503 | Clobetasone butyrate EP Impurity C CAS# NA M.F.: C26H34ClFO5 M.W.: 481 |
| |
QC150501 | Clobetasone butyrate EP Impurity A CAS# NA M.F.: C22H26ClFO4 M.W.: 408.89 |
| |
QC150500 | Clobetasone butyrate CAS# 25122-57-0 M.F.: C26H32ClFO M.W.: 478.98 |
| |
QC150406 | Clobazam EP Impurity F CAS# NA M.F.: C17H17ClN2O3 M.W.: 332.78 |
| |
QC150405 | Clobazam EP Impurity E CAS# 75524-13-9 M.F.: C15H15ClN2O M.W.: 274.75 |
| |
QC150404 | Clobazam EP Impurity D CAS# 2092997-47-0 M.F.: C18H17ClN2O2 M.W.: 328.79 |
| |
QC150403 | Clobazam EP Impurity C CAS# 22316-16-1 M.F.: C17H15ClN2O2 M.W.: 314.77 |
| |
QC150402 | Clobazam EP Impurity B CAS# 22316-24-1 M.F.: C16H14N2O2 M.W.: 266.29 |
| |
QC150401 | Clobazam EP Impurity A CAS# 22316-55-8 M.F.: C15H11ClN2O2 M.W.: 286.71 |
| |
QC121103 | Clioquinol EP Impurity C CAS# NA M.F.: C9H5I2NO M.W.: 396.95 |
| |
QC121102 | Clioquinol EP Impurity B CAS# NA M.F.: C9H5Cl2NO M.W.: 214.05 |
| |
QC121101 | Clioquinol EP Impurity A CAS# NA M.F.: C9H6ClNO M.W.: 179.6 |
| |
QC121003 | Clebopride malate EP Impurity C CAS# NA M.F.: C20H25N3O2 M.W.: 339.43 |
| |
QC121002 | Clebopride malate EP Impurity B CAS# 50541-93-0 M.F.: C12H18N2 M.W.: 190.28 |
| |
QC121001 | Clebopride malate EP Impurity A CAS# 7206-70-4 M.F.: C8H8ClNO3 M.W.: 201.61 |
| |
QC121000 | Clebopride malate CAS# 57645-91-7 M.F.: C24H30ClN3O7 M.W.: 507.96 |
| |
QC122609 | Clazuril EP Impurity I CAS# NA M.F.: C16H12Cl2N4O M.W.: 347.2 |
| |
QC122608 | Clazuril EP Impurity H CAS# NA M.F.: C34H19Cl3N8O4 M.W.: 709.92 |
| |
QC122607 | Clazuril EP Impurity G CAS# NA M.F.: C16H9Cl2N3O3 M.W.: 362.17 |
| |
QC122606 | Clazuril EP Impurity F CAS# NA M.F.: C20H14Cl2N4O4 M.W.: 445.26 |
| |
QP032015 | Procaterol Impurity 15 CAS# NA M.F.: C16H22N2O3 HCl M.W.: 290.36 36.46 |
| |
QC122605 | Clazuril EP Impurity E CAS# NA M.F.: C19H12Cl2N4O4 M.W.: 431.23 |
| |
QC122604 | Clazuril EP Impurity D CAS# NA M.F.: C20H15Cl2N5O3 M.W.: 444.27 |
| |
QC122603 | Clazuril EP Impurity C CAS# NA M.F.: C17H12Cl2N4O3 M.W.: 391.21 |
| |
QC122602 | Clazuril EP Impurity B CAS# NA M.F.: C18H11Cl2N5O3 M.W.: 416.22 |
| |
QC122601 | Clazuril EP Impurity A CAS# NA M.F.: C17H11Cl2N3O4 M.W.: 392.19 |
| |
QC091204 | Cilazapril EP Impurity D CAS# NA M.F.: C22H31N3O5 M.W.: 417.50 |
| |
QC091203 | Cilazapril EP Impurity C CAS# NA M.F.: C24H35N3O5 M.W.: 445.55 |
| |
QC091202 | Cilazapril EP Impurity B CAS# NA M.F.: C20H27N3O5 M.W.: 389.45 |
| |
QC091201 | Cilazapril EP Impurity A CAS# NA M.F.: C26H39N3O5 M.W.: 473.60 |
| |
QC090403 | Ciclesonide EP Impurity C CAS# NA M.F.: C32H42O7 M.W.: 538.67 |
| |
QC090402 | Ciclesonide EP Impurity B CAS# 161115-59-9 M.F.: C28H38O6 M.W.: 470.60 |
| |
QC090401 | Ciclesonide EP Impurity A CAS# 141845-81-0 M.F.: C32H44O7 M.W.: 540.69 |
| |
QN151841 | Noradrenaline (Norepinephrine) Impurity 41 CAS# 2947-04-8 M.F.: C9H13NO3 M.W.: 183.20 |
| |
QC182212 | Chlortetracycline EP Impurity L CAS# NA M.F.: C22H21ClN2O7 M.W.: 460.86 |
| |
QC182211 | Chlortetracycline EP Impurity K CAS# NA M.F.: C22H21ClN2O7 M.W.: 460.86 |
| |
QC182210 | Chlortetracycline EP Impurity J; Lymecycline EP Impurity C CAS# NA M.F.: C22H22N2O7 M.W.: 426.42 |
| |
QC182209 | Chlortetracycline EP Impurity I; Lymecycline EP Impurity D CAS# NA M.F.: C22H22N2O7 M.W.: 426.42 |
| |
QC182208 | Chlortetracycline EP Impurity H CAS# NA M.F.: C23H24ClNO8 M.W.: 477.89 |
| |
QC182207 | Chlortetracycline EP Impurity G CAS# NA M.F.: C22H23ClN2O8 M.W.: 478.88 |
| |
QC182206 | Chlortetracycline EP Impurity F CAS# NA M.F.: C22H23ClN2O8 M.W.: 478.88 |
| |
QC182205 | Chlortetracycline EP Impurity E; Demeclocycline EP Impurity B CAS# 14206-59-8 M.F.: C21H21ClN2O8 M.W.: 464.85 |
| |
QC182204 | Chlortetracycline EP Impurity D; Lymecycline EP Impurity A; Tetracycline EP Impurity A; 4-Epitetracycline CAS# 79-85-6;23313-80-6(HCl salt) M.F.: C22H24N2O8 M.W.: 444.43 |
| |
QC182203 | Chlortetracycline EP Impurity C; Demeclocycline EP Impurity C CAS# NA M.F.: C21H22N2O8 M.W.: 430.41 |
| |
QC121701 | Chlorhexidine EP Impurity A CAS# 152504-08-0 M.F.: C16H24ClN9 M.W.: 377.88 |
| |
QT131211 | Timolol Maleate Impurity 11 CAS# 1391068-18-0 M.F.: C19H31N7O4S2 M.W.: 485.62 |
| |
QC121714 | Chlorhexidine EP Impurity N CAS# 152504-10-4 M.F.: C15H25ClN8 M.W.: 352.87 |
| |
QC121708 | Chlorhexidine EP Impurity H CAS# NA M.F.: C30H47Cl2N15 M.W.: 688.70 |
| |
QC121705 | Chlorhexidine EP Impurity E CAS# 45964-97-4;14279-91-5(HCl salt) M.F.: C7H8ClN3 M.W.: 169.61 |
| |
QC051309 | Celiprolol EP Impurity I CAS# NA M.F.: C15H22N2O3 M.W.: 278.35 |
| |
QC051308 | Celiprolol EP Impurity H CAS# NA M.F.: C16H23BrN2O4 M.W.: 387.27 |
| |
QC051307 | Celiprolol EP Impurity G CAS# NA M.F.: C16H22N2O4 M.W.: 306.36 |
| |
QC051306 | Celiprolol EP Impurity F CAS# NA M.F.: C13H18N2O3 M.W.: 250.29 |
| |
QC051304 | Celiprolol EP Impurity D CAS# NA M.F.: C20H33N3O4 M.W.: 379.49 |
| |
QC051303 | Celiprolol EP Impurity C CAS# NA M.F.: C20H33N3O4 M.W.: 379.49 |
| |
QC051301 | Celiprolol EP Impurity A CAS# NA M.F.: C15H24N2O3 M.W.: 280.36 |
| |
QC012305 | Carteolol EP Impurity E CAS# 56660-90-3 M.F.: C21H22N2O5 M.W.: 382.41 |
| |
QC012304 | Carteolol EP Impurity D CAS# 51781-13-6 M.F.: C12H14ClNO3 M.W.: 255.70 |
| |
QC012303 | Carteolol EP Impurity C CAS# 51781-14-7 M.F.: C12H13NO3 M.W.: 219.24 |
| |
QC012302 | Carteolol EP Impurity B CAS# 30389-33-4 M.F.: C9H9NO2 M.W.: 163.17 |
| |
QC011705 | Carprofen EP Impurity E CAS# NA M.F.: C12H8ClN M.W.: 201.65 |
| |
QB051300 | Bempedoic acid CAS# 738606-46-7 M.F.: C19H36O5 M.W.: 344.49 |
| |
QC012809 | Camphor EP Impurity I CAS# NA M.F.: C10H18O M.W.: 154.25 |
| |
QC012804 | Camphor EP Impurity D CAS# NA M.F.: C10H18O M.W.: 154.25 |
| |
QC012803 | Camphor EP Impurity C CAS# NA M.F.: C10H16 M.W.: 136.23 |
| |
QC012704 | Cabergoline EP Impurity D CAS# 85329-86-8 M.F.: C23H32N4O M.W.: 380.53 |
| |
QC012703 | Cabergoline EP Impurity C CAS# 126554-50-5 M.F.: C29H42N6O3 M.W.: 522.68 |
| |
QC012702 | Cabergoline EP Impurity B CAS# 166533-36-4 M.F.: C26H37N5O2 M.W.: 451.60 |
| |
QC012701 | Cabergoline EP Impurity A CAS# 81409-74-7 M.F.: C18H20N2O2 M.W.: 296.36 |
| |
QB211610 | Buprenorphine EP Impurity J CAS# NA M.F.: C29H39NO4 M.W.: 465.62 |
| |
QB211609 | Buprenorphine EP Impurity I CAS# NA M.F.: C28H37NO3 M.W.: 435.60 |
| |
QN122033 | 6α-N-methylnaltrexamine CAS# 102919-85-7 M.F.: C21H28N2O3 M.W.: 356.46 |
| |
QB211608 | Buprenorphine EP Impurity H CAS# NA M.F.: C29H43NO4 M.W.: 469.66 |
| |
QB211607 | Buprenorphine EP Impurity G CAS# NA M.F.: C58H80N2O8 M.W.: 933.26 |
| |
QB211606 | Buprenorphine EP Impurity F CAS# NA M.F.: C29H39NO3 M.W.: 449.62 |
| |
QB211605 | Buprenorphine EP Impurity E CAS# NA M.F.: C28H39NO4 M.W.: 453.61 |
| |
QB211604 | Buprenorphine EP Impurity D CAS# NA M.F.: C30H43NO4 M.W.: 481.67 |
| |
QB211603 | Buprenorphine EP Impurity C CAS# NA M.F.: C27H36N2O4 M.W.: 452.59 |
| |
QB211602 | Buprenorphine EP Impurity B CAS# NA M.F.: C25H35NO4 M.W.: 413.55 |
| |
QB211601 | Buprenorphine EP Impurity A CAS# NA M.F.: C29H41NO4 M.W.: 467.64 |
| |
QB210503 | Bufexamac EP Impurity C CAS# NA M.F.: C16H24O3 M.W.: 264.36 |
| |
QB210502 | Bufexamac EP Impurity B CAS# NA M.F.: C13H18O3 M.W.: 222.28 |
| |
QB210501 | Bufexamac EP Impurity A CAS# NA M.F.: C12H16O3 M.W.: 208.25 |
| |
QB182002 | Brotizolam EP Impurity B CAS# NA M.F.: C14H8BrClN4S M.W.: 379.66 |
| |
QB052202 | Betadex EP Impurity B;Alfadex EP Impurity B CAS# 17465-86-0 M.F.: C48H80O40 M.W.: 1297.12 |
| |
QB052201 | Betadex EP Impurity A CAS# 10016-20-3 M.F.: C36H60O30 M.W.: 972.84 |
| |
QB052700 | Benzyl benzoate CAS# 120-51-4 M.F.: C14H12O2 M.W.: 212.24 |
| |
QA181007 | Articaine EP Impurity G CAS# NA M.F.: C14H22N2O3S M.W.: 298.4 |
| |
QA181006 | Articaine EP Impurity F CAS# NA M.F.: C15H25N3O2S M.W.: 311.44 |
| |
QA181002 | Articaine EP Impurity B CAS# 114176-52-2 M.F.: C12H18N2O3S M.W.: 270.35 |
| |
QA142601 | Antazoline hydrochloride EP Impurity A CAS# NA M.F.: C17H21N3O M.W.: 283.37 |
| |
QF120315 | Folic Acid Impurity 15 CAS# 712-29-8 M.F.: C7H7N5O2 M.W.: 193.16 |
| |
QF120314 | Folic Acid Impurity 14 CAS# 873397-19-4 M.F.: C7H6ClN5O M.W.: 211.61 |
| |
QA142600 | Antazoline hydrochloride CAS# 2508-72-7 M.F.: C17H20ClN3 M.W.: 301.81 |
| |
QF122020 | Fluticasone Impurity 20; Fluticasone Furoate EP Impurity F CAS# NA M.F.: C29H34F2O7 M.W.: 532.57 |
| |
QN150300 | Neomycin sulfate CAS# 1405-10-3 M.F.: C23H46N6O13.xH2SO4 M.W.: 614.64 x(98.08) |
| |
QM091903 | Misoprostol EP Impurity C CAS# NA M.F.: C22H36O4 M.W.: 364.52 |
| |
QM050105 | Metamizole sodium EP Impurity E CAS# 117-38-4;129-89-5(Na salt) M.F.: C12H15N3O4S M.W.: 297.33 |
| |
QM050104 | Metamizole sodium EP Impurity D CAS# 58-15-1 M.F.: C13H17N3O M.W.: 231.29 |
| |
QM050103 | Metamizole sodium EP Impurity C CAS# 519-98-2;856307-27-2(HCl salt) M.F.: C12H15N3O M.W.: 217.27 |
| |
QM050102 | Metamizole sodium EP Impurity B CAS# 83-07-8 M.F.: C11H13N3O M.W.: 203.24 |
| |
QV307760 | Vitamin B12;Cyanocobalamin CAS# 68-19-9 M.F.: C63H88CoN14O14P M.W.: 1355.37 |
| |
QA130302 | Aminocaproic acid Impurity B CAS# NA M.F.: C8H11F2NO3 M.W.: 207.17 |
| |
QL241678 | Loxoprofen Impurity 52 CAS# NA M.F.: C18H24O5 M.W.: 320.38 |
| |
QZ151206 | Zoledronic acid Impurity 6 CAS# 1627731-61-6;2043362-88-3(chloride) M.F.: C7H16N2O14P4 M.W.: 476.10 |
| |
QA141501 | Aminoglutethimide EP Impurity A CAS# NA M.F.: C13H16N2O2 M.W.: 232.28 |
| |
QC162639 | Cefprozil Impurity 13 CAS# NA M.F.: C36H36N6O9S2 M.W.: 760.84 |
| |
QM140437 | Metronidazole Nitroso Impurity 5 CAS# NA M.F.: C4H5N3O M.W.: 111.10 |
| |
QA120604 | Alfentanil EP Impurity D CAS# NA M.F.: C20H30N6O3 M.W.: 402.49 |
| |
QA120600 | Alfentanil hydrochloride CAS# 69049-06-5 M.F.: C21H33ClN6O3 M.W.: 452.98 |
| |
QC123102 | Clemastine EP Impurity B CAS# NA M.F.: C21H26ClNO M.W.: 343.89 |
| |
QA031228 | Aciclovir Impurity 28 CAS# NA M.F.: C9H13N5O4 M.W.: 255.23 |
| |
QA161854 | Aprepitant Impurity 54 CAS# NA M.F.: C3H6ClN3O2 M.W.: 151.55 |
| |
QP082701 | Pheniramine maleate EP Impurity A CAS# 101-82-6 M.F.: C12H11N M.W.: 169.22 |
| |
QA142001 | Antipyrine Impurity 1;Metamizole sodium EP Impurity A CAS# 1672-58-8 M.F.: C12H13N3O2 M.W.: 231.25 |
| |
QC181504 | Cromolyn Sodium Impurity 4; Sodium Cromoglicate EP Impurity A CAS# 699-83-2 M.F.: C8H8O3 M.W.: 152.15 |
| |
QF120313 | D-Folic Acid CAS# 65165-91-5 M.F.: C19H19N7O6 M.W.: 441.40 |
| |
QT031856 | all-rac-alpha-Tocopherol EP Impurity C CAS# 90510-39-7 M.F.: C30H52O2 M.W.: 444.73 |
| |
QV307758 | Vitamin B6 Impurity 58 CAS# 19203-53-3 M.F.: C16H20N2O5 M.W.: 320.34 |
| |
QV307757 | Vitamin B6 Impurity 57 CAS# 18436-47-0 M.F.: C16H20N2O5 M.W.: 320.34 |
| |
QB180926 | Brivaracetam Impurity Z CAS# 22530-99-0 M.F.: C8H14O2 M.W.: 142.20 |
| |
QP080508 | Phenytoin Sodium impurity 8 CAS# 56079-91-5 M.F.: C15H11N3O4 M.W.: 297.27 |
| |
QP080507 | Phenytoin Sodium impurity 7 CAS# 1189192-83-3 M.F.: C15H10N4O6 M.W.: 342.26 |
| |
QP080506 | Phenytoin Sodium EP Impurity F CAS# 51169-17-6 M.F.: C16H14N2O2 M.W.: 266.29 |
| |
QP080505 | Phenytoin Sodium EP Impurity E CAS# 6802-95-5 M.F.: C15H14N2O3 M.W.: 270.28 |
| |
QP080511 | Phenytoin Sodium impurity 11 CAS# 36898-62-1 M.F.: C14H10N2O6 M.W.: 302.24 |
| |
QP080510 | Phenytoin Sodium impurity 10 CAS# 61693-07-0 M.F.: C14H11NO4 M.W.: 257.24 |
| |
QM041844 | Minodronic Acid Impurity 18 CAS# NA M.F.: C8H6N2O2 M.W.: 162.15 |
| |
QR160731 | Repaglinide Impurity 5 CAS# NA M.F.: C18H24O7 M.W.: 352.38 |
| |
QB050101 | Betaxolol EP Impurity A CAS# 67193-95-7 M.F.: C14H23NO2 M.W.: 237.34 |
| |
QA190212 | Ascorbic Acid Impurity 12 CAS# 3445-22-5 M.F.: C6H8O7 M.W.: 192.12 |
| |
QL091649 | Lipoic Acid Impurity 23 CAS# 940-69-2 M.F.: C8H15NOS2 M.W.: 205.34 |
| |
QM041843 | Minodronic Acid Impurity 17 CAS# NA M.F.: C9H9N2O4P M.W.: 240.15 |
| |
QM041842 | Minodronic Acid Impurity 16 CAS# NA M.F.: C14H12N4O M.W.: 252.27 |
| |
QM041841 | Minodronic Acid Impurity 15 CAS# 4437-06-3 M.F.: C4H4O3 M.W.: 100.07 |
| |
QM041840 | Minodronic Acid Impurity 14 CAS# 653599-20-3 M.F.: C9H8N2O3 M.W.: 192.17 |
| |
QM041839 | Minodronic Acid Impurity 13 CAS# 1507308-67-9 M.F.: C9H7ClN2O2 M.W.: 210.62 |
| |
QM041838 | Minodronic Acid Impurity 12 CAS# NA M.F.: C9H11ClN2O7P2 M.W.: 356.59 |
| |
QL091648 | Lipoic Acid Impurity 22 CAS# 25636-58-2 M.F.: C8H14O2S M.W.: 174.26 |
| |
QM041837 | Minodronic Acid Impurity 11 CAS# 17745-04-9 M.F.: C9H8N2O2 M.W.: 176.17 |
| |
QA130502 | Aminolevulinic Acid Related Compound B CAS# 109258-71-1 M.F.: C14H13NO5 M.W.: 275.26 |
| |
QA130501 | Aminolevulinic Acid Related Compound A CAS# 77479-02-8 M.F.: C10H12N2O4 M.W.: 224.21 |
| |
QA130500 | Aminolevulinic Acid Hydrochloride CAS# 5451-09-2;106-60-5(free base) M.F.: C5H9NO3 HCl M.W.: 131.13 36.46 |
| |
QC051206 | Ceftezole Sodium Impurity 6 CAS# NA M.F.: C12H11N9O4S3 M.W.: 441.47 |
| |
QC051205 | Ceftezole Sodium Impurity 5 CAS# NA M.F.: C13H12N8O4S3 M.W.: 440.48 |
| |
QC051204 | Ceftezole Sodium Impurity 4 CAS# NA M.F.: C13H13N9O3S3 M.W.: 439.50 |
| |
QC051203 | Ceftezole Sodium Impurity 3 CAS# NA M.F.: C13H14N8O5S3 M.W.: 458.50 |
| |
QC051202 | Ceftezole Sodium Impurity 2 CAS# NA M.F.: C13H12N8O4S3 M.W.: 440.48 |
| |
QC051201 | Ceftezole Sodium Impurity 1 CAS# NA M.F.: C13H12N8O5S3 M.W.: 456.48 |
| |
QE120119 | Elagolix Impurity 19 CAS# NA M.F.: C28H21F5N2O4 M.W.: 544.47 |
| |
QE120116 | Elagolix Impurity 16 CAS# NA M.F.: C40H44F5N3O7 M.W.: 773.79 |
| |
QC061910 | Ceftaroline Fosamil Impurity J CAS# NA M.F.: C29H26N2O7S2 M.W.: 578.66 |
| |
QC061909 | Ceftaroline Fosamil Impurity I CAS# NA M.F.: C28H24N2O5S M.W.: 500.57 |
| |
QC061908 | Ceftaroline Fosamil Impurity H CAS# NA M.F.: C16H14N4O3S3 M.W.: 406.50 |
| |
QU190425 | Ursodeoxycholic Acid Impurity 25 CAS# NA M.F.: C24H38O4 M.W.: 390.56 |
| |
QP180437 | Perindopril Impurity 37 CAS# 82864-25-3 M.F.: C11H19NO2 HCl M.W.: 197.27 36.46 |
| |
QT011500 | Tauroursodeoxycholic Acid CAS# 14605-22-2 M.F.: C26H45NO6S M.W.: 499.70 |
| |
QL091647 | Lipoic Acid Impurity 21 CAS# NA M.F.: C9H16O2S2 M.W.: 220.35 |
| |
QL091646 | Lipoic Acid Impurity 20 CAS# NA M.F.: C4H6O2S2 M.W.: 150.22 |
| |
QL091645 | Lipoic Acid Impurity 19 CAS# NA M.F.: C6H10O3S2 M.W.: 194.27 |
| |
QL091644 | Lipoic Acid Impurity 18 CAS# NA M.F.: C6H10O2S2 M.W.: 178.27 |
| |
QL091643 | Lipoic Acid Impurity 17 CAS# NA M.F.: C9H16O2S2 M.W.: 220.35 |
| |
QL091642 | Lipoic Acid Impurity 16 CAS# NA M.F.: C9H16O2S2 M.W.: 220.35 |
| |
QL091641 | Lipoic Acid Impurity 15 CAS# 1071-71-2 M.F.: C8H13ClO3 M.W.: 192.64 |
| |
QA130405 | Amidotrizoic Acid EP Impurity E CAS# NA M.F.: C13H11I3N2O5 M.W.: 655.95 |
| |
QA130404 | Amidotrizoic Acid EP Impurity D CAS# NA M.F.: C11H8I4N2O4 M.W.: 739.81 |
| |
QA130403 | Amidotrizoic Acid EP Impurity C CAS# NA M.F.: C11H10I2N2O4 M.W.: 488.02 |
| |
QA130401 | Amidotrizoic Acid EP Impurity A; Sodium amidotrizoate EP Impurity A CAS# NA M.F.: C9H7I3N2O3 M.W.: 571.88 |
| |
QA130400 | Amidotrizoic Acid CAS# 117-96-4 M.F.: C11H9I3N2O4 M.W.: 613.91 |
| |
QA041601 | Adipic acid EP Impurity A CAS# 110-94-1 M.F.: C5H8O4 M.W.: 132.11 |
| |
QA180228 | Arbidol Impurity 28 CAS# NA M.F.: C20H21BrN2O3S M.W.: 449.36 |
| |
QI091600 | Ipratropium bromide monohydrate CAS# 66985-17-9 M.F.: C20H30BrNO3 H2O M.W.: 412.36 18.02 |
| |
QT181400 | Treprostinil CAS# 81846-19-7;289480-64-4(Na salt) M.F.: C23H34O5 M.W.: 390.51 |
| |
QP072040 | Pioglitazone hydrochloride Impurity 40 CAS# NA M.F.: C19H20N2O2S M.W.: 340.44 |
| |
QN050904 | Netilmicin sulfate EP Impurity D CAS# NA M.F.: C23H45N5O7 M.W.: 503.63 |
| |
QA200345 | Cisatracurium Besylate Impurity 45 CAS# NA M.F.: C65H82N2O18S2 M.W.: 1243.48 |
| |
QH121617 | Haloperidol Impurity 17 CAS# NA M.F.: C31H32ClF2NO3 M.W.: 540.04 |
| |
QA200344 | Atracurium besylate CAS# 64228-81-5 M.F.: C65H82N2O18S2 M.W.: 1243.48 |
| |
QS052003 | Sertaconazole nitrate EP Impurity C CAS# 142181-53-1 M.F.: C9H7ClOS M.W.: 198.67 |
| |
QS052002 | Sertaconazole nitrate EP Impurity B CAS# 17512-61-7 M.F.: C9H6BrClS M.W.: 261.57 |
| |
QC042005 | Cefditoren pivoxil Impurity 5 CAS# NA M.F.: C28H33N7O7S3 M.W.: 675.80 |
| |
QC042004 | Cefditoren pivoxil Impurity 4 CAS# NA M.F.: C25H28N6O7S3 M.W.: 620.72 |
| |
QB050415 | Bedaquiline Fumarate Impurity 15 CAS# 861709-47-9 M.F.: C31H29BrN2O2 M.W.: 541.48 |
| |
QI091623 | Ipratropium Bromide Impurity 23 CAS# NA M.F.: C20H30BrNO3 M.W.: 412.36 |
| |
QI091622 | Ipratropium Bromide Impurity 22 CAS# NA M.F.: C19H27NO3 M.W.: 317.42 |
| |
QZ151205 | Zoledronic acid Impurity 5 CAS# 1334703-07-9 M.F.: C11H17ClN2O4 M.W.: 276.72 |
| |
QZ151204 | Zoledronic acid Impurity 4 CAS# 117255-11-5;805228-36-8(chloride) M.F.: C7H8N2O4 M.W.: 184.15 |
| |
QZ151203 | Zoledronic acid Impurity 3 CAS# 1627731-60-5 M.F.: C7H12N2O9P2 M.W.: 330.13 |
| |
QZ151202 | Zoledronic acid Impurity 2 CAS# NA M.F.: C10H16N4O12P4 M.W.: 508.15 |
| |
QZ151201 | Zoledronic acid Impurity 1; Zoledronic acid EP Impurity B CAS# 1632236-60-2;2043362-88-3(Cl salt) M.F.: C7H17N2O14P4 M.W.: 477.11 |
| |
QN151836 | Noradrenaline (Norepinephrine) Impurity 36 CAS# 50988-14-2 M.F.: C9H11NO3 M.W.: 181.19 |
| |
QN151835 | Noradrenaline (Norepinephrine) Impurity 35 CAS# NA M.F.: C9H13NO4 M.W.: 199.20 |
| |
QN151834 | Noradrenaline (Norepinephrine) Impurity 34 CAS# NA M.F.: C9H13NO4 M.W.: 199.20 |
| |
QN151833 | Noradrenaline (Norepinephrine) Impurity 33 CAS# 21213-89-8 M.F.: C9H11NO2 M.W.: 165.19 |
| |
QN151832 | Noradrenaline (Norepinephrine) Impurity 32 CAS# 554-99-4 M.F.: C10H15NO3 M.W.: 197.23 |
| |
QN151831 | Noradrenaline (Norepinephrine) Impurity 31 CAS# 2947-02-6;74571-90-7(HCl salt) M.F.: C10H15NO3 M.W.: 197.23 |
| |
QN151830 | Noradrenaline (Norepinephrine) Impurity 30 CAS# NA M.F.: C17H21NO6 M.W.: 335.35 |
| |
QN151829 | Noradrenaline (Norepinephrine) Impurity 29 CAS# NA M.F.: C17H17NO6 M.W.: 331.32 |
| |
QN151828 | Noradrenaline (Norepinephrine) Impurity 28 CAS# 150-05-0 M.F.: C9H13NO3 M.W.: 183.20 |
| |
QN151827 | Noradrenaline (Norepinephrine) Impurity 27 CAS# 1197-09-7 M.F.: C8H8O3 M.W.: 152.15 |
| |
QN151826 | Noradrenaline (Norepinephrine) Impurity 26 CAS# 373360-12-4 M.F.: C8H11NO3 M.W.: 169.18 |
| |
QN151825 | Noradrenaline (Norepinephrine) Impurity 25 CAS# 73660-93-2 M.F.: C8H11NO3 M.W.: 169.18 |
| |
QN151824 | Noradrenaline (Norepinephrine) Impurity 24 CAS# 1891319-98-4 M.F.: C8H9NO3 M.W.: 167.16 |
| |
QN151823 | Noradrenaline (Norepinephrine) Impurity 23 CAS# NA M.F.: C8H9NO4 M.W.: 183.16 |
| |
QN151822 | Noradrenaline (Norepinephrine) Impurity 22 CAS# NA M.F.: C8H6Cl2O3 M.W.: 221.04 |
| |
QN151821 | Noradrenaline (Norepinephrine) Impurity 21 CAS# 29477-54-1 M.F.: C8H8O4 M.W.: 168.15 |
| |
QN151820 | Noradrenaline (Norepinephrine) Impurity 20 CAS# 408328-15-4 M.F.: C8H8O4 M.W.: 168.15 |
| |
QN151819 | Noradrenaline (Norepinephrine) Impurity 19 CAS# 60912-82-5 M.F.: C8H7ClO3 M.W.: 186.59 |
| |
QN151818 | Noradrenaline (Norepinephrine) Impurity 18 CAS# 490-90-4 M.F.: C8H5NO3 M.W.: 163.13 |
| |
QN151817 | Noradrenaline (Norepinephrine) Impurity 17 CAS# 490-89-1 M.F.: C8H7NO3 M.W.: 165.15 |
| |
QN151816 | Noradrenaline (Norepinephrine) Impurity 16 CAS# 3198-07-0(HCl salt) M.F.: C10H15NO3 M.W.: 197.23 |
| |
QN151815 | Noradrenaline (Norepinephrine) Impurity 15 CAS# 132261-26-8 M.F.: C8H12N2O2 M.W.: 168.19 |
| |
QN151814 | Noradrenaline (Norepinephrine) Impurity 14 CAS# 3805-00-3(HCl salt) M.F.: C10H15NO3 M.W.: 197.23 |
| |
QN151813 | Noradrenaline (Norepinephrine) Impurity 13 CAS# 5530-29-0 M.F.: C8H9ClO3 M.W.: 188.61 |
| |
QN151812 | Noradrenaline (Norepinephrine) Impurity 12 CAS# 28822-73-3 M.F.: C8H10O4 M.W.: 170.16 |
| |
QN151811 | Noradrenaline (Norepinephrine) Impurity 11 CAS# NA M.F.: C16H19NO6 M.W.: 321.33 |
| |
QN151809 | Noradrenaline (Norepinephrine) Impurity 9 CAS# 872266-28-9 M.F.: C16H15NO6 M.W.: 317.29 |
| |
QG122109 | Glucaric acid CAS# 87-73-0;5793-89-5(Calcium salt tetrahydrate) M.F.: C6H10O8 M.W.: 210.14 |
| |
QM050501 | Methylene violet CAS# 2516-05-4 M.F.: C14H12N2OS M.W.: 256.32 |
| |
QC071209 | Carglumic Acid Impurity 9 CAS# NA M.F.: C6H8N2O4 M.W.: 172.14 |
| |
QC071208 | Carglumic Acid Impurity 8 CAS# 5624-26-0 M.F.: C6H8N2O4 M.W.: 172.14 |
| |
QC071207 | Carglumic Acid Impurity 7 CAS# 17027-50-8 M.F.: C6H8N2O4 M.W.: 172.14 |
| |
QC071206 | Carglumic Acid Impurity 6 CAS# 2380660-24-0 M.F.: C6H8N2O4 M.W.: 172.14 |
| |
QA032104 | Aclidinium bromide Impurity 4 CAS# NA M.F.: C26H30BrNO4S2 M.W.: 564.55 |
| |
QP132613 | Promethazine Impurity 13 CAS# 1207-71-2 M.F.: C12H9NOS M.W.: 215.27 |
| |
QM201244 | Montelukast Impurity 18 CAS# 1152185-58-4 M.F.: C35H36ClNO4S M.W.: 602.18 |
| |
QA200343 | Atracurium Besylate Impurity 43 CAS# 91950-41-3 M.F.: C10H14O3S M.W.: 214.28 |
| |
QA040638 | Adefovir Impurity 12 CAS# NA M.F.: C32H52N5O18P M.W.: 825.75 |
| |
QM131925 | Mometasone Furoate Impurity 25 CAS# 134429-33-7 M.F.: C27H30Cl2O7 M.W.: 537.43 |
| |
QM131924 | Mometasone Furoate Impurity 24 CAS# 1404070-67-2 M.F.: C26H28Cl2O6 M.W.: 507.40 |
| |
QM131923 | Mometasone Furoate Impurity 23 CAS# NA M.F.: C28H32Cl2O6 M.W.: 535.46 |
| |
QM131922 | Mometasone Furoate Impurity 22 CAS# NA M.F.: C27H28Cl2O6 M.W.: 519.41 |
| |
QM131921 | Mometasone Furoate Impurity 21 CAS# NA M.F.: C26H29ClO7 M.W.: 488.96 |
| |
QM131920 | Mometasone Furoate EP Impurity T CAS# NA M.F.: C27H29Cl3O6 M.W.: 555.87 |
| |
QM131918 | Mometasone Furoate EP Impurity R CAS# 1370190-08-1 M.F.: C28H33ClO9S M.W.: 581.07 |
| |
QM131917 | Mometasone Furoate EP Impurity Q CAS# 83881-08-7 M.F.: C22H27ClO4 M.W.: 390.90 |
| |
QM131916 | Mometasone Furoate EP Impurity P CAS# NA M.F.: C27H31ClO7 M.W.: 502.98 |
| |
QM131915 | Mometasone Furoate EP Impurity O CAS# 24916-91-4 M.F.: C24H31ClO6 M.W.: 450.95 |
| |
QM131913 | Mometasone Furoate EP Impurity M CAS# 57780-86-6 M.F.: C22H29ClO4 M.W.: 392.92 |
| |
QM131910 | Mometasone Furoate EP Impurity J CAS# NA M.F.: C28H32Cl2O6 M.W.: 535.46 |
| |
QK161827 | Kyprolis Impurity 27 CAS# NA M.F.: C37H47N3O6 M.W.: 629.79 |
| |
QA032103 | Aclidinium bromide Impurity 3 CAS# 320346-75-6 M.F.: C25H28BrNO4S2 M.W.: 550.53 |
| |
QA032102 | Aclidinium bromide Impurity 2 CAS# 1708930-15-7 M.F.: C16H24BrNO2 M.W.: 342.27 |
| |
QA032101 | Aclidinium bromide Impurity 1 CAS# 588-63-6 M.F.: C9H11BrO M.W.: 215.09 |
| |
QA032100 | Aclidinium bromide CAS# 320345-99-1 M.F.: C26H30BrNO4S2 M.W.: 564.55 |
| |
QL010317 | Memantine Lactose Adduct CAS# 1159637-28-1 M.F.: C24H41NO10 M.W.: 503.58 |
| |
QC022000 | Cabazitaxel CAS# 183133-96-2;1426815-65-7(acetone) M.F.: C45H57NO14 M.W.: 835.93 |
| |
QC071205 | Carglumic Acid Impurity 5 CAS# 1009553-88-1 M.F.: C6H8N2O4 M.W.: 172.14 |
| |
QI091621 | Ipratropium Bromide Impurity 21 CAS# NA M.F.: C19H27NO3 M.W.: 317.42 |
| |
QV200101 | Vitamin A EP Impurity A CAS# NA M.F.: C40H60O2/C44H64O4 M.W.: 572.90/ 656.98 |
| |
QV200103 | Vitamin A EP Impurity C CAS# 16729-22-9 M.F.: C20H30O M.W.: 286.45 |
| |
QV200102 | Vitamin A EP Impurity B CAS# 144407-18-1 M.F.: C20H28 M.W.: 268.44 |
| |
QT182702 | Tramadol EP Impurity B CAS# 66170-32-9(HCl salt) M.F.: C16H23NO M.W.: 245.36 |
| |
QF122414 | Fluoxetine Impurity 14 CAS# NA M.F.: C39H58F3NO5 M.W.: 677.88 |
| |
QF120312 | Folic Acid EP Impurity H CAS# 2366274-27-1 M.F.: C31H31N9O10 M.W.: 689.63 |
| |
QF120311 | Folic Acid EP Impurity G CAS# 2734707-85-6 M.F.: C19H19N7O6 M.W.: 441.40 |
| |
QG121800 | Glycyrrhizic Acid CAS# 1405-86-3 M.F.: C42H62O16 M.W.: 822.93 |
| |
QC030354 | Cinacalcet Impurity 54 CAS# 3751-48-2 M.F.: C10H12O2 M.W.: 164.20 |
| |
QL091640 | Lipoic Acid Impurity 14 CAS# NA M.F.: C8H14O3S2 M.W.: 222.32 |
| |
QL091639 | Lipoic Acid Impurity 13 CAS# 41443-60-1 M.F.: C8H14Cl2O2 M.W.: 213.10 |
| |
QT181919 | Torasemide Impurity 19 CAS# 33263-44-4 M.F.: C5H3Cl2NO2S M.W.: 212.05 |
| |
QC-M011202 | Malic acid; Aspartic acid EP Impurity A CAS# 6915-15-7;617-48-1 M.F.: C4H6O5 M.W.: 134.09 |
| |
QU190421 | Ursodeoxycholic Acid Impurity 21 CAS# NA M.F.: C26H44O4 M.W.: 420.63 |
| |
QT070501 | Tigecycline EP Impurity A CAS# 1422262-97-2 M.F.: C29H39N5O8 M.W.: 585.65 |
| |
QL051508 | Calcium Levofolinate EP Impurity H CAS# 73951-54-9 M.F.: C20H23N7O7 M.W.: 473.44 |
| |
QL051507 | Calcium Levofolinate EP Impurity G; Calcium Folinate Hydrate EP Impurity G CAS# 4033-27-6 M.F.: C19H21N7O6 M.W.: 443.41 |
| |
QL051506 | Calcium Levofolinate EP Impurity F; Calcium Folinate Hydrate EP Impurity F CAS# 28459-40-7 M.F.: C20H21N7O7 M.W.: 471.42 |
| |
QL051504 | Calcium Levofolinate EP Impurity D; Calcium Folinate Hydrate EP Impurity D CAS# 134-05-4 M.F.: C20H19N7O7 M.W.: 469.41 |
| |
QL051503 | Calcium Levofolinate EP Impurity C; Calcium Folinate Hydrate EP Impurity C; Folic acid CAS# 59-30-3 M.F.: C19H19N7O6 M.W.: 441.40 |
| |
QL051502 | Calcium Levofolinate EP Impurity B CAS# NA M.F.: C21H23N7O8 M.W.: 501.45 |
| |
QL051500 | Calcium Levofolinate CAS# 80433-71-2 M.F.: C20H21CaN7O7 M.W.: 511.50 |
| |
QL051515 | Calcium levofolinate Impurity 15 CAS# 26560-38-3;134-35-0 (free base) M.F.: C20H23CaN7O6 M.W.: 497.52 |
| |
QE262041 | Ezetimibe Impurity 41 CAS# 163222-32-0 M.F.: C31H27F2NO3 M.W.: 499.55 |
| |
QL051505 | Calcium levofolinate EP Impurity E CAS# 944737-05-7 M.F.: C15H16N6O4 M.W.: 344.33 |
| |
QF122908 | Fluocinolone acetonide EP Impurity H; Triamcinolone acetonide CAS# 76-25-5 M.F.: C24H31FO6 M.W.: 434.50 |
| |
QL091638 | Lipoic Acid Impurity 12 CAS# 2114407-78-0 M.F.: C8H14O3S2 M.W.: 222.32 |
| |
QL091637 | Lipoic Acid Impurity 11 CAS# NA M.F.: C8H14O3S2 M.W.: 222.32 |
| |
QL091636 | Lipoic Acid Impurity 10 CAS# NA M.F.: C8H14O3S2 M.W.: 222.32 |
| |
QL091635 | Lipoic Acid Impurity 9 CAS# NA M.F.: C8H14O3S2 M.W.: 222.32 |
| |
QV011228 | 4-Hydroxy Valproic Acid Sodium Salt CAS# 1216888-06-0 M.F.: C8H15NaO3 M.W.: 182.19 |
| |
QS210300 | Sucrose CAS# 57-50-1 M.F.: C12H22O11 M.W.: 342.30 |
| |
QD061807 | Deferasirox Impurity 7 CAS# 1395346-29-8 M.F.: C23H17N3O6 M.W.: 431.40 |
| |
QO132066 | Olmesartan Impurity 66 CAS# NA M.F.: C45H44N6O3 M.W.: 716.87 |
| |
QT090306 | Thioctic Acid Impurity 6 CAS# NA M.F.: C8H14O2S3 M.W.: 238.39 |
| |
QT090305 | Thioctic Acid EP Impurity B CAS# NA M.F.: H2O[C8H14OS2]n M.W.: 18.02[190.33]n |
| |
QW011803 | Warfarin sodium EP Impurity C CAS# 1896-62-4 M.F.: C10H10O M.W.: 146.19 |
| |
QW011800 | Warfarin sodium CAS# 129-06-6;81-81-2(free base) M.F.: C19H15NaO4 M.W.: 330.31 |
| |
QA180603 | ArforMoterol Tartrate Impurity 3 CAS# 477552-94-6 M.F.: C9H11NO3 M.W.: 181.19 |
| |
QO240110 | Oxacillin sodium monohydrate EP Impurity J; Ozolamide of 6-APA dimer CAS# NA M.F.: C27H31N5O8S2 M.W.: 617.69 |
| |
QO240109 | Oxacillin sodium monohydrate EP Impurity I CAS# NA M.F.: C27H29N5O7S2 M.W.: 599.68 |
| |
QO240107 | Oxacillin sodium monohydrate EP Impurity G CAS# NA M.F.: C19H18ClN3O5S M.W.: 435.88 |
| |
QO240106 | Oxacillin sodium monohydrate EP Impurity F CAS# 5053-35-0 M.F.: C19H19N3O4S2 M.W.: 417.50 |
| |
QO240105 | Oxacillin sodium monohydrate EP Impurity E; Cloxacillin CAS# 61-72-3;7081-44-9(Na salt monohydrate) M.F.: C19H18ClN3O5S M.W.: 435.88 |
| |
QO240103 | Oxacillin sodium monohydrate EP Impurity C CAS# 1136-45-4 M.F.: C11H9NO3 M.W.: 203.19 |
| |
QF120310 | Folic Acid Impurity 10; Calcium levofolinate EP Impurity I CAS# 31690-11-6 M.F.: C20H23N7O6 M.W.: 457.44 |
| |
QF120309 | Folic Acid EP Impurity G CAS# 2734707-85-6 M.F.: C19H19N7O6 M.W.: 441.40 |
| |
QF061311 | Fosfomycin Trometamol Impurity 11 CAS# 26017-03-8 M.F.: C3H7O4P M.W.: 138.06 |
| |
QF061310 | Fosfomycin Trometamol Impurity 10 CAS# 45629-00-3 M.F.: C3H7O4P M.W.: 138.06 |
| |
QF061304 | Fosfomycin Trometamol EP Impurity D CAS# 1262243-12-8 M.F.: C10H25NO11P2 M.W.: 397.25 |
| |
QF061303 | Fosfomycin Trometamol EP Impurity C CAS# 23001-39-0;114252-50-5(Barium Salt) M.F.: C4H12NO6P M.W.: 201.11 |
| |
QF061302 | Fosfomycin Trometamol EP Impurity B CAS# 1262243-11-7 M.F.: C7H18NO7P M.W.: 259.19 |
| |
QF061301 | Fosfomycin Trometamol EP Impurity A CAS# 84954-80-3 M.F.: C3H9O5P M.W.: 156.07 |
| |
QM051500 | Methocarbamol CAS# 532-03-6 M.F.: C11H15NO5 M.W.: 241.24 |
| |
QD150305 | Docusate sodium Impurity 5 CAS# NA M.F.: C14H25NaO7S M.W.: 360.40 |
| |
QD150304 | Docusate sodium Impurity 4 CAS# NA M.F.: C14H25NaO7S M.W.: 360.40 |
| |
QD150303 | Docusate sodium Impurity 3 CAS# 86878-53-7 M.F.: C12H20Na2O7S M.W.: 354.33 |
| |
QD150302 | Docusate sodium Impurity 2 CAS# 115960-17-3 M.F.: C12H21NaO7S M.W.: 332.35 |
| |
QL091634 | Lipoic Acid Impurity 8 CAS# NA M.F.: C20H37NO6S4 C4H11NO3 M.W.: 515.77 121.14 |
| |
QH251200 | Hyocholic acid CAS# 547-75-1 M.F.: C24H40O5 M.W.: 408.57 |
| |
QC-S210301 | succinic acid; Adipic acid EP Impurity B; Aspartic acid EP Impurity E CAS# 110-15-6 M.F.: C4H6O4 M.W.: 118.09 |
| |
QM160284 | Moxifloxacin Impurity 84 CAS# NA M.F.: C21H24FN3O7 M.W.: 449.43 |
| |
QC-P160500 | Pteroic acid CAS# 119-24-4 M.F.: C14H12N6O3 M.W.: 312.28 |
| |
QT031853 | α-Tocopherol; all-rac-α-Tocopherol CAS# 10191-41-0 M.F.: C29H50O2 M.W.: 430.71 |
| |
QP082500 | Vitamin K1 (Phytonadione) CAS# 84-80-0 M.F.: C31H46O2 M.W.: 450.70 |
| |
QT131204 | Timolol Maleate EP Impurity D CAS# 30165-97-0 M.F.: C6H9N3O2S M.W.: 187.22 |
| |
QF120308 | 10-Formyl-7,8-dihydro Folic Acid Disodium Salt CAS# 28459-40-7(free base) M.F.: C20H19N7Na2O7 M.W.: 515.39 |
| |
QF120307 | Folic Acid Impurity 7 CAS# NA M.F.: C31H31N9O10 M.W.: 689.63 |
| |
QC-A180701 | L-Arginine; Lysine acetate EP Impurity F CAS# 74-79-3;1119-34-2(HCl salt) M.F.: C6H14N4O2 M.W.: 174.20 |
| |
QE201208 | Estriol EP Impurity H; 16alpha-Hydroxyestrone CAS# 566-76-7 M.F.: C18H22O3 M.W.: 286.37 |
| |
QL091633 | Lipoic Acid Impurity 7 CAS# NA M.F.: C16H28O6S4 M.W.: 444.65 |
| |
QV011201 | Valproic Acid Ethyl Ester CAS# 17022-31-0 M.F.: C10H20O2 M.W.: 172.26 |
| |
QD032012 | Docetaxel Impurity 12 CAS# 151636-78-1 M.F.: C49H55Cl6NO18 M.W.: 1158.67 |
| |
QT142409 | Tranexamic Acid Impurity 9 CAS# 70795-45-8 M.F.: C8H18N2 M.W.: 142.24 |
| |
QT142408 | Tranexamic Acid Impurity 8 CAS# NA M.F.: C9H17NO2 M.W.: 171.24 |
| |
QT142407 | Tranexamic Acid EP Impurity E CAS# 82755-59-7 M.F.: C16H28N2O3 M.W.: 296.41 |
| |
QT142406 | Tranexamic Acid Impurity 6 CAS# 13064-83-0 M.F.: C8H14O2 M.W.: 142.20 |
| |
QC-A080301 | D-Glucose;Trehalose dihydrate EP Impurity A CAS# 50-99-7;5996-10-1(monohydrate) M.F.: C6H12O6 M.W.: 180.16 |
| |
QP050400 | Peonidin Chloride CAS# 134-01-0 M.F.: C16H13ClO6 M.W.: 336.72 |
| |
QI020101 | Ibandronic acid Impurity 1 CAS# 128202-57-3(free base) M.F.: C4H12NNaO7P2 M.W.: 271.08 |
| |
QT090304 | (R)-alpha-Thioctic Acid CAS# 1200-22-2 M.F.: C8H14O2S2 M.W.: 206.33 |
| |
QM050605 | Mefenamic Acid EP Impurity E CAS# 4869-11-8 M.F.: C14H15N M.W.: 197.28 |
| |
QM050602 | Mefenamic Acid EP Impurity B CAS# 21122-68-9 M.F.: C23H24N2O M.W.: 344.45 |
| |
QM050601 | Mefenamic Acid EP Impurity A CAS# 87-59-2 M.F.: C8H11N M.W.: 121.18 |
| |
QM050600 | Mefenamic Acid CAS# 61-68-7 M.F.: C15H15NO2 M.W.: 241.29 |
| |
QF211900 | Fusidic Acid CAS# 6990-06-3 M.F.: C31H48O6 M.W.: 516.71 |
| |
QD190640 | Doxofylline Impurity 14 CAS# NA M.F.: C13H20N4O6 M.W.: 328.32 |
| |
QM011412 | Mandelic acid 12 CAS# 51019-43-3 M.F.: C10H10O4 M.W.: 194.18 |
| |
QM011411 | Mandelic acid 11 CAS# 29169-64-0 M.F.: C9H7ClO3 M.W.: 198.60 |
| |
QM011410 | Mandelic acid 10 CAS# 29169-63-9 M.F.: C9H8O4 M.W.: 180.16 |
| |
QP011406 | DL-Pantothenic acid calcium salt CAS# 6381-63-1 M.F.: C18H32CaN2O10 M.W.: 476.53 |
| |
QC-D091307 | Calcium Pantothenate EP Impurity B; Dexpanthenol EP Impurity B; Pantoic acid CAS# 1112-33-0;60979-68-2(Na salt) M.F.: C6H12O4 M.W.: 148.16 |
| |
QP051401 | Pentaerythritol tetrakis(3-(3,5-di-tert-butyl-4-hydroxyphenyl)propionate) CAS# 6683-19-8 M.F.: C73H108O12 M.W.: 1177.63 |
| |
QE120100 | Elagolix Sodium CAS# 832720-36-2 M.F.: C32H29F5N3NaO5 M.W.: 653.57 |
| |
QZ151200 | Zoledronic acid hydrate CAS# 165800-06-6;118072-93-8(free base) M.F.: C5H12N2O8P2 M.W.: 290.10 |
| |
QS151800 | Sorbitan Monolaurate CAS# 1338-39-2 M.F.: C18H34O6 M.W.: 346.46 |
| |
QF161401 | Hydroxy-Fipronil CAS# NA M.F.: C11H5Cl2F3N4O M.W.: 337.08 |
| |
QA161907 | Acetylsalicylic Acid Impurity 7 CAS# 2708578-72-5 M.F.: C16H12O6 M.W.: 300.26 |
| |
QC551804 | Clenbuterol EP Impurity D CAS# 99-92-3 M.F.: C8H9NO M.W.: 135.16 |
| |
QC062804 | Cefetamet Pivoxyl Impurity 4 CAS# NA M.F.: C41H50N10O14S4 M.W.: 1035.15 |
| |
QC062803 | Cefetamet Pivoxyl Impurity 3 CAS# NA M.F.: C25H33N5O8S2 M.W.: 595.69 |
| |
QC062802 | Cefetamet Pivoxyl Impurity 2 CAS# NA M.F.: C20H25N5O7S2 M.W.: 511.57 |
| |
QC062801 | Cefetamet Pivoxyl Impurity 1 CAS# NA M.F.: C21H27N5O8S2 M.W.: 541.60 |
| |
QF121200 | Flucloxacillin sodium CAS# 1847-24-1 M.F.: C19H16ClFN3NaO5S M.W.: 475.85 |
| |
QF121205 | Flucloxacillin sodium EP Impurity E CAS# NA M.F.: C27H27ClFN5O7S2 M.W.: 652.11 |
| |
QF121204 | Flucloxacillin sodium EP Impurity D CAS# 3919-74-2 M.F.: C11H7ClFNO3 M.W.: 255.63 |
| |
QF121202 | Flucloxacillin sodium EP Impurity B CAS# NA M.F.: C18H19ClFN3O4S M.W.: 427.88 |
| |
QF121201 | Flucloxacillin sodium EP Impurity A CAS# 68728-50-7(2Na salt) M.F.: C19H19ClFN3O6S M.W.: 471.89 |
| |
QT150900 | Tropicamide CAS# 1508-75-4 M.F.: C17H20N2O2 M.W.: 284.35 |
| |
QA201500 | Atovaquone CAS# 95233-18-4 M.F.: C22H19ClO3 M.W.: 366.84 |
| |
QE161236 | Epalrestat Impurity 10 CAS# NA M.F.: C17H17NO3S2 M.W.: 347.45 |
| |
QC071200 | Carglumic Acid CAS# 1188-38-1 M.F.: C6H10N2O5 M.W.: 190.15 |
| |
QT140405 | Tinidazole Impurity 5 CAS# 110-77-0 M.F.: C4H10OS M.W.: 106.19 |
| |
QF211904 | Fusidic Acid EP Impurity D; Sodium Fusidate EP Impurity D CAS# NA M.F.: C31H48O7 M.W.: 532.71 |
| |
QF211903 | Fusidic Acid EP Impurity C; Sodium Fusidate EP Impurity C CAS# NA M.F.: C31H48O7 M.W.: 532.71 |
| |
QF211902 | Fusidic Acid EP Impurity B; Sodium Fusidate EP Impurity B CAS# NA M.F.: C31H48O7 M.W.: 532.71 |
| |
QF211906 | Fusidic Acid EP Impurity F; Sodium Fusidate EP Impurity F CAS# NA M.F.: C31H46O7 M.W.: 530.69 |
| |
QF211905 | Fusidic Acid EP Impurity E; Sodium Fusidate EP Impurity E CAS# NA M.F.: C31H48O7 M.W.: 532.71 |
| |
QF211901 | Fusidic Acid EP Impurity A; Sodium Fusidate EP Impurity A CAS# 80445-74-5 M.F.: C31H50O8 M.W.: 550.72 |
| |
QF211911 | Fusidic Acid EP Impurity K; Sodium Fusidate EP Impurity K CAS# 4701-54-6 M.F.: C29H44O4 M.W.: 456.66 |
| |
QF211910 | Fusidic Acid EP Impurity J; Sodium Fusidate EP Impurity J CAS# 13011-12-6 M.F.: C29H44O4 M.W.: 456.66 |
| |
QF211915 | Fusidic Acid EP Impurity O; Sodium Fusidate EP Impurity O CAS# 55601-53-1(Na salt) M.F.: C29H46O5 M.W.: 474.67 |
| |
QF211913 | Fusidic Acid EP Impurity M; Sodium Fusidate EP Impurity M CAS# 1013937-16-0 M.F.: C31H48O5 M.W.: 500.71 |
| |
QF211912 | Fusidic Acid EP Impurity L; Sodium Fusidate EP Impurity L CAS# 74048-41-2 M.F.: C31H46O5 M.W.: 498.69 |
| |
QF211909 | Fusidic Acid EP Impurity I; Sodium Fusidate EP Impurity I; 16-epi-Deacetylfusidic acid CAS# 5951-83-7 M.F.: C29H46O5 M.W.: 474.67 |
| |
QF211908 | Fusidic Acid EP Impurity H; Sodium Fusidate EP Impurity H CAS# 16711-91-4 M.F.: C31H46O6 M.W.: 514.69 |
| |
QF211907 | Fusidic Acid EP Impurity G; Sodium Fusidate EP Impurity G CAS# 4680-37-9 M.F.: C31H46O6 M.W.: 514.69 |
| |
QE182012 | Erythromycin EP Impurity L;3″-N-demethyl-3″-N-formyl Erythromycin A CAS# 127955-44-6 M.F.: C37H65NO14 M.W.: 747.91 |
| |
QS075425 | Mono-ethyl-ester-Sugammadex CAS# NA M.F.: C74H109Na7O48S8 M.W.: 2184.08 |
| |
QL091632 | Lipoic Acid Impurity 6 CAS# NA M.F.: C8H14O4S2 M.W.: 238.32 |
| |
QE202512 | Estradiol Hemihydrate EP Impurity B; Ethinylestradiol EP Impurity L; Estriol EP Impurity J CAS# 57-91-0 M.F.: C18H24O2 M.W.: 272.38 |
| |
QD090530 | Dienogest 17-Epi Impurity CAS# NA M.F.: C20H25NO2 M.W.: 311.42 |
| |
QA221805 | Alverine Citrate EP Impurity E CAS# NA M.F.: C27H33N M.W.: 371.56 |
| |
QA221804 | Alverine Citrate EP Impurity D CAS# NA M.F.: C20H33N M.W.: 287.48 |
| |
QA221803 | Alverine Citrate EP Impurity C CAS# NA M.F.: C11H17N M.W.: 163.26 |
| |
QA221802 | Alverine Citrate EP Impurity B CAS# 122-97-4 M.F.: C9H12O M.W.: 136.19 |
| |
QA221801 | Alverine Citrate EP Impurity A CAS# NA M.F.: C9H11Cl M.W.: 154.64 |
| |
QA190208 | Ascorbic Acid EP Impurity H; Sodium Ascorbate EP Impurity H CAS# 122046-79-1 M.F.: C7H8O7 M.W.: 204.13 |
| |
QA190207 | Ascorbic Acid EP Impurity G; Sodium Ascorbate EP Impurity G CAS# 66757-69-5 M.F.: C6H6O7 M.W.: 190.11 |
| |
QA190204 | Ascorbic Acid EP Impurity D; Sodium Ascorbate EP Impurity D CAS# 3031-98-9 M.F.: C7H12O7 M.W.: 208.17 |
| |
QA190203 | Ascorbic Acid EP Impurity C; Sodium Ascorbate EP Impurity C CAS# 526-98-7 M.F.: C6H10O7 M.W.: 194.14 |
| |
QA190200 | Ascorbic Acid CAS# 50-81-7 M.F.: C6H8O6 M.W.: 176.12 |
| |
QA161900 | Acetylsalicylic Acid CAS# 50-78-2 M.F.: C9H8O4 M.W.: 180.16 |
| |
QB200108 | Betamethasone Dipropionate EP Impurity H CAS# 2575516-37-7 M.F.: C28H36BrFO7 M.W.: 583.48 |
| |
QB200107 | Betamethasone Dipropionate EP Impurity G CAS# 1186048-33-8 M.F.: C31H41FO8 M.W.: 560.65 |
| |
QB200106 | Betamethasone Dipropionate EP Impurity F; Beclometasone Dipropionate EP Impurity J CAS# 66917-44-0 M.F.: C28H36O7 M.W.: 484.58 |
| |
QB200105 | Betamethasone Dipropionate EP Impurity E; Beclometasone Dipropionate CAS# 5534-09-8 M.F.: C28H37ClO7 M.W.: 521.04 |
| |
QB200104 | Betamethasone Dipropionate EP Impurity D CAS# 5514-81-8 M.F.: C27H35FO7 M.W.: 490.56 |
| |
QB200103 | Betamethasone Dipropionate EP Impurity C; Clobetasol Propionate EP Impurity K; Betamethasone 21-propionate CAS# 75883-07-7 M.F.: C25H33FO6 M.W.: 448.52 |
| |
QB200101 | Betamethasone Dipropionate EP Impurity A; Dexamethasone EP Impurity B; Betamethasone Acetate EP Impurity A; Betamethasone valerate EP Impurity A; Betamethasone CAS# 378-44-9 M.F.: C22H29FO5 M.W.: 392.46 |
| |
QI121604 | Iloperidone Impurity 4 CAS# NA M.F.: C12H14Cl2FNO M.W.: 278.15 |
| |
QS160904 | Spironolactone EP Impurity D CAS# NA M.F.: C24H32O4S2 M.W.: 448.64 |
| |
QT120842 | Trelagliptin Impurity 16 CAS# 1485536-93-3 M.F.: C8H4Br2FN M.W.: 292.93 |
| |
QG031906 | Glucosamine Impurity 6; Ascorbic Acid EP Impurity A;Sodium Ascorbate EP Impurity A CAS# 98-01-1 M.F.: C5H4O2 M.W.: 96.08 |
| |
QR182424 | Brexpiprazole Impurity 24 CAS# 98327-87-8 M.F.: C44H32P2 M.W.: 622.67 |
| |
QC015905 | Cladribine EP Impurity E CAS# NA M.F.: C5H10O4 M.W.: 134.13 |
| |
QL131101 | Malic Acid Impurity 1 CAS# 1800467-68-8 M.F.: C8H10O9 M.W.: 250.16 |
| |
QF121403 | Flunarizine EP Impurity C CAS# 90830-31-2 M.F.: C26H26F2N2 M.W.: 404.49 |
| |
QP011405 | Calcium Pantothenate EP Impurity H CAS# NA M.F.: C10H17NO5 M.W.: 231.25 |
| |
QP011404 | Calcium Pantothenate EP Impurity G CAS# 2140-53-6 M.F.: C6H12N2O3 M.W.: 160.17 |
| |
QP011403 | Calcium Pantothenate EP Impurity F CAS# 505-47-5 M.F.: C6H11NO4 M.W.: 161.16 |
| |
QP011402 | Calcium Pantothenate EP Impurity E CAS# 897045-90-8 M.F.: C12H22N2O6 M.W.: 290.31 |
| |
QP011401 | Calcium Pantothenate EP Impurity D;Methyl Pantothenate CAS# 50692-78-9 M.F.: C10H19NO5 M.W.: 233.26 |
| |
QA181625 | Aripiprazole Impurity 25 CAS# 710339-49-4 M.F.: C12H16BrNO M.W.: 270.17 |
| |
QT181501 | Trospium EP Impurity A CAS# 76-93-7 M.F.: C14H12O3 M.W.: 228.24 |
| |
QC-E200808 | ethyl 4-hydroxybenzoate; Propyl Parahydroxybenzoate EP Impurity C; Butyl parahydroxybenzoate EP Impurity C CAS# 120-47-8 M.F.: C9H10O3 M.W.: 166.17 |
| |
QC-M052004 | methyl 4-hydroxybenzoate; Propyl Parahydroxybenzoate EP Impurity B; Nifuroxazide EP Impurity B; Sodium ethyl parahydroxybenzoate EP Impurity B; Butyl parahydroxybenzoate EP Impurity B CAS# 99-76-3 M.F.: C8H8O3 M.W.: 152.15 |
| |
QE191307 | Esmolol Isopropyl Amide Analog HCl CAS# NA M.F.: C18H28N2O3.HCl M.W.: 320.43 36.46 |
| |
QE191306 | N-Ethyl Esmolol HCl CAS# 2469273-97-8(free base) M.F.: C15H23NO4.HCl M.W.: 281.35 36.46 |
| |
QE191305 | Esmolol Acid HCl CAS# 83356-60-9 M.F.: C15H23NO4.HCl M.W.: 281.35 36.46 |
| |
QF121902 | Fulvestrant Impurity 2 CAS# NA M.F.: C32H47F5O2S M.W.: 590.77 |
| |
QT081811 | N-Carbobenzoxy-D-threonine CAS# 80384-27-6 M.F.: C12H15NO5 M.W.: 253.25 |
| |
QF191413 | Fosinopril EP Impurity N CAS# NA M.F.: C41H63N2O8P M.W.: 742.92 |
| |
QF191410 | Fosinopril EP Impurity B CAS# NA M.F.: C30H46NO7P M.W.: 563.66 |
| |
QF191409 | Fosinopril EP Impurity H CAS# NA M.F.: C30H46NO7P M.W.: 563.66 |
| |
QA220327 | Avibactam Impurity 1 CAS# 2306254-34-0;2413365-40-7(oxalate salt) M.F.: C15H22N2O3 M.W.: 278.35 |
| |
QH151600 | Homopiperazine CAS# 505-66-8 M.F.: C5H12N2 M.W.: 100.16 |
| |
QF120306 | Folic Acid EP Impurity F CAS# 1391194-56-1 M.F.: C7H6ClN5O M.W.: 211.61 |
| |
QF120302 | Folic Acid EP Impurity B CAS# 1004-75-7;35011-47-3(H2SO4 salt) M.F.: C4H7N5O M.W.: 141.13 |
| |
QP251800 | Pyrazolam CAS# 39243-02-2 M.F.: C16H12BrN5 M.W.: 354.20 |
| |
QF141929 | Finasteride Impurity 3 CAS# NA M.F.: C23H36N2O2 M.W.: 372.54 |
| |
QC242015 | Cefoxitin Impurity 15 CAS# NA M.F.: C16H16N3NaO8S2 M.W.: 465.43 |
| |
QD090508 | Dienogest EP Impurity H CAS# 16669-06-0 M.F.: C20H25NO2 M.W.: 311.42 |
| |
QD090505 | Dienogest EP Impurity E CAS# 102193-41-9 M.F.: C22H31NO3 M.W.: 357.49 |
| |
QD090504 | Dienogest EP Impurity D CAS# 190662-30-7 M.F.: C22H29NO3 M.W.: 355.47 |
| |
QD090503 | Dienogest EP Impurity C CAS# 106111-42-6 M.F.: C20H25NO2 M.W.: 311.42 |
| |
QI151612 | Iopamidol EPImpurity F CAS# 1869069-71-5 M.F.: C16H20I3N3O6 M.W.: 731.06 |
| |
QI151601 | Iopamidol EP Impurity A CAS# 60166-98-5 M.F.: C14H18I3N3O6 M.W.: 705.02 |
| |
QK201820 | Ketorolac EP Impurity H CAS# 80965-09-9 M.F.: C16H15NO3 M.W.: 269.30 |
| |
QL141249 | Lenalidomide Impurity 49 CAS# 827026-44-8 M.F.: C13H14N4O5 M.W.: 306.27 |
| |
QN032011 | Nicotinic acid Impurity 11 CAS# 33545-23-2 M.F.: C9H11NO2 M.W.: 165.19 |
| |
QL130601 | Lamivudine EP Impurity A CAS# NA M.F.: C8H9N3O4S M.W.: 243.24 |
| |
QM202413 | Methotrexate EP Impurity K; Folic Acid EP Impurity A; Calcium Levofolinate EP Impurity A; Calcium Folinate Hydrate EP Impurity A CAS# 4271-30-1 M.F.: C12H14N2O5 M.W.: 266.25 |
| |
QM202410 | Methotrexate CAS# 59-05-2 M.F.: C20H22N8O5 M.W.: 454.44 |
| |
QN032010 | Nicotinic acid Impurity 10 CAS# 13362-26-0 M.F.: C8H10N2O2 M.W.: 166.18 |
| |
QN032009 | Nicotinic acid EP Impurity I CAS# 940-06-7 M.F.: C5H3N3O4 M.W.: 169.10 |
| |
QN032008 | Nicotinic acid EP Impurity H CAS# 2530-26-9 M.F.: C5H4N2O2 M.W.: 124.10 |
| |
QN032006 | Nicotinic acid EP Impurity F CAS# 2047-49-6 M.F.: C6H4N2O4 M.W.: 168.11 |
| |
QN032004 | Nicotinic acid EP Impurity D CAS# 100-26-5 M.F.: C7H5NO4 M.W.: 167.12 |
| |
QN032003 | Nicotinic acid EP Impurity C CAS# 104-90-5;2024-89-7(HCl salt) M.F.: C8H11N M.W.: 121.18 |
| |
QN032002 | Nicotinic acid EP Impurity B CAS# 1802-30-8 M.F.: C12H8N2O4 M.W.: 244.20 |
| |
QN032001 | Nicotinic acid EP Impurity A CAS# 3222-47-7 M.F.: C7H7NO2 M.W.: 137.14 |
| |
QL091631 | Lipoic Acid Impurity 5 CAS# 17370-41-1 M.F.: C8H14O4S2 M.W.: 238.32 |
| |
QP141200 | Phenylephrine CAS# 59-42-7;61-76-7(HCl salt) M.F.: C9H13NO2 M.W.: 167.21 |
| |
QT161835 | Topiroxostat Impurity 9 CAS# 2044708-04-3 M.F.: C7H10N6O M.W.: 194.19 |
| |
QR131617 | Ramipril EP Impurity N CAS# 129939-63-5 M.F.: C23H32N2O5 M.W.: 416.51 |
| |
QS210209 | Sulbactam Impurity 9;Penicillanic acid CAS# 87-53-6 M.F.: C8H11NO3S M.W.: 201.24 |
| |
QS061900 | Sulfasalazine CAS# 599-79-1 M.F.: C18H14N4O5S M.W.: 398.39 |
| |
QD030422 | Diclofenac Impurity V CAS# NA M.F.: C26H35Cl2NO2 M.W.: 464.47 |
| |
QG121501 | Glycocholic Acid CAS# 475-31-0;863-57-0(Na salt); 338950-81-5(xH2O Na salt) M.F.: C26H43NO6 M.W.: 465.62 |
| |
QS122501 | Silybin A CAS# 22888-70-6 M.F.: C25H22O10 M.W.: 482.44 |
| |
QC120210 | Clobetasol Propionate EP Impurity J CAS# 1486466-31-2 M.F.: C25H30ClFO4 M.W.: 448.95 |
| |
QC120206 | Clobetasol Propionate EP Impurity F CAS# 2412496-00-3 M.F.: C22H27FO4 M.W.: 374.45 |
| |
QC120205 | Clobetasol Propionate EP Impurity E CAS# NA M.F.: C25H33ClO4 M.W.: 432.98 |
| |
QC120204 | Clobetasol Propionate EP Impurity D CAS# 25120-99-4 M.F.: C25H34ClFO5 M.W.: 468.99 |
| |
QC120203 | Clobetasol Propionate EP Impurity C CAS# 25122-52-5 M.F.: C25H32ClFO5 M.W.: 466.97 |
| |
QC120202 | Clobetasol Propionate EP Impurity B CAS# 1356190-17-4 M.F.: C22H26ClFO3 M.W.: 392.89 |
| |
QC120209 | Clobetasol Propionate EP Impurity I CAS# 15423-80-0 M.F.: C26H35FO8S M.W.: 526.61 |
| |
QC120208 | Clobetasol Propionate EP Impurity H CAS# 4351-48-8 M.F.: C25H33FO5 M.W.: 432.52 |
| |
QC120201 | Clobetasol Propionate EP Impurity A; Betamethasone 17-propionate CAS# 5534-13-4 M.F.: C25H33FO6 M.W.: 448.52 |
| |
QC120200 | Clobetasol Propionate CAS# 25122-46-7 M.F.: C25H32ClFO5 M.W.: 466.97 |
| |
QC221213 | Clavulanate Potassium EP Impurity M CAS# 3033-62-3 M.F.: C8H20N2O M.W.: 160.26 |
| |
QC221212 | Clavulanate Potassium EP Impurity L CAS# 4013-94-9 M.F.: C8H20N2 M.W.: 144.26 |
| |
QC221211 | Clavulanate Potassium EP Impurity K CAS# 107-45-9 M.F.: C8H19N M.W.: 129.24 |
| |
QC221215 | Clavulanate Potassium EP Impurity J CAS# 110-18-9;7677-21-6(2HCl salt) M.F.: C6H16N2 M.W.: 116.20 |
| |
QC221208 | Clavulanate Potassium EP Impurity H CAS# 75-64-9 M.F.: C4H11N M.W.: 73.14 |
| |
QU190400 | Ursodeoxycholic Acid;Chenodeoxycholic acid EP Impurity A CAS# 128-13-2 M.F.: C24H40O4 M.W.: 392.57 |
| |
QH120311 | Halcinonide Impurity K CAS# NA M.F.: C21H28ClFO5 M.W.: 414.90 |
| |
QI221205 | Isoniazid Impurity E CAS# 31599-25-4 M.F.: C12H10N6 M.W.: 238.25 |
| |
QI221204 | Isoniazid Impurity D CAS# 4329-75-3 M.F.: C12H10N4O2 M.W.: 242.23 |
| |
QI221202 | Isoniazid EP Impurity D CAS# 553-53-7 M.F.: C6H7N3O M.W.: 137.14 |
| |
QR022221 | Ribavirin Impurity U;Ascorbic Acid EP Impurity E;Sodium Ascorbate EP Impurity E;Oxaliplatin EP Impurity A CAS# 144-62-7 M.F.: C2H2O4 M.W.: 90.03 |
| |
QV011227 | Valproic Acid Impurity 1 CAS# 624-24-8 M.F.: C6H12O2 M.W.: 116.16 |
| |
QV011200 | Valproic Acid; Sodium caprylate EP Impurity E; Caprylic acid EP Impurity E CAS# 99-66-1 M.F.: C8H16O2 M.W.: 144.21 |
| |
QN201800 | Nitrogen Mustard CAS# 55-86-7 M.F.: C5H12Cl3N M.W.: 192.51 |
| |
QE122031 | Erlotinib Impurity 5 CAS# NA M.F.: C22H23N3O5 M.W.: 409.44 |
| |
QE122030 | Erlotinib Impurity 4 CAS# NA M.F.: C22H25N3O6 M.W.: 427.45 |
| |
QA132006 | Amantadine EP Impurity B CAS# NA M.F.: C12H19NO M.W.: 193.29 |
| |
QA132005 | Amantadine EP Impurity A CAS# 935-56-8 M.F.: C10H15Cl M.W.: 170.68 |
| |
QC062727 | Cefazolin Impurity 1 CAS# 2416213-67-5 M.F.: C18H20N4O8S2 M.W.: 484.50 |
| |
QP201642 | Pantoprazole Impurity 16 CAS# 72830-08-1 M.F.: C8H11NO3 M.W.: 169.18 |
| |
QT140695 | Tenofovir Impurity 95 CAS# 108-23-6 M.F.: C4H7ClO2 M.W.: 122.55 |
| |
QT140694 | Tenofovir Impurity 94 CAS# 133217-92-2 M.F.: C6H12ClNO2 M.W.: 165.62 |
| |
QT140692 | Tenofovir Impurity 92 CAS# NA M.F.: C5H8Cl2O3 M.W.: 187.02 |
| |
QT140669 | Tenofovir Impurity 69 CAS# 6482-34-4 M.F.: C7H14O3 M.W.: 146.18 |
| |
QT140668 | Tenofovir Impurity 68 CAS# 35273-90-6 M.F.: C5H9ClO3 M.W.: 152.58 |
| |
QT140667 | Tenofovir Impurity 67 CAS# 35179-98-7 M.F.: C4H7ClO3 M.W.: 138.55 |
| |
QT140662 | Tenofovir Impurity 62 CAS# 3084-40-0 M.F.: C5H13O4P M.W.: 168.13 |
| |
QT140661 | Tenofovir Impurity 61 CAS# 762-04-9 M.F.: C4H11O3P M.W.: 138.10 |
| |
QT140609 | Tenofovir Impurity H CAS# NA M.F.: C11H17N5O2 M.W.: 251.28 |
| |
QE131610 | Empagliflozin Impurity J CAS# NA M.F.: C18H17ClO4 M.W.: 332.78 |
| |
QP020338 | Palbociclib Impurity 12 CAS# NA M.F.: C44H52Br2N14O2 M.W.: 968.78 |
| |
QP020337 | Palbociclib Impurity 11 CAS# NA M.F.: C13H14BrN3O2 M.W.: 324.17 |
| |
QP020336 | Palbociclib Impurity 10 CAS# 851067-56-6 M.F.: C22H26BrN7O M.W.: 484.39 |
| |
QP020334 | Palbociclib Impurity 8 CAS# NA M.F.: C15H17N3O3 M.W.: 287.31 |
| |
QP020333 | Palbociclib Impurity 7 CAS# NA M.F.: C13H13Br2N3O M.W.: 387.07 |
| |
QP020332 | Palbociclib Impurity 6 CAS# 1244949-62-9 M.F.: C11H14ClN3O M.W.: 239.70 |
| |
QG210101 | Guanfacine Impurity A CAS# NA M.F.: C17H13Cl4N3O2 M.W.: 433.12 |
| |
QR010310 | Racecadotril Impurity J; Benzalkonium chloride EP Impurity C CAS# 100-44-7 M.F.: C7H7Cl M.W.: 126.58 |
| |
QA070208 | Argatroban Impurity H CAS# NA M.F.: C23H36N6O5S M.W.: 508.63 |
| |
QA070206 | Argatroban Impurity F CAS# 74874-09-2 M.F.: C25H35N7O7S M.W.: 577.65 |
| |
QO022018 | Obeticholic Acid Impurity R CAS# 10538-59-7 M.F.: C25H40O4 M.W.: 404.58 |
| |
QO022017 | Obeticholic Acid Impurity Q CAS# NA M.F.: C24H38O4 M.W.: 390.56 |
| |
QB161617 | Bupropion Impurity Q CAS# 119802-69-6 M.F.: C9H10ClNO M.W.: 183.63 |
| |
QF022461 | Febuxostat Impurity 35 CAS# NA M.F.: C15H18N2O2S M.W.: 290.38 |
| |
QF022459 | Febuxostat Impurity 33 CAS# NA M.F.: C17H18N2O3S M.W.: 330.40 |
| |
QF022458 | Febuxostat Impurity 32 CAS# 2418591-43-0 M.F.: C16H16N2O3S M.W.: 316.37 |
| |
QF022457 | Febuxostat Impurity 31 CAS# NA M.F.: C18H20N2O3S M.W.: 344.43 |
| |
QF022456 | Febuxostat Impurity 30 CAS# NA M.F.: C18H20N2O3S M.W.: 344.43 |
| |
QF022454 | Febuxostat Impurity 28 CAS# NA M.F.: C15H17NO2S M.W.: 275.37 |
| |
QF022453 | Febuxostat Impurity 27 CAS# NA M.F.: C15H18N2O2S M.W.: 290.38 |
| |
QF022450 | Febuxostat Impurity 24 CAS# 1350352-70-3 M.F.: C16H18N2O4S M.W.: 334.39 |
| |
QC201819 | Cetirizine Impurity 19 CAS# 1016-78-0 M.F.: C13H9ClO M.W.: 216.66 |
| |
QC132401 | Cefmenoxime Impurity 1 CAS# 84994-24-1 M.F.: C13H10N4O3S2 M.W.: 334.37 |
| |
QO022014 | Obeticholic Acid Impurity N CAS# NA M.F.: C26H44O4 M.W.: 420.63 |
| |
QO022013 | Obeticholic Acid Impurity M CAS# NA M.F.: C24H40O4 M.W.: 392.57 |
| |
QO022012 | Obeticholic Acid Impurity L CAS# NA M.F.: C26H44O4 M.W.: 420.63 |
| |
QO022011 | Obeticholic Acid Impurity K CAS# NA M.F.: C26H44O4 M.W.: 420.63 |
| |
QO022010 | Obeticholic Acid Impurity J CAS# NA M.F.: C26H42O4 M.W.: 418.61 |
| |
QO022009 | Obeticholic Acid Impurity I CAS# 915038-26-5 M.F.: C26H42O4 M.W.: 418.61 |
| |
QO022008 | Obeticholic Acid Impurity H CAS# NA M.F.: C26H40O4 M.W.: 416.59 |
| |
QC061714 | Cefoperazone Impurity N CAS# NA M.F.: C23H25N5O8S2 M.W.: 563.60 |
| |
QC061711 | Cefoperazone Impurity K CAS# NA M.F.: C25H29N9O9S2 M.W.: 663.68 |
| |
QC061710 | Cefoperazone Impurity J CAS# 24209-38-9 M.F.: C10H12N6O3S2 M.W.: 328.37 |
| |
QC061709 | Cefoperazone Impurity I CAS# NA M.F.: C23H25N5O9S M.W.: 547.54 |
| |
QC140600 | Coniferyl ferulate CAS# 63644-62-2 M.F.: C20H20O6 M.W.: 356.37 |
| |
QP020331 | Palbociclib Impurity 5 CAS# 1082876-26-3 M.F.: C9H14N4 M.W.: 178.23 |
| |
QG140905 | Ganciclovir EP Impurity E CAS# 86357-09-7 M.F.: C9H13N5O4 M.W.: 255.23 |
| |
QG140904 | Ganciclovir EP Impurity D CAS# 1346598-14-8 M.F.: C10H15N5O5 M.W.: 285.26 |
| |
QG140903 | Ganciclovir EP Impurity C; Valganciclovir EP Impurity I CAS# 108436-36-8 M.F.: C9H12ClN5O3 M.W.: 273.68 |
| |
QG140902 | Ganciclovir EP Impurity B; Valganciclovir EP Impurity J CAS# 194159-18-7 M.F.: C12H17N5O5 M.W.: 311.29 |
| |
QG140901 | Ganciclovir EP Impurity A CAS# 1797982-93-4 M.F.: C9H10ClN5O2 M.W.: 255.66 |
| |
QL191631 | Lansoprazole Impurity 5 CAS# 103577-61-3 M.F.: C9H10F3NO2 M.W.: 221.18 |
| |
QD240907 | Dexmedetomidine Impurity 7 CAS# 2240179-65-9 M.F.: C23H28N2 M.W.: 332.48 |
| |
QD240906 | Controlled Substance (Dexmedetomidine Impurity 6) CAS# 60907-90-6 M.F.: C10H14O M.W.: 150.22 |
| |
QL221518 | Levonorgestrel EP Impurity R CAS# 2322-77-2 M.F.: C20H28O2 M.W.: 300.44 |
| |
QL221517 | Levonorgestrel EP Impurity Q CAS# 1038-28-4 M.F.: C20H30O2 M.W.: 302.45 |
| |
QL221516 | Levonorgestrel EP Impurity P CAS# 100021-05-4 M.F.: C21H28O2 M.W.: 312.45 |
| |
QL221514 | Levonorgestrel EP Impurity N CAS# 4222-96-2 M.F.: C19H26O2 M.W.: 286.41 |
| |
QL221512 | Levonorgestrel EP Impurity L CAS# 21800-83-9 M.F.: C19H26O2 M.W.: 286.41 |
| |
QL221510 | Levonorgestrel EP Impurity J CAS# 1175109-63-3 M.F.: C21H26O3 M.W.: 326.43 |
| |
QL221509 | Levonorgestrel EP Impurity I CAS# 20402-62-4;21508-50-9 M.F.: C21H28O3 M.W.: 328.45 |
| |
QL221507 | Levonorgestrel EP Impurity G CAS# 87585-03-3 M.F.: C21H28O3 M.W.: 328.45 |
| |
QL221504 | Levonorgestrel EP Impurity D CAS# 32419-58-2 M.F.: C21H30O M.W.: 298.46 |
| |
QL221503 | Levonorgestrel EP Impurity C CAS# 1337972-89-0 M.F.: C23H28O M.W.: 320.47 |
| |
QL221502 | Levonorgestrel EP Impurity B CAS# 19914-67-1 M.F.: C21H28O2 M.W.: 312.45 |
| |
QA202262 | Atorvastatin Impurity 12 CAS# 196085-85-5 M.F.: C14H23NO4 M.W.: 269.34 |
| |
QP202222 | Pitavastatin Impurity V CAS# NA M.F.: C50H46CaF2N2O8 M.W.: 880.98 |
| |
QA164808 | Axitinib Impurity H CAS# 1428728-83-9 M.F.: C44H36N8O2S2 M.W.: 772.94 |
| |
QP812519 | Paclitaxel Impurity S CAS# NA M.F.: C47H51NO14 M.W.: 853.91 |
| |
QG120309 | Gliclazide Impurity I CAS# 38173-52-3 M.F.: C15H19N3O5S M.W.: 353.39 |
| |
QC-A130910 | 6-aminohexanoic acid; Aminocaproic acid;Zinc acexamate EP Impurity B CAS# 60-32-2 M.F.: C6H13NO2 M.W.: 131.17 |
| |
QC120424 | Clindamycin Phosphate EP Impurity B CAS# 54887-31-9 M.F.: C17H32ClN2O8PS M.W.: 490.94 |
| |
QF120103 | Flutamide EP Impurity C CAS# 13312-12-4 M.F.: C10H9F3N2O3 M.W.: 262.19 |
| |
QA011404 | 7-ANCA Impurity D CAS# NA M.F.: C7H8N2O3S M.W.: 200.22 |
| |
QA011407 | 7-ANCA Impurity G CAS# NA M.F.: C14H14N4O5S2 M.W.: 382.41 |
| |
QA011405 | 7-ANCA Impurity E CAS# NA M.F.: C6H8N2OS M.W.: 156.21 |
| |
QA011403 | 7-ANCA Impurity C CAS# 68403-70-3 M.F.: C7H10N2O4S M.W.: 218.23 |
| |
QA011402 | 7-ANCA Impurity B CAS# NA M.F.: C7H8N2O4S M.W.: 216.21 |
| |
QA202250 | Atorvastatin Impurity Z CAS# 196085-84-4 M.F.: C14H23NO4 M.W.: 269.34 |
| |
QP201637 | Pantoprazole Sodium Impurity 11 CAS# NA M.F.: C7H8ClNO2 M.W.: 173.60 |
| |
QP201632 | Pantoprazole Sodium Impurity 6 CAS# NA M.F.: C8H11NO3 M.W.: 169.18 |
| |
QP201631 | Pantoprazole Sodium Impurity 5 CAS# NA M.F.: C8H11NO3 M.W.: 169.18 |
| |
QP201629 | Pantoprazole Sodium Impurity 3 CAS# NA M.F.: C9H13NO3 M.W.: 183.20 |
| |
QP201628 | Pantoprazole Sodium Impurity 2 CAS# 957470-59-6 M.F.: C24H24F2N4O6S M.W.: 534.53 |
| |
QP201627 | Pantoprazole Sodium Impurity 1 CAS# NA M.F.: C16H15F2N3O3S M.W.: 367.37 |
| |
QP201626 | Pantoprazole Sodium Impurity Z CAS# NA M.F.: C15H11F2N3O5 M.W.: 351.26 |
| |
QT120838 | Trelagliptin Impurity 12 CAS# 31737-09-4 M.F.: C5H5ClN2O2 M.W.: 160.56 |
| |
QT120834 | Trelagliptin Impurity 8 CAS# 147754-12-9 M.F.: C8H6FN M.W.: 135.14 |
| |
QL142619 | Linezolid Impurity S CAS# 5394-50-3 M.F.: C16H16N2O4 M.W.: 300.31 |
| |
QE131609 | Empagliflozin Impurity I CAS# NA M.F.: C46H52Cl2O14 M.W.: 899.80 |
| |
QC160802 | Cephalothin Impurity B;Cefalotin sodium EP Impurity A CAS# 34691-02-6 M.F.: C14H14N2O4S2 M.W.: 338.40 |
| |
QT251954 | Thymalfasin Impurity D-Ser9 CAS# NA M.F.: C129H215O55N33 M.W.: 3108.34 |
| |
QT251953 | Thymalfasin Impurity D-Ser8 CAS# NA M.F.: C129H215O55N33 M.W.: 3108.34 |
| |
QT251952 | Thymalfasin Impurity Des-Asn28 CAS# NA M.F.: C125H209O53N31 M.W.: 2994.24 |
| |
QT251946 | Thymalfasin Impurity Des-Val23 CAS# NA M.F.: C124H206O54N32 M.W.: 3009.21 |
| |
QC121204 | Cholecalciferol EP Impurity D;iso-Tachysterol 3 CAS# 22350-43-2 M.F.: C27H44O M.W.: 384.64 |
| |
QI192106 | Isoflurane EP Impurity F CAS# NA M.F.: C4H8 M.W.: 56.11 |
| |
QI192105 | Isoflurane EP Impurity E CAS# 32778-09-9 M.F.: C3Cl3F5O M.W.: 253.38 |
| |
QI192103 | Isoflurane EP Impurity C CAS# 32778-08-8 M.F.: C3HCl2F5O M.W.: 218.94 |
| |
QI192100 | Isoflurane CAS# 26675-46-7 M.F.: C3H2ClF5O M.W.: 184.49 |
| |
QC062111 | Ceftazidime Impurity 11 CAS# NA M.F.: C22H24N6O8S2 M.W.: 564.59 |
| |
QL191808 | Lesinurad Impurity H CAS# NA M.F.: C19H18BrN3O2S M.W.: 432.33 |
| |
QL191807 | Lesinurad Impurity G CAS# NA M.F.: C17H15N3O3S M.W.: 341.38 |
| |
QL191806 | Lesinurad Impurity F CAS# NA M.F.: C17H15N3O2S M.W.: 325.38 |
| |
QL191804 | Lesinurad Impurity D CAS# NA M.F.: C17H14ClN3O2S M.W.: 359.83 |
| |
QL191803 | Lesinurad Impurity C CAS# NA M.F.: C17H13Br2N3O2S M.W.: 483.18 |
| |
QL191802 | Lesinurad Impurity B CAS# NA M.F.: C17H14BrN3O4S M.W.: 436.28 |
| |
QC121203 | Cholecalciferol EP Impurity C;Lumisterol 3 CAS# 5226-01-7 M.F.: C27H44O M.W.: 384.64 |
| |
QB162227 | Bupivacaine N-Oxide CAS# 1346597-81-6;1796927-05-3(HCl salt) M.F.: C18H28N2O2 M.W.: 304.43 |
| |
QT251941 | Thymalfasin Impurity Des-Glu18 CAS# NA M.F.: C124H208O52N32 M.W.: 2979.22 |
| |
QT251963 | Thymalfasin Impurity Des-Lys17 CAS# NA M.F.: C123H203O54N31 M.W.: 2980.16 |
| |
QT251924 | Thymalfasin Impurity Des-Thr13 CAS# NA M.F.: C125H208O53N32 M.W.: 3007.23 |
| |
QT251923 | Thymalfasin Impurity Des-Thr12 CAS# NA M.F.: C125H208O53N32 M.W.: 3007.23 |
| |
QT251914 | Thymalfasin Impurity Des-Asp2 CAS# NA M.F.: C125H210O52N32 M.W.: 2993.25 |
| |
QT251913 | Thymalfasin Impurity Des-Ser1 CAS# NA M.F.: C126H210O53N32 M.W.: 3021.26 |
| |
QD072406 | Digoxin EP Impurity F;Digoxigenin bisdigitoxoside CAS# 5297-05-2 M.F.: C35H54O11 M.W.: 650.80 |
| |
QD072404 | Digoxin EP Impurity D;Digoxigenin monodigitoxoside CAS# 5352-63-6 M.F.: C29H44O8 M.W.: 520.65 |
| |
QC182501 | Canagliflozin Impurity A CAS# 842133-16-8 M.F.: C24H26O5S M.W.: 426.53 |
| |
QT041215 | Tadalafil Impurity O;Tryptophan;N-Acetyltryptophan EP Impurity A CAS# 73-22-3 M.F.: C11H12N2O2 M.W.: 204.23 |
| |
QF122106 | Fluorouracil EP Impurity F CAS# 56177-80-1 M.F.: C6H7FN2O2 M.W.: 158.13 |
| |
QF122105 | Fluorouracil EP Impurity E CAS# 1820-81-1 M.F.: C4H3ClN2O2 M.W.: 146.53 |
| |
QF122104 | Fluorouracil EP Impurity D CAS# 6623-81-0 M.F.: C5H6N2O3 M.W.: 142.11 |
| |
QF122102 | Fluorouracil EP Impurity B CAS# 496-76-4 M.F.: C4H4N2O3 M.W.: 128.09 |
| |
QF122101 | Fluorouracil EP Impurity A CAS# 67-52-7 M.F.: C4H4N2O3 M.W.: 128.09 |
| |
QL142617 | Linezolid Impurity 17 CAS# 15708-41-5 M.F.: C10H12FeN2NaO8 M.W.: 367.05 |
| |
QI140410 | Indometacin EP Impurity J CAS# 402849-25-6 M.F.: C33H27Cl2N3O5 M.W.: 616.49 |
| |
QI140409 | Indometacin EP Impurity I CAS# 16401-99-3 M.F.: C21H20ClNO4 M.W.: 385.84 |
| |
QI140408 | Indometacin EP Impurity H CAS# 1601-18-9 M.F.: C20H18ClNO4 M.W.: 371.81 |
| |
QI140407 | Indometacin EP Impurity G CAS# 402849-26-7 M.F.: C19H15Cl2NO4 M.W.: 392.23 |
| |
QI140405 | Indometacin EP Impurity E CAS# 807614-94-4 M.F.: C19H16ClNO4 M.W.: 357.79 |
| |
QI140404 | Indometacin EP Impurity D CAS# NA M.F.: C19H16ClNO4 M.W.: 357.79 |
| |
QI140402 | Indometacin EP Impurity B CAS# 2882-15-7 M.F.: C12H13NO3 M.W.: 219.24 |
| |
QL142221 | Lenvatinib Impurity U CAS# NA M.F.: C19H16ClN3O5 M.W.: 401.80 |
| |
QL142220 | Lenvatinib Impurity T CAS# 417719-51-8 M.F.: C18H15ClN4O4 M.W.: 386.79 |
| |
QL142217 | Lenvatinib Impurity Q CAS# 2110414-05-4 M.F.: C11H10N2O3 M.W.: 218.21 |
| |
QL142216 | Lenvatinib Impurity P CAS# 2143930-77-0 M.F.: C13H14N2O3 M.W.: 246.26 |
| |
QL142215 | Lenvatinib Impurity O CAS# 2143930-76-9 M.F.: C20H19ClN4O4 M.W.: 414.84 |
| |
QL052013 | Levetiracetam Impurity M CAS# NA M.F.: C8H17N3O2 M.W.: 187.24 |
| |
QP020323 | Palbociclib Impurity W CAS# NA M.F.: C27H34ClN7O3 M.W.: 540.06 |
| |
QP020322 | Palbociclib Impurity V CAS# NA M.F.: C29H37N7O3 M.W.: 531.65 |
| |
QP020321 | Palbociclib Impurity U CAS# 2270982-31-3 M.F.: C28H37N7O2 M.W.: 503.64 |
| |
QP020327 | Palbociclib Impurity 1 CAS# 2206135-30-8 M.F.: C41H55N11O5 M.W.: 781.95 |
| |
QF121906 | Fulvestrant EP Impurity F;6-Keto Fulvestrant CAS# NA M.F.: C32H45F5O4S M.W.: 620.75 |
| |
QF121903 | Fulvestrant EP Impurity C CAS# 2482852-42-4 M.F.: C41H65F5O4S2 M.W.: 781.07 |
| |
QF121901 | Fulvestrant EP Impurity A CAS# 407577-53-1 M.F.: C32H47F5O3S M.W.: 606.77 |
| |
QP020328 | Palbociclib Impurity 2 CAS# 2204863-06-7 M.F.: C24H29N7O M.W.: 431.53 |
| |
QC060504 | Cefradine EP Impurity D CAS# NA M.F.: C16H19N3O5S M.W.: 365.40 |
| |
QL040310 | Lidocaine EP Impurity J CAS# 857570-37-7;1012864-23-1(HCl salt) M.F.: C14H22N2O M.W.: 234.34 |
| |
QL040309 | Lidocaine EP Impurity I CAS# 17289-53-1;17289-54-2(HCl salt) M.F.: C14H22N2O M.W.: 234.34 |
| |
QL040307 | Lidocaine EP Impurity G CAS# 42459-30-3;35891-87-3(HCl salt) M.F.: C13H20N2O M.W.: 220.31 |
| |
QL040306 | Lidocaine EP Impurity F CAS# 142713-08-4;857170-72-0(HCl salt) M.F.: C14H22N2O M.W.: 234.34 |
| |
QA181620 | Aripiprazole Impurity 20 CAS# NA M.F.: C18H27Cl3N2O M.W.: 393.78 |
| |
QL040305 | Lidocaine EP Impurity E CAS# 745798-07-6;1135231-62-7(HCl salt) M.F.: C20H25N3O2 M.W.: 339.43 |
| |
QC-T180903 | 1H-1,2,4-triazol-3-amine;Trapidil EP Impurity B CAS# 61-82-5 M.F.: C2H4N4 M.W.: 84.08 |
| |
QC241308 | Cefixime Impurity H CAS# 79349-82-9 M.F.: C9H10N2O3S M.W.: 226.25 |
| |
QA261230 | Azelastine EP Impurity D CAS# 53242-88-9 M.F.: C15H11ClN2O M.W.: 270.71 |
| |
QG062006 | Gefitinib Impurity F CAS# 1502829-45-9(free base) M.F.: C29H40Cl4FN5O4 M.W.: 683.47 |
| |
QL050310 | Lercanidipine Impurity J CAS# NA M.F.: C36H39N3O7 M.W.: 625.71 |
| |
QI041628 | Indapamide EP Impurity B CAS# 63968-75-2 M.F.: C16H14ClN3O3S M.W.: 363.82 |
| |
QS161808 | Sulpiride Impurity 8 CAS# NA M.F.: C14H21N3O5S M.W.: 343.4 |
| |
QE131607 | Empagliflozin Impurity G CAS# 1620758-33-9 M.F.: C23H27ClO7 M.W.: 450.91 |
| |
QC-C081204 | 2-chlorobenzoic acid;Mesalazine EP Impurity L;Mefenamic Acid EP Impurity C; Tolfenamic acid EP Impurity A CAS# 118-91-2 M.F.: C7H5ClO2 M.W.: 156.57 |
| |
QC132637 | Cefmetazole Impurity 11 CAS# 56796-16-8 M.F.: C15H17N3O7S2 M.W.: 415.44 |
| |
QA041430 | Adrenaline EP Impurity D CAS# 317351-40-9 M.F.: C16H19NO3 M.W.: 273.33 |
| |
QC062429 | Ceftriaxone Impurity 3 CAS# 6938-68-7 M.F.: C2H7N3S M.W.: 105.16 |
| |
QC162631 | Cefprozil Impurity 5 CAS# 1000980-59-5 M.F.: C18H19N3O5S M.W.: 389.43 |
| |
QG130333 | Gemcitabine EP Impurity C CAS# 114248-23-6 M.F.: C9H10F2N2O5 M.W.: 264.18 |
| |
QC201838 | (S)-Cetirizine CAS# 130018-76-7;163837-48-7(2HCl salt) M.F.: C21H25ClN2O3 M.W.: 388.89 |
| |
QP151427 | Prostaglandin E1-d3 CAS# 745-65-3 (non-labelled) M.F.: C20H31D3O5 M.W.: 357.50 |
| |
QA161830 | Aprepitant Impurity 1 CAS# 638990-20-2 M.F.: C22H24N2O5 M.W.: 396.44 |
| |
QL142631 | Linezolid Impurity 31 CAS# NA M.F.: C21H29FN4O6 M.W.: 452.48 |
| |
QA200331 | Cisatracurium Besylate EP Impurity K CAS# NA M.F.: C66H84N2O18S2 M.W.: 1257.51 |
| |
QL221523 | Levonorgestrel EP Impurity W CAS# 155683-59-3 M.F.: C21H24O2 M.W.: 308.41 |
| |
QL221508 | Levonorgestrel EP Impurity H CAS# 55555-97-0 M.F.: C21H28O3 M.W.: 328.45 |
| |
QL221501 | Levonorgestrel EP Impurity A CAS# 1260525-53-8 M.F.: C21H26O2 M.W.: 310.43 |
| |
QA120715 | Alogliptin Impurity O CAS# 655-63-0 M.F.: C8H5Br2N M.W.: 274.94 |
| |
QC081229 | Chlorpromazine EP Impurity D CAS# 3953-65-9(HCl salt) M.F.: C16H17ClN2S M.W.: 304.84 |
| |
QD240905 | Dexmedetomidine Impurity 5 CAS# 1021949-47-2 M.F.: C13H14N2 M.W.: 198.26 |
| |
QF141911 | Finasteride Impurity K CAS# NA M.F.: C23H32N2O2 M.W.: 368.51 |
| |
QE200335 | Entecavir Impurity 9 CAS# NA M.F.: C15H19N5O5 M.W.: 349.34 |
| |
QE200334 | Entecavir Impurity 8 CAS# NA M.F.: C15H19N5O5 M.W.: 349.34 |
| |
QE200333 | Entecavir Impurity 7 CAS# NA M.F.: C15H19N5O5 M.W.: 349.34 |
| |
QE200332 | Entecavir Impurity 6 CAS# NA M.F.: C15H19N5O5 M.W.: 349.34 |
| |
QT140623 | Tenofovir Impurity W CAS# NA M.F.: C13H23N5O8P2 M.W.: 439.30 |
| |
QE151308 | Esomeprazole Impurity H CAS# NA M.F.: C8H7NO2S M.W.: 181.21 |
| |
QL140306 | Lincomycin Hydrochloride EP Impurity F CAS# 14810-93-6 M.F.: C9H19NO5S M.W.: 253.32 |
| |
QL140303 | Lincomycin Hydrochloride EP impurity C CAS# 14600-41-0 M.F.: C17H33ClN2O6S M.W.: 428.97 |
| |
QL140328 | Lincomycin B Hydrochloride CAS# 11021-35-5;2520-24-3(free base) M.F.: C17H32N2O6S.HCl M.W.: 392.51 36.46 |
| |
QL140327 | Lincomycin Hydrochloride EP Impurity A CAS# NA M.F.: C18H34N2O6S M.W.: 406.54 |
| |
QA120714 | Alogliptin Impurity N CAS# NA M.F.: C20H26N4O4 M.W.: 386.44 |
| |
QL121929 | Lansoprazole Impurity 3 CAS# 1083100-27-9 M.F.: C25H22F6N4O2S M.W.: 556.52 |
| |
QV141677 | Vonoprazan Impurity 40 CAS# 1421640-34-7 M.F.: C6H7NO3S M.W.: 173.19 |
| |
QT120832 | Trelagliptin Impurity 6 CAS# 1938080-42-2 M.F.: C13H10FN3O3 M.W.: 275.24 |
| |
QB031214 | Bicalutamide EP Impurity M CAS# 151262-57-6 M.F.: C10H11FO5S M.W.: 262.25 |
| |
QO022030 | Obeticholic Acid CAS# 459789-99-2 M.F.: C26H44O4 M.W.: 420.63 |
| |
QE151318 | Esomeprazole Impurity 9 CAS# 695-98-7 M.F.: C8H11N M.W.: 121.18 |
| |
QI040128 | Indacaterol Impurity 2 CAS# 435273-75-9 M.F.: C31H34N2O3 M.W.: 482.61 |
| |
QC132634 | Cefmetazole Impurity 8; 7-MAC CAS# 56610-72-1 M.F.: C24H24N6O4S2 M.W.: 524.62 |
| |
QC132632 | Cefmetazole Impurity 6 CAS# NA M.F.: C15H17N7O6S3 M.W.: 487.53 |
| |
QC132633 | Cefmetazole Impurity 7 CAS# NA M.F.: C15H19N7O6S3 M.W.: 489.55 |
| |
QC-M200824 | Trelagliptin Impurity 24 CAS# NA M.F.: C12H9BrClFN2O2 M.W.: 347.57 |
| |
QA163000 | Apremilast Impurity T CAS# 2096492-41-8 M.F.: C22H26N2O8S M.W.: 478.52 |
| |
QA162999 | Apremilast Impurity S CAS# 1809170-71-5 M.F.: C22H26N2O8S M.W.: 478.52 |
| |
QG062003 | Gefitinib Impurity C CAS# 199327-61-2 M.F.: C16H21N3O4 M.W.: 319.36 |
| |
QT192019 | Telmisartan Impurity S CAS# 4760-34-3 M.F.: C7H10N2 M.W.: 122.17 |
| |
QA181630 | Aripiprazole EP Impurity D CAS# 203395-82-8 M.F.: C23H28ClN3O2 M.W.: 413.95 |
| |
QC121904 | Cilastatin EP Impurity D CAS# 141-79-7 M.F.: C6H10O M.W.: 98.14 |
| |
QC062431 | Ceftriaxone Oxidation Impurity CAS# NA M.F.: C18H18N8O8S3 M.W.: 570.58 |
| |
QE151325 | Esomeprazole Sodium Impurity 9 CAS# NA M.F.: C26H30N4O3S M.W.: 478.61 |
| |
QC132628 | Cefmetazole Impurity 2 CAS# NA M.F.: C15H16N7NaO6S3 M.W.: 509.52 |
| |
QF181932 | Furosemide Impurity 6 CAS# 4795-29-3 M.F.: C5H11NO M.W.: 101.15 |
| |
QE262031 | Ezetimibe Impurity 5 CAS# 1612153-32-8 M.F.: C20H20FNO4 M.W.: 357.38 |
| |
QT251910 | Des-Ser1-Asp15-Tal CAS# NA M.F.: C66H113N17O25 M.W.: 1544.74 |
| |
QT251906 | Des-Ser1-Asp2-Tal CAS# NA M.F.: C120H203N31O49 M.W.: 2864.13 |
| |
QT260227 | Tazobactam Impurity 1 CAS# 89789-07-1 M.F.: C23H22N4O5S M.W.: 466.51 |
| |
QF181931 | Furosemide Impurity 5 CAS# 98-00-0 M.F.: C5H6O2 M.W.: 98.10 |
| |
QD180904 | Dirithromycin EP Impurity D CAS# NA M.F.: C41H76N2O14 M.W.: 821.05 |
| |
QF181928 | Furosemide Impurity 2 CAS# 41332-59-6 M.F.: C7H4Cl2O5S M.W.: 271.07 |
| |
QL142630 | (R)-Linezolid CAS# 872992-20-6 M.F.: C16H20FN3O4 M.W.: 337.35 |
| |
QC120101 | Clavulanic Acid Imidazole Derivative-d3 CAS# NA M.F.: C10H10D3N3O3 M.W.: 226.25 |
| |
QT180630 | Tirofiban Impurity 4 CAS# NA M.F.: C9H19NO2 M.W.: 173.25 |
| |
QC-A140901 | Aniline;Mesalazine EP Impurity K; Fentanyl EP Impurity F; Sodium Cyclamate EP Impurity B; Trimethoprim EP Impurity K; 4-Aminobenzoic acid EP Impurity C CAS# 62-53-3;142-04-1(HCl salt) M.F.: C6H7N M.W.: 93.13 |
| |
QI131602 | Imipenem EP Impurity B CAS# 1197869-90-1 M.F.: C12H19N3O5S M.W.: 317.36 |
| |
QD190628 | Doxofylline Impurity 2 CAS# NA M.F.: C10H14N4O5 M.W.: 270.24 |
| |
QE200345 | Entecavir Impurity 45 CAS# 142217-81-0 M.F.: C26H27N5O3 M.W.: 457.52 |
| |
QT090303 | Thioctic Acid Impurity C CAS# 916746-61-7 M.F.: C12H23NO4S2 M.W.: 309.45 |
| |
QP201618 | Pantoprazole Impurity R CAS# 172282-50-7 M.F.: C7H8F2N2O M.W.: 174.15 |
| |
QP201617 | Pantoprazole Impurity Q CAS# 97963-76-3 M.F.: C7H6F2N2O3 M.W.: 204.13 |
| |
QD031232 | Daclatasvir Impurity 6 CAS# 1417333-58-4 M.F.: C40H50N8O6 M.W.: 738.88 |
| |
QD031231 | Daclatasvir Impurity 5 CAS# 1009117-26-3 M.F.: C40H50N8O6 M.W.: 738.88 |
| |
QL052229 | Levocetirizine Impurity 3 CAS# NA M.F.: C21H25ClN2O3[C2H4]n M.W.: 388.90[44.05]n |
| |
QG121621 | Glipizide Impurity U CAS# NA M.F.: C14H20N2O6S M.W.: 344.38 |
| |
QG121619 | Glipizide Impurity S CAS# NA M.F.: C12H17N3O M.W.: 219.28 |
| |
QG121618 | Glipizide Impurity R CAS# NA M.F.: C8H8N2O4 M.W.: 196.16 |
| |
QG121610 | Glipizide Impurity 1 HCl CAS# 1428553-61-0;2015-16-9(free base) M.F.: C15H23N3O3S.HCl M.W.: 325.43 36.46 |
| |
QB200102 | Betamethasone Dipropionate EP Impurity B CAS# 5534-13-4 M.F.: C25H33FO6 M.W.: 448.52 |
| |
QL121928 | Lansoprazole Impurity 2 CAS# NA M.F.: C16H14F3N3O2 M.W.: 337.30 |
| |
QL141239 | Linagliptin Impurity 39 CAS# 88203-04-7 M.F.: C10H10N2O M.W.: 174.20 |
| |
QA131501 | N-Desethyl Amodiaquine DiHCl CAS# 79352-78-6(free base) M.F.: C18H20Cl3N3O M.W.: 400.73 |
| |
QA181619 | Aripiprazole Impurity 19 CAS# 889443-20-3 M.F.: C13H17NO3 M.W.: 235.28 |
| |
QD031229 | Daclatasvir Impurity 29 CAS# NA M.F.: C29H32N6O3 M.W.: 512.60 |
| |
QD130927 | Demiditraz Impurity 1 CAS# 944263-08-5 M.F.: C13H16N2 M.W.: 200.28 |
| |
QC251927 | Cystine Impurity 1 CAS# 32854-09-4;1069-29-0(free base) M.F.: C8H16N2O4S2.2HCl M.W.: 268.35 72.92 |
| |
QC120313 | Celecoxib Impurity M CAS# 41472-49-5 M.F.: C10H14N2O3S M.W.: 242.29 |
| |
QG121629 | Glipizide Impurity 3 CAS# 933705-21-6 M.F.: C8H12N2O2S M.W.: 200.26 |
| |
QG121628 | Glipizide Impurity 2 CAS# 73631-58-0 M.F.: C8H11NO3S M.W.: 201.24 |
| |
QG121627 | Glipizide Impurity 1 CAS# 877-95-2 M.F.: C10H13NO M.W.: 163.22 |
| |
QA041404 | rac-Adrenaline EP Impurity D HCl CAS# 1095714-91-2 (free base) M.F.: C16H20ClNO3 M.W.: 309.79 |
| |
QA041406 | rac-Adrenaline EP Impurity F CAS# 26405-77-6 M.F.: C9H13NO5S M.W.: 247.27 |
| |
QP122412 | Plerixafor Impurity L CAS# NA M.F.: C70H90N8O12S6 M.W.: 1427.90 |
| |
QP122411 | Plerixafor Impurity K CAS# 104395-69-9 M.F.: C31H42N4O6S3 M.W.: 662.88 |
| |
QC202627 | Ceftizoxime Impurity 1 CAS# NA M.F.: C13H15N5O6S2 M.W.: 401.42 |
| |
QD241305 | Dexamethasone Acetate EP Impurity E CAS# 1524-94-3 M.F.: C24H33FO6 M.W.: 436.51 |
| |
QT180629 | Tirofiban Impurity 3 CAS# NA M.F.: C20H24N2O4 M.W.: 356.42 |
| |
QG140927 | Ganciclovir EP Impurity H CAS# 84222-50-4 M.F.: C9H13N5O4 M.W.: 255.23 |
| |
QT142090 | Teneligliptin (2S,4R)-Isomer Impurity CAS# 1404559-15-4 M.F.: C22H30N6OS M.W.: 426.58 |
| |
QO241810 | Oxiracetam Impurity J CAS# NA M.F.: C6H8N2O2 M.W.: 140.14 |
| |
QL162007 | Lapatinib Impurity 7 CAS# 1026818-86-9 M.F.: C29H26ClFN4O4S M.W.: 581.06 |
| |
QL162003 | Lapatinib Impurity 3 CAS# 1360431-86-2 M.F.: C29H26ClFN4O5S M.W.: 597.06 |
| |
QL162002 | Lapatinib Impurity 2 CAS# 320337-48-2 M.F.: C26H19ClFN3O3 M.W.: 475.90 |
| |
QG140909 | Ganciclovir EP Impurity I CAS# 86357-20-2 M.F.: C15H21N5O6 M.W.: 367.36 |
| |
QT060359 | Tofacitinib Impurity 33 CAS# NA M.F.: C13H19N5 M.W.: 245.32 |
| |
QP121827 | Palonosetron Impurity 27 CAS# 135729-78-1 M.F.: C18H24N2O M.W.: 284.40 |
| |
QC-M200805 | Bisoctrizole CAS# 103597-45-1 M.F.: C41H50N6O2 M.W.: 658.87 |
| |
QT132014 | Trimetazidine Impurity N CAS# 69471-05-2 M.F.: C9H10O4 M.W.: 182.17 |
| |
QH042401 | Hydroxychloroquine sulfate EP Impurity A CAS# 1449223-88-4 M.F.: C18H26ClN3O2 M.W.: 351.87 |
| |
QH042403 | Hydroxychloroquine sulfate EP Impurity C CAS# 4298-15-1 M.F.: C16H22ClN3O M.W.: 307.82 |
| |
QT161828 | Topiroxostat Impurity 2 CAS# 38634-05-8 M.F.: C12H10N6 M.W.: 238.25 |
| |
QC161306 | Cefepime EP Impurity F CAS# NA M.F.: C32H42N9O7S3 M.W.: 760.93 |
| |
QC161302 | Cefepime EP Impurity B CAS# NA M.F.: C25H29N9O7S3 M.W.: 663.75 |
| |
QC160732 | Clopidogrel Impurity 6 CAS# 212838-70-5 M.F.: C9H11Cl2NO2 M.W.: 236.10 |
| |
QP182004 | Paracetamol EP Impurity D CAS# 103-84-4 M.F.: C8H9NO M.W.: 135.16 |
| |
QC551801 | Clenbuterol EP Impurity A CAS# 62909-66-4 M.F.: C7H5Cl2NO M.W.: 190.03 |
| |
QL091630 | Lipoic Acid Impurity 4 CAS# NA M.F.: C8H14O4S2 M.W.: 238.32 |
| |
QL091629 | Lipoic Acid Impurity 3 CAS# 108015-78-7 M.F.: C8H14O3S2 M.W.: 222.32 |
| |
QL091628 | Lipoic Acid Impurity 2 CAS# 462-20-4 M.F.: C8H16O2S2 M.W.: 208.34 |
| |
QL091600 | Lipoic Acid CAS# 1077-28-7;2319-84-8(Na salt) M.F.: C8H14O2S2 M.W.: 206.33 |
| |
QT060372 | Tofacitinib Impurity 72 CAS# NA M.F.: C16H20N6O M.W.: 312.37 |
| |
QC010606 | Caffeine EP Impurity F CAS# 611-59-6 M.F.: C7H8N4O2 M.W.: 180.16 |
| |
QA202267 | Atorvastatin Impurity 17 CAS# 425408-16-8 M.F.: C53H58ClFN4O9 M.W.: 949.50 |
| |
QA202266 | Atorvastatin Impurity 16 CAS# 1821498-27-4 M.F.: C27H30FNO6 M.W.: 483.53 |
| |
QT140657 | Tenofovir Impurity 31 CAS# NA M.F.: C21H29N6O5P M.W.: 476.47 |
| |
QT201608 | Tiotropium Bromide EP Impurity H CAS# 845870-40-8 M.F.: C9H16BrNO2 M.W.: 250.13 |
| |
QI041529 | Indobufen Impurity 3 CAS# 21762-22-1 M.F.: C10H11NO4 M.W.: 209.20 |
| |
QL141202 | Lenalidomide Impurity B CAS# 1218910-61-2 M.F.: C9H8ClNO4 M.W.: 229.62 |
| |
QE160930 | Epinastine Impurity 4 CAS# NA M.F.: C15H13NO M.W.: 223.27 |
| |
QD031227 | Daclatasvir Dihydrochloride CAS# 1009119-65-6 M.F.: C40H52Cl2N8O6 M.W.: 811.80 |
| |
QP180104 | Piracetam EP Impurity D CAS# 53934-76-2 M.F.: C6H9NO3 M.W.: 143.14 |
| |
QP180101 | Piracetam EP Impurity A CAS# 616-45-5 M.F.: C4H7NO M.W.: 85.10 |
| |
QP122410 | Plerixafor Impurity J CAS# NA M.F.: C18H32N4 M.W.: 304.47 |
| |
QT060371 | Tofacitinib Impurity 71 CAS# NA M.F.: C14H22N2O M.W.: 234.34 |
| |
QT060369 | Tofacitinib Impurity 69 CAS# NA M.F.: C14H21N5 M.W.: 259.35 |
| |
QE160929 | Epinastine Impurity 3 CAS# NA M.F.: C15H12N2O M.W.: 236.27 |
| |
QE160928 | Epinastine Impurity 2 CAS# NA M.F.: C16H16N2 M.W.: 236.31 |
| |
QE200347 | Entecavir Impurity 47 CAS# NA M.F.: C13H17N5O4 M.W.: 307.31 |
| |
QP122409 | Plerixafor Impurity I CAS# NA M.F.: C17H30N4O2S M.W.: 354.51 |
| |
QT180626 | Tirofiban Impurity Z CAS# 102878-73-9 M.F.: C9H11NO2 M.W.: 165.19 |
| |
QT180621 | Tirofiban Impurity U CAS# 2374-68-7 M.F.: C6H14O3S M.W.: 166.24 |
| |
QT180620 | Tirofiban Impurity T CAS# NA M.F.: C22H30N2O5S M.W.: 434.55 |
| |
QT180619 | Tirofiban Impurity S CAS# NA M.F.: C36H62N4O3 M.W.: 598.90 |
| |
QT180617 | Tirofiban Impurity Q CAS# NA M.F.: C27H47Cl2N3O3 M.W.: 532.59 |
| |
QT180616 | Tirofiban Impurity P CAS# NA M.F.: C27H33N3O3 M.W.: 447.57 |
| |
QT180614 | Tirofiban Impurity N CAS# NA M.F.: C18H22N2O3 M.W.: 314.38 |
| |
QT180612 | Tirofiban Impurity L CAS# NA M.F.: C18H22N2O3 M.W.: 314.38 |
| |
QT180600 | Tirofiban HCl CAS# 142373-60-2;150915-40-5(HCl monohydrate) M.F.: C22H36N2O5S.HCl M.W.: 440.60 36.46 |
| |
QT180610 | Tirofiban Impurity J CAS# NA M.F.: C31H49Cl2N3O5S M.W.: 646.71 |
| |
QT180604 | Tirofiban Impurity D CAS# 149490-61-9 M.F.: C22H30N2O5S M.W.: 434.55 |
| |
QT180603 | Tirofiban Impurity C CAS# NA M.F.: C31H43Cl2N3O5S M.W.: 640.66 |
| |
QT251938 | Thymalfasin Impurity Des-Glu21---Asn28-Tal CAS# NA M.F.: C92H158O38N24 M.W.: 2208.42 |
| |
QT251929 | Thymalfasin Impurity Des-Asn28-Tal CAS# NA M.F.: C125H209O53N31 M.W.: 2994.24 |
| |
QP136046 | Pidotimod Impurity 20 CAS# NA M.F.: C10H16N2O3S2 M.W.: 276.38 |
| |
QP136045 | Pidotimod Impurity 19 CAS# NA M.F.: C8H12N2O4S M.W.: 232.26 |
| |
QP136044 | Pidotimod Impurity 18 CAS# NA M.F.: C13H19N3O6S2 M.W.: 377.44 |
| |
QG200609 | Gatifloxacin Impurity I CAS# 103460-89-5 M.F.: C18H19F2N3O3 M.W.: 363.36 |
| |
QU121600 | Ulipristal Acetate CAS# 126784-99-4 M.F.: C30H37NO4 M.W.: 475.62 |
| |
QU121608 | Ulipristal acetate Impurity H CAS# NA M.F.: C30H37NO4 M.W.: 475.62 |
| |
QU121607 | Ulipristal acetate Impurity G CAS# NA M.F.: C28H35NO3 M.W.: 433.58 |
| |
QU121606 | Ulipristal acetate Impurity F CAS# NA M.F.: C29H35NO4 M.W.: 461.59 |
| |
QC062009 | Cefathiamidine Impurity I CAS# NA M.F.: C19H28N4O7S2 M.W.: 488.58 |
| |
QA150927 | Atomoxetine EP Impurity F CAS# NA M.F.: C17H20FNO M.W.: 273.35 |
| |
QP191627 | Phosphocreatine Disodium Salt Impurity 1 CAS# NA M.F.: C7H16N3O5P M.W.: 253.19 |
| |
QL142627 | Linezolid Impurity 27 CAS# 10389-51-2 M.F.: C10H12N2O3 M.W.: 208.21 |
| |
QL142626 | Linezolid Impurity 26 CAS# 348626-43-7 M.F.: C18H20N2O3 M.W.: 312.36 |
| |
QL142625 | Linezolid Impurity 25 CAS# 212325-40-1 M.F.: C12H15FN2O3 M.W.: 254.26 |
| |
QL142624 | Linezolid Impurity 24 CAS# 1138458-15-7 M.F.: C13H14ClFN2O3 M.W.: 300.71 |
| |
QP160527 | Prednisolone Dicarbonate CAS# NA M.F.: C26H34O9 M.W.: 490.54 |
| |
QI091613 | (S)-Ipratropium EP Impurity E CAS# 183626-76-8 M.F.: C19H27NO3 M.W.: 317.42 |
| |
QA070243 | Argatroban Impurity 17 CAS# 188659-43-0 M.F.: C22H34N4O5S M.W.: 466.59 |
| |
QT090906 | Thiamine EP Impurity F CAS# 6309-04-2;10593-44-9(free base) M.F.: C13H20Br2N4OS M.W.: 440.20 |
| |
QT090905 | Thiamine EP Impurity E CAS# 299-35-4 M.F.: C12H16N4OS2 M.W.: 296.41 |
| |
QT090903 | Thiamine EP Impurity C CAS# 7275-24-3 M.F.: C12H16Cl2N4S.HCl M.W.: 319.25 36.46 |
| |
QT090901 | Thiamine EP Impurity A CAS# 2380-61-2 M.F.: C12H16N4O4S2 M.W.: 344.41 |
| |
QC121305 | Clotrimazole EP Impurity E CAS# 5162-03-8 M.F.: C13H9ClO M.W.: 216.66 |
| |
QP132032 | Pemetrexed Impurity 6 CAS# NA M.F.: C25H28N6O9 M.W.: 556.52 |
| |
QB082431 | Bromhexine Impurity V CAS# 1797894-71-3 M.F.: C14H16Br2N2O M.W.: 388.10 |
| |
QT251940 | Thymalfasin Impurity Glu-Asn-OH CAS# NA M.F.: C9H15N3O6 M.W.: 261.24 |
| |
QT251937 | Thymalfasin Impurity Des-Ser1---Glu18-Tal CAS# NA M.F.: C51H85O21N13 M.W.: 1216.32 |
| |
QT251936 | Thymalfasin Impurity Ac-Ser1---Glu18-OH CAS# NA M.F.: C80H134O36N20 M.W.: 1952.07 |
| |
QT251935 | Thymalfasin Impurity Des-Ser1---Lys17-Tal CAS# NA M.F.: C56H92O24N14 M.W.: 1345.44 |
| |
QT251934 | Thymalfasin Impurity Ac-Ser1---Lys17-OH CAS# NA M.F.: C75H127O33N19 M.W.: 1822.96 |
| |
QL040304 | Lidocaine EP Impurity D CAS# 7728-40-7;7729-94-4(HCl salt) M.F.: C12H18N2O M.W.: 206.28 |
| |
QC-D091501 | Piperonylic Acid CAS# 94-53-1 M.F.: C8H6O4 M.W.: 166.13 |
| |
QF191616 | Fosaprepitant Impurity P CAS# 538-86-3 M.F.: C8H10O M.W.: 122.16 |
| |
QF191614 | Fosaprepitant Impurity N CAS# 1623-08-1 M.F.: C14H15O4P M.W.: 278.24 |
| |
QF191610 | Fosaprepitant Impurity J CAS# NA M.F.: C23H23F6N4O6P 2C7H17NO5 M.W.: 596.42 390.42 |
| |
QF191609 | Fosaprepitant Impurity I CAS# NA M.F.: C23H23F6N4O6P 2C7H17NO5 M.W.: 596.42 390.42 |
| |
QP132031 | Pemetrexed Impurity 5 CAS# NA M.F.: C22H25N5O6 M.W.: 455.46 |
| |
QL201523 | Letrozole Impurity 23 CAS# NA M.F.: C17H12N4O2 M.W.: 304.30 |
| |
QL142213 | Lenvatinib Impurity M CAS# 1788901-86-9 M.F.: C21H19ClN4O5 M.W.: 442.85 |
| |
QC120440 | Clindamycin Hydrochloride EP Impurity E CAS# NA M.F.: C18H31ClN2O5S M.W.: 422.97 |
| |
QD162433 | Dapoxetine Impurity 7 CAS# NA M.F.: C19H17N3O M.W.: 303.36 |
| |
QD162430 | Dapoxetine Impurity 4 CAS# NA M.F.: C21H23NO M.W.: 305.41 |
| |
QP180206 | Pregabalin Impurity F CAS# NA M.F.: C16H30N2O2 M.W.: 282.42 |
| |
QP180205 | Pregabalin Impurity E CAS# 1083246-65-4 M.F.: C16H32N2O3 M.W.: 300.44 |
| |
QP202244 | Pitavastatin Impurity 44 CAS# NA M.F.: C25H22FNO4 M.W.: 419.44 |
| |
QC062725 | Cefazolin EP Impurity I CAS# NA M.F.: C14H16N8O5S3 M.W.: 472.52 |
| |
QC062724 | Cefazolin Impurity 24 CAS# NA M.F.: C11H12N6O5S M.W.: 340.32 |
| |
QC131405 | Cefminox Sodium impurity 5 CAS# NA M.F.: C14H18N3NaO8S2 M.W.: 443.43 |
| |
QP180730 | Pregabalin Impurity 4 CAS# NA M.F.: C14H25NO6 M.W.: 303.35 |
| |
QP180729 | Pregabalin Impurity 3 CAS# NA M.F.: C20H35NO11 M.W.: 465.49 |
| |
QP180728 | Pregabalin Impurity 2 CAS# 501665-88-9 M.F.: C20H35NO11 M.W.: 465.49 |
| |
QC062723 | Cefazolin Impurity 23 CAS# NA M.F.: C14H14N8O4S3 M.W.: 454.51 |
| |
QC062722 | Cefazolin Impurity 22 CAS# NA M.F.: C14H14N8O4S3 M.W.: 454.51 |
| |
QC201837 | Cetirizine Impurity 37; USP Glyceryl ester of cetirizine CAS# 1243652-36-9 M.F.: C24H31ClN2O5 M.W.: 462.97 |
| |
QC201836 | Cetirizine Impurity 36;USP Propylene glycol ester of cetirizine CAS# NA M.F.: C24H31ClN2O4 M.W.: 446.97 |
| |
QF181906 | Furosemide EP Impurity F CAS# 4793-38-8 M.F.: C12H15ClN2O5S M.W.: 334.78 |
| |
QF181905 | Furosemide EP Impurity E CAS# 50-84-0 M.F.: C7H4Cl2O2 M.W.: 191.01 |
| |
QF181903 | Furosemide EP Impurity C CAS# 3086-91-7 M.F.: C7H7ClN2O4S M.W.: 250.66 |
| |
QF181902 | Furosemide EP Impurity B CAS# 2736-23-4 M.F.: C7H5Cl2NO4S M.W.: 270.09 |
| |
QF121113 | Fluconazole Impurity M CAS# NA M.F.: C11H9F2N3O M.W.: 237.21 |
| |
QE151334 | Esomeprazole Impurity 17 CAS# 91219-90-8 M.F.: C11H15NO3 M.W.: 209.24 |
| |
QE151332 | Esomeprazole Impurity 15 CAS# 102-51-2;59548-39-9(2HCl salt) M.F.: C7H10N2O M.W.: 138.17 |
| |
QP140828 | Penehyclidine Impurity 2 CAS# NA M.F.: C14H20O2 M.W.: 220.31 |
| |
QP140827 | Penehyclidine Impurity 1 CAS# 151673-91-5 M.F.: C13H18O2 M.W.: 206.28 |
| |
QD020747 | Dabigatran Impurity 18 CAS# 1854074-40-0 M.F.: C28H30N6O4 M.W.: 514.58 |
| |
QD020746 | Dabigatran Impurity 17 CAS# 1408238-39-0 M.F.: C33H38N6O6 M.W.: 614.69 |
| |
QD020744 | Dabigatran Impurity 15 CAS# 771459-37-1 M.F.: C26H27N7O3 M.W.: 485.54 |
| |
QD020743 | Dabigatran Impurity 14 CAS# 1422435-39-9;1408238-41-4(free base) M.F.: C19H22ClN5O2 M.W.: 387.86 |
| |
QD020742 | Dabigatran Impurity 13 CAS# 1427571-33-2 M.F.: C21H25ClN4O3 M.W.: 416.90 |
| |
QC030344 | Cinacalcet Impurity 13 CAS# NA M.F.: C17H17F3O3S M.W.: 358.38 |
| |
QC030343 | Cinacalcet Impurity 12 CAS# NA M.F.: C28H25F3N2O4S M.W.: 542.57 |
| |
QC030342 | Cinacalcet Impurity 11 CAS# NA M.F.: C18H16N2O4S M.W.: 356.40 |
| |
QP181604 | Pramipexole EP Impurity D CAS# 104632-27-1 M.F.: C10H19Cl2N3S M.W.: 284.25 |
| |
QA162998 | Apremilast Impurity R CAS# NA M.F.: C20H24N2O7S M.W.: 436.48 |
| |
QA162997 | Apremilast Impurity Q CAS# 1831833-38-5 M.F.: C12H16O4S M.W.: 256.32 |
| |
QA162994 | Apremilast Impurity N CAS# 1384439-79-5 M.F.: C19H18N2O7S M.W.: 418.42 |
| |
QA162990 | Apremilast Impurity J CAS# NA M.F.: C23H26N2O7S M.W.: 474.53 |
| |
QA162989 | Apremilast Impurity I CAS# NA M.F.: C22H24N2O7S M.W.: 460.50 |
| |
QA162986 | Apremilast Impurity F CAS# NA M.F.: C34H43N3O11S2 M.W.: 733.85 |
| |
QA178203 | Artemisinin Impurity 29 CAS# 82596-30-3 M.F.: C15H22O4 M.W.: 266.33 |
| |
QE200343 | Entecavir USP Related Compound A CAS# NA M.F.: C27H31N5O2Si M.W.: 485.65 |
| |
QC120435 | Clindamycin Impurity 8 CAS# 22431-46-5 M.F.: C18H33ClN2O6S M.W.: 440.98 |
| |
QC120434 | Clindamycin Impurity 7 CAS# 22965-79-3 M.F.: C9H18ClNO4S M.W.: 271.76 |
| |
QL140305 | Lincomycin Hydrochloride EP Impurity E CAS# 6734-79-8;13380-36-4(free base) M.F.: C9H17NO2.HCl M.W.: 171.24 36.46 |
| |
QC062401 | Ceftriaxone EP Impurity A CAS# 92143-31-2;97164-54-0(2Na salt) M.F.: C18H18N8O7S3 M.W.: 554.58 |
| |
QC062405 | Ceftriaxone EP Impurity E CAS# 58909-56-1 M.F.: C12H13N5O5S2 M.W.: 371.39 |
| |
QC120433 | Clindamycin Phosphate EP Impurity H; Clindamycin 2,3-Bisphosphate CAS# NA M.F.: C18H35ClN2O11P2S M.W.: 584.94 |
| |
QC120432 | Clindamycin Phosphate EP Impurity K CAS# NA M.F.: C36H66Cl2N4O15P2S2 M.W.: 991.91 |
| |
QC120429 | Clindamycin Phosphate EP Impurity I CAS# 1309048-48-3 M.F.: C18H35ClN2O11P2S M.W.: 584.94 |
| |
QC120428 | Clindamycin Phosphate EP Impurity G CAS# NA M.F.: C18H33N2O8PS M.W.: 468.50 |
| |
QC120427 | Clindamycin Phosphate EP Impurity A; Clindamycin Hydrochloride EP Impurity A; Lincomycin CAS# 154-21-2;859-18-7(HCl salt); 7179-49-9(hydrochloride monohydrate) M.F.: C18H34N2O6S M.W.: 406.54 |
| |
QC062404 | Ceftriaxone EP Impurity D CAS# 80756-85-0 M.F.: C13H10N4O2S3 M.W.: 350.44 |
| |
QC062403 | Ceftriaxone EP Impurity C CAS# 58909-39-0 M.F.: C4H5N3O2S M.W.: 159.17 |
| |
QC160731 | Clopidogrel EP Impurity F CAS# 141109-20-8 M.F.: C15H16ClNO2S M.W.: 309.81 |
| |
QA202263 | Atorvastatin Impurity 13 CAS# 1316291-19-6 (Na salt);873950-17-5 M.F.: C33H35FN2O7 M.W.: 590.64 |
| |
QC160719 | Clopidogrel Amide Racemate CAS# 90055-68-8 (free base) M.F.: C15H16Cl2N2OS M.W.: 343.27 |
| |
QI132033 | Imatinib Impurity 33 CAS# 581076-64-4 M.F.: C8H12N4 M.W.: 164.21 |
| |
QL220106 | Levalbuterol USP Related Compound F CAS# 174607-68-2 M.F.: C20H27NO3 M.W.: 329.43 |
| |
QL220101 | Levalbuterol USP Related Compound A CAS# 1823256-56-9 M.F.: C13H21NO2 M.W.: 223.31 |
| |
QA164109 | Avanafil Impurity I CAS# 1452128-53-8 M.F.: C18H17ClN6O3 M.W.: 400.82 |
| |
QP160454 | Paliperidone Impurity 28 CAS# 1138463-56-5 M.F.: C11H13ClN2O2 M.W.: 240.69 |
| |
QE201805 | Emtricitabine Impurity E CAS# NA M.F.: C8H9FN2O4S M.W.: 248.23 |
| |
QE200341 | Entecavir Impurity 41 CAS# NA M.F.: C12H15N5O4 M.W.: 293.28 |
| |
QP020317 | Palbociclib Impurity Q CAS# 827022-35-5 M.F.: C33H45N7O4 M.W.: 603.75 |
| |
QP202241 | Pitavastatin Impurity 41 CAS# 1611499-16-1;2276678-27-2(Na salt) M.F.: C25H24FNO5 M.W.: 437.46 |
| |
QE192016 | Escitalopram EP Impurity L oxalate CAS# 1093072-86-6;1026009-77-7(free base) M.F.: C20H22N2O.C2H2O4 M.W.: 306.40 90.03 |
| |
QE192015 | Escitalopram Impurity P CAS# NA M.F.: C20H21FN2O.C2H2O4 M.W.: 324.40 90.03 |
| |
QV010337 | Valaciclovir Impurity K CAS# NA M.F.: C13H21ClN6O4 M.W.: 360.80 |
| |
QT130203 | Trimebutine Impurity C CAS# NA M.F.: C10H11NO M.W.: 161.08 |
| |
QA121803 | Allura Red Impurity 3 CAS# 61551-82-4 M.F.: C20H12Na2O7S2 M.W.: 474.41 |
| |
QA121802 | Allura Red Impurity 2 CAS# 6471-78-9 M.F.: C8H11NO4S M.W.: 217.24 |
| |
QA121801 | Allura Red Impurity 1 CAS# 135-76-2;93-01-6(free base) M.F.: C10H7NaO4S M.W.: 246.21 |
| |
QP190333 | Posaconazole Impurity 2 CAS# NA M.F.: C47H52N8O5 M.W.: 808.97 |
| |
QE221329 | Everolimus Impurity 29 CAS# 1708118-13-1 M.F.: C53H83NO14 M.W.: 958.22 |
| |
QC242020 | Cefoxitin Impurity 20 CAS# NA M.F.: C16H17N3O7S2 M.W.: 427.45 |
| |
QD170600 | Diquafosol sodium CAS# 211427-08-6 M.F.: C18H22N4Na4O23P4 M.W.: 878.23 |
| |
QC031232 | Cefaclor Impurity 6 CAS# NA M.F.: C15H14ClN3O5S M.W.: 383.81 |
| |
QP180736 | Pregabalin Impurity 10 CAS# 181289-34-9 M.F.: C9H17NO3 M.W.: 187.24 |
| |
QB151429 | Bromfenac Impurity 3 CAS# 1644279-16-2 M.F.: C30H18Br2N2O3 M.W.: 614.28 |
| |
QB151431 | Bromfenac Impurity 5 Sodium Salt CAS# 1391052-54-2;241825-87-6(free base) M.F.: C15H9BrNNaO4 M.W.: 370.13 |
| |
QB151430 | Bromfenac Impurity 4 Sodium salt CAS# 241496-82-2 (free base) M.F.: C14H9BrNNaO3 M.W.: 342.12 |
| |
QC202437 | Cefotaxime Impurity 11 CAS# NA M.F.: C32H34N10O14S4 M.W.: 910.93 |
| |
QC202435 | Cefotaxime Impurity 9 CAS# NA M.F.: C15H19N5O6S2 M.W.: 429.47 |
| |
QC202434 | Cefotaxime Impurity 8 CAS# NA M.F.: C16H19N5O8S2 M.W.: 473.48 |
| |
QC202431 | Cefotaxime Impurity 5 CAS# 64485-89-8 M.F.: C27H25N3O3S M.W.: 471.57 |
| |
QC202430 | Cefotaxime Impurity 4 CAS# 64485-88-7 M.F.: C8H11N3O3S M.W.: 229.26 |
| |
QC202429 | Cefotaxime Impurity 3 CAS# NA M.F.: C7H10BrNO4 M.W.: 252.06 |
| |
QC202428 | Cefotaxime Impurity 2 CAS# 66340-86-1 M.F.: C7H11NO4 M.W.: 173.17 |
| |
QT060367 | Tofacitinib Impurity 67 CAS# NA M.F.: C26H26Cl2N8 M.W.: 521.44 |
| |
QE201803 | Emtricitabine Impurity C CAS# NA M.F.: C8H9FN2O5S M.W.: 264.23 |
| |
QS061902 | Sulfasalazine EP Impurity B CAS# 1391062-49-9 M.F.: C29H22N8O7S2 M.W.: 658.66 |
| |
QT060366 | Tofacitinib Impurity 66 CAS# 10132-07-7 M.F.: C4H3Cl2N3 M.W.: 163.99 |
| |
QA261933 | Azilsartan CAS# 147403-03-0 M.F.: C25H20N4O5 M.W.: 456.45 |
| |
QT140654 | Tenofovir Impurity 27 CAS# NA M.F.: C12H20N5O4P M.W.: 329.29 |
| |
QT140652 | Tenofovir Impurity 25 CAS# 2488598-61-2 M.F.: C15H18N5O4P M.W.: 363.31 |
| |
QT140647 | Tenofovir Impurity 21 CAS# NA M.F.: C6H13NO2 M.W.: 131.17 |
| |
QT140646 | Tenofovir Impurity 20 CAS# 147127-19-3 M.F.: C9H14N5O4P M.W.: 287.21 |
| |
QP812518 | Paclitaxel EP Impurity R CAS# 158948-96-0 M.F.: C45H55NO14 M.W.: 833.92 |
| |
QP812517 | Paclitaxel EP Impurity Q CAS# 2243233-98-7 M.F.: C46H55NO14 M.W.: 845.93 |
| |
QP812516 | Paclitaxel EP Impurity P CAS# 173101-56-9 M.F.: C48H53NO14 M.W.: 867.93 |
| |
QP812515 | Paclitaxel EP Impurity O; N-cinnamoyl-N-debenzoylpaclitaxel CAS# 219783-77-4 M.F.: C49H53NO14 M.W.: 879.94 |
| |
QP812514 | Paclitaxel EP Impurity N;Baccatin III CAS# 27548-93-2 M.F.: C31H38O11 M.W.: 586.63 |
| |
QP812513 | Paclitaxel EP Impurity M CAS# NA M.F.: C47H53NO15 M.W.: 871.92 |
| |
QP812512 | Paclitaxel EP Impurity L CAS# 92950-39-5 M.F.: C49H53NO15 M.W.: 895.94 |
| |
QP812511 | Paclitaxel EP Impurity K CAS# 148930-55-6 M.F.: C53H65NO14Si M.W.: 968.17 |
| |
QP812510 | Paclitaxel EP Impurity J CAS# NA M.F.: C49H53NO15 M.W.: 895.94 |
| |
QP812509 | Paclitaxel EP Impurity I CAS# 2157462-42-3 M.F.: C61H62N2O16 M.W.: 1079.15 |
| |
QP812504 | Paclitaxel EP Impurity D;7-epi-Cephalomannine CAS# 150547-36-7 M.F.: C45H53NO14 M.W.: 831.90 |
| |
QP812503 | Paclitaxel EP Impurity C;Paclitaxel C CAS# 153415-45-3 M.F.: C46H57NO14 M.W.: 847.94 |
| |
QP812502 | Paclitaxel EP Impurity B; Cephalomannine CAS# 71610-00-9 M.F.: C45H53NO14 M.W.: 831.90 |
| |
QP812501 | Paclitaxel EP Impurity A CAS# 173101-54-7 M.F.: C45H53NO14 M.W.: 831.90 |
| |
QP812500 | Paclitaxel;Docetaxel EP Impurity F CAS# 33069-62-4 M.F.: C47H51NO14 M.W.: 853.91 |
| |
QE122029 | Erlotinib Impurity 3 CAS# 183320-15-2 M.F.: C23H23N3O5 M.W.: 421.45 |
| |
QE122028 | Erlotinib Impurity 2 CAS# 2512209-22-0;2712530-31-7(HCl salt) M.F.: C15H23NO6 M.W.: 313.35 |
| |
QE122027 | Erlotinib Impurity 1 CAS# 183322-21-6 M.F.: C12H11Cl3N2O2 M.W.: 321.59 |
| |
QI220226 | Ivabradine N-Oxide CAS# 2511244-97-4 M.F.: C27H36N2O6 M.W.: 484.58 |
| |
QA202261 | Atorvastatin Impurity 11 CAS# NA M.F.: C44H56FN3O8 M.W.: 773.93 |
| |
QA202234 | Atorvastatin Impurity O CAS# NA M.F.: C37H42F2N2O5 M.W.: 632.74 |
| |
QA202249 | Atorvastatin Impurity Ⅵ CAS# NA M.F.: C37H44N2O5 M.W.: 596.76 |
| |
QA202247 | Atorvastatin Impurity Ⅳ CAS# 693793-87-2 M.F.: C40H46F2N2O5 M.W.: 672.80 |
| |
QA202244 | Atorvastatin Impurity Ⅲ CAS# 1105067-91-1 M.F.: C40H48N2O5 M.W.: 636.82 |
| |
QA202243 | Atorvastatin Impurity Ⅱ CAS# 125995-13-3 M.F.: C14H27NO4 M.W.: 273.37 |
| |
QA202242 | Atorvastatin Impurity Ⅰ CAS# 125971-96-2 M.F.: C26H24FNO3 M.W.: 417.47 |
| |
QA202260 | Atorvastatin Impurity 10 CAS# 2088732-01-6 M.F.: C14H27NO4 M.W.: 273.37 |
| |
QA202258 | Atorvastatin Impurity 8 CAS# 947586-93-8 M.F.: C14H27NO4 M.W.: 273.37 |
| |
QA202257 | Atorvastatin Impurity 7 CAS# 125971-94-0 M.F.: C14H23NO4 M.W.: 269.34 |
| |
QA202254 | Atorvastatin Impurity 4 CAS# 444577-70-2 M.F.: C26H25NO3 M.W.: 399.48 |
| |
QA202252 | Atorvastatin Impurity 2 CAS# 125971-57-5 M.F.: C19H19NO2 M.W.: 293.36 |
| |
QA202251 | Atorvastatin Impurity 1 CAS# 124401-38-3 M.F.: C12H15NO2 M.W.: 205.25 |
| |
QC-P131201 | Pimelic acid;Adipic acid EP Impurity C CAS# 111-16-0 M.F.: C7H12O4 M.W.: 160.17 |
| |
QL091627 | Lipoic Acid Impurity 1 CAS# NA M.F.: C18H32N2O2S4 M.W.: 436.72 |
| |
QP190336 | Posaconazole Impurity 36 CAS# 213381-02-3 M.F.: C37H42F2N8O4 M.W.: 700.78 |
| |
QP190342 | Posaconazole Impurity 42 CAS# 2243785-96-6 M.F.: C37H42F2N8O4 M.W.: 700.78 |
| |
QF140207 | Fenofibrate EP Impurity G CAS# 217636-48-1 M.F.: C24H27ClO6 M.W.: 446.92 |
| |
QF140201 | Fenofibrate EP Impurity A CAS# 42019-78-3 M.F.: C13H9ClO2 M.W.: 232.66 |
| |
QP190334 | Posaconazole Impurity 34 CAS# 2173414-68-9 M.F.: C13H20N2O2 M.W.: 236.31 |
| |
QP190332 | Posaconazole Impurity 19 CAS# NA M.F.: C20H18ClF2N3O4S M.W.: 469.89 |
| |
QP190331 | Posaconazole Impurity 16 CAS# 2243786-07-2 M.F.: C20H18ClF2N3O4S M.W.: 469.89 |
| |
QP190330 | Posaconazole Impurity 15 CAS# 2423024-27-3 M.F.: C20H18ClF2N3O4S M.W.: 469.89 |
| |
QC061229 | Cephalexin Impurity 3 CAS# NA M.F.: C16H19N3O5S M.W.: 365.40 |
| |
QC061228 | Cephalexin Impurity 2 CAS# 6485-67-2 M.F.: C8H10N2O M.W.: 150.18 |
| |
QC061226 | Cephalexin Impurity 1 CAS# 19883-41-1;24461-61-8(free base) M.F.: C9H12ClNO2 M.W.: 201.65 |
| |
QC221210 | Clavulanate Potassium EP Impurity A CAS# 4744-51-8 M.F.: C8H12N2O2 M.W.: 168.19 |
| |
QC242006 | Cefoxitin Sodium EP Impurity F (S-methoxy cefoxitin) CAS# NA M.F.: C17H19N3O8S2 M.W.: 457.48 |
| |
QC242010 | Cefoxitin Sodium EP Impurity E (R-methoxy cefoxitin) CAS# NA M.F.: C17H19N3O8S2 M.W.: 457.48 |
| |
QL062415 | Levofloxacin Impurity I CAS# 431058-46-7 M.F.: C15H14FNO4 M.W.: 291.27 |
| |
QC081331 | Calcitriol EP Impurity A CAS# 73837-24-8 M.F.: C27H44O3 M.W.: 416.65 |
| |
QC061851 | Cefuroxime Impurity 10 CAS# NA M.F.: C16H15N4NaO9S M.W.: 462.37 |
| |
QT060358 | Tofacitinib Impurity 32 CAS# NA M.F.: C20H24ClN5 M.W.: 369.89 |
| |
QT060357 | Tofacitinib Impurity 31 CAS# NA M.F.: C20H24ClN5 M.W.: 369.89 |
| |
QT060356 | Tofacitinib Impurity 30 CAS# NA M.F.: C20H24ClN5 M.W.: 369.89 |
| |
QL052228 | Levocetirizine Impurity 2 CAS# 300543-56-0 M.F.: C17H19ClN2 M.W.: 286.81 |
| |
QG130306 | Gemcitabine Impurity E CAS# NA M.F.: C23H19F2N3O6 M.W.: 471.41 |
| |
QG130307 | Gemcitabine Impurity G CAS# NA M.F.: C16H16ClF2N3O5 M.W.: 403.77 |
| |
QG130331 | Gemcitabine EP Impurity B CAS# 95058-85-8;122111-05-1 (HCl salt) M.F.: C9H11F2N3O4 M.W.: 263.20 |
| |
QG130329 | Gemcitabine Impurity 3 CAS# 1173824-58-2 M.F.: C19H16F2O6 M.W.: 378.32 |
| |
QG130328 | Gemcitabine Impurity 2 CAS# 134877-43-3 M.F.: C20H18F2O8S M.W.: 456.41 |
| |
QG130327 | Gemcitabine Impurity 1 CAS# 134877-42-2 M.F.: C20H18F2O8S M.W.: 456.41 |
| |
QC061849 | Cefuroxime Impurity 8 CAS# NA M.F.: C8H10N2O4S M.W.: 230.24 |
| |
QF141928 | Finasteride Impurity 2 CAS# NA M.F.: C23H36N2O3 M.W.: 388.54 |
| |
QC071203 | Carglumic Acid Impurity 3 CAS# NA M.F.: C7H11N3O6 M.W.: 233.18 |
| |
QC071202 | Carglumic Acid Impurity 2 CAS# NA M.F.: C11H17N3O8 M.W.: 319.27 |
| |
QC071201 | Carglumic Acid Impurity 1 CAS# NA M.F.: C12H18N4O9 M.W.: 362.29 |
| |
QH042407 | Hydroxychloroquine O-Acetate CAS# 47493-14-1 M.F.: C20H28ClN3O2 M.W.: 377.92 |
| |
QT060355 | Tofacitinib Impurity 29 CAS# 2504210-38-0 M.F.: C19H22N8 M.W.: 362.43 |
| |
QT060354 | Tofacitinib Impurity 28 CAS# NA M.F.: C23H31N7O3 M.W.: 453.54 |
| |
QT060353 | Tofacitinib Impurity 27 CAS# 2227199-31-5 M.F.: C20H29N5O3 M.W.: 387.48 |
| |
QA070231 | Argatroban Impurity 5 CAS# 20668-20-6 M.F.: C10H13N M.W.: 147.22 |
| |
QE022002 | Ebastine EP Impurity B CAS# 943-27-1 M.F.: C12H16O M.W.: 176.25 |
| |
QA122210 | Alvimopan (2R, 3S, 4S)-Isomer CAS# NA M.F.: C25H32N2O4 M.W.: 424.53 |
| |
QC160718 | 2-Oxo Clopidogrel Hydrochloride CAS# 1219432-42-4 ;109904-27-0(free base) M.F.: C16H17Cl2NO3S M.W.: 374.28 |
| |
QT261841 | Tazarotenic Acid Sulfoxide CAS# 603952-64-3 M.F.: C19H17NO3S M.W.: 339.42 |
| |
QD031230 | Daclatasvir Impurity 30 CAS# NA M.F.: C38H48N8O4 M.W.: 680.84 |
| |
QD031235 | Daclatasvir Impurity 35 CAS# NA M.F.: C41H52N8O6 M.W.: 752.90 |
| |
QC031208 | Cefaclor EP Impurity H CAS# NA M.F.: C23H21ClN4O5S M.W.: 500.95 |
| |
QA201804 | Aztreonam USP Impurity D CAS# 102579-59-9 (free base) M.F.: C13H17N5O5S.C2HF3O2 M.W.: 355.37 114.02 |
| |
QA040628 | Adefovir Impurity 1 CAS# NA M.F.: C26H42N5O10P M.W.: 615.61 |
| |
QA040627 | Adefovir Dipivoxil Intermediate CAS# 116384-53-3 M.F.: C12H20N5O4P M.W.: 329.29 |
| |
QD122040 | Dolutegravir CAS# 1051375-16-6;1051375-19-9(Na salt) M.F.: C20H19F2N3O5 M.W.: 419.38 |
| |
QD020739 | Dabigatran Impurity 10 CAS# 1610758-19-4 M.F.: C35H43N7O5 M.W.: 641.76 |
| |
QD020736 | Dabigatran Impurity 7 CAS# NA M.F.: C10H14N2O2 M.W.: 194.23 |
| |
QS180609 | Sorafenib tosylate Impurity I CAS# 1129683-83-5 M.F.: C14H10ClF3N2O2 M.W.: 330.69 |
| |
QA070227 | Argatroban Impurity 1 CAS# 153886-69-2 M.F.: C10H9NO3S M.W.: 223.25 |
| |
QA200328 | Atracurium Besylate Impurity 2 CAS# NA M.F.: C58H74N2O15S M.W.: 1071.28 |
| |
QL220327 | Levocarnitine Impurity 27 CAS# 2788-28-5 M.F.: C7H15ClN2O M.W.: 178.66 |
| |
QT260422 | Trazodone hydrochloride Impurity V CAS# NA M.F.: C13H18Cl2N4O M.W.: 317.21 |
| |
QT260419 | Trazodone hydrochloride Impurity S CAS# NA M.F.: C19H22ClN5O2 M.W.: 387.86 |
| |
QT260418 | Trazodone hydrochloride Impurity R CAS# 1263358-12-8;1263278-79-0(HCl salt) M.F.: C19H21Cl2N5O M.W.: 406.31 |
| |
QT260417 | Trazodone hydrochloride Impurity Q CAS# NA M.F.: C19H22ClN5O3 M.W.: 403.86 |
| |
QT260413 | Trazodone hydrochloride Impurity M CAS# NA M.F.: C14H21Cl2N3 M.W.: 302.24 |
| |
QT260412 | Trazodone hydrochloride Impurity L CAS# 32229-98-4 M.F.: C13H19ClN2O M.W.: 254.76 |
| |
QT260411 | Trazodone hydrochloride Impurity K CAS# NA M.F.: C10H14Cl2N2 M.W.: 233.14 |
| |
QT260409 | Trazodone hydrochloride Impurity I CAS# NA M.F.: C15H14N6O2 M.W.: 310.31 |
| |
QT260408 | Trazodone hydrochloride Impurity H CAS# 6323-09-7;2408971-27-5(2HCl salt) M.F.: C23H30Cl2N4 M.W.: 433.42 |
| |
QT260407 | Trazodone hydrochloride EP Impurity G CAS# 2470436-00-9;2470441-00-8(HCl salt) M.F.: C17H27ClN2O M.W.: 310.86 |
| |
QT260405 | Trazodone hydrochloride Impurity E CAS# 1346599-35-6 M.F.: C21H26ClN5O M.W.: 399.92 |
| |
QT260403 | Trazodone hydrochloride Impurity C CAS# 157072-19-0;1263278-77-8(HCl salt) M.F.: C19H22ClN5O M.W.: 371.86 |
| |
QT260402 | Trazodone hydrochloride Impurity B CAS# 62337-66-0 M.F.: C19H23N5O M.W.: 337.42 |
| |
QE151331 | Esomeprazole Impurity 14 CAS# 1227380-90-6;2227107-89-1(NH4+ salt) M.F.: C16H15N3O4 M.W.: 313.31 |
| |
QI220224 | Ivabradine Impurity 5 CAS# 304464-98-0 M.F.: C26H34N2O5 M.W.: 454.56 |
| |
QB031431 | Bucinnazine hydrochloride Impurity 5 CAS# NA M.F.: C9H18N2O M.W.: 170.25 |
| |
QB031429 | Bucinnazine hydrochloride Impurity 3 CAS# NA M.F.: C13H18N2O M.W.: 218.29 |
| |
QB031428 | Bucinnazine hydrochloride Impurity 2 CAS# NA M.F.: C14H18N2O M.W.: 230.31 |
| |
QB031427 | Bucinnazine hydrochloride Impurity 1 CAS# NA M.F.: C5H10N2O M.W.: 114.15 |
| |
QA070241 | Argatroban Impurity 15 CAS# NA M.F.: C11H11NO3S M.W.: 237.27 |
| |
QA070240 | Argatroban Impurity 14 CAS# NA M.F.: C12H13NO3S M.W.: 251.30 |
| |
QA070237 | Argatroban Impurity 11 CAS# 2423016-01-5 M.F.: C23H35N5O6S M.W.: 509.62 |
| |
QL040327 | Lidocaine Impurity 1 CAS# 294852-91-8 M.F.: C18H22N2O M.W.: 282.38 |
| |
QC030340 | Cinacalcet Impurity 9 CAS# NA M.F.: C22H23ClF3NO M.W.: 409.87 |
| |
QC030339 | Cinacalcet Impurity 8 CAS# 1224568-02-8;1273259-50-9(HCl) M.F.: C22H22F3NO M.W.: 373.41 |
| |
QC120430 | Clindamycin Phosphate EP Impurity D; Clindamycin 4-Phosphate CAS# 54887-30-8 M.F.: C18H34ClN2O8PS M.W.: 504.96 |
| |
QC182534 | 1-Methoxy Canagliflozin CAS# 1358581-37-9 M.F.: C25H27FO6S M.W.: 474.54 |
| |
QC060427 | Cefodizime Impurity 1 CAS# 120533-30-4 M.F.: C20H20N6O7S4 M.W.: 584.67 |
| |
QB201438 | Bortezomib Impurity 12 CAS# NA M.F.: C24H38BClN2O3 M.W.: 448.83 |
| |
QB201436 | Bortezomib Impurity 10 CAS# NA M.F.: C24H38BClN2O3 M.W.: 448.83 |
| |
QP182446 | Paroxetine Impurity 8 CAS# NA M.F.: C14H21NO2 M.W.: 235.32 |
| |
QP182445 | Paroxetine Impurity 7 CAS# NA M.F.: C13H19NO M.W.: 205.30 |
| |
QP136040 | Pidotimod Impurity 14 CAS# NA M.F.: C10H12N2O4S M.W.: 256.28 |
| |
QP180631 | Pirfenidone Impurity 5 CAS# NA M.F.: C13H13N3O2 M.W.: 243.26 |
| |
QP180630 | Pirfenidone Impurity 4 CAS# NA M.F.: C25H21N5O4 M.W.: 455.47 |
| |
QP180628 | Pirfenidone Impurity 2 CAS# 284462-78-8 M.F.: C13H13N3O2 M.W.: 243.26 |
| |
QP180627 | Pirfenidone Impurity 1 CAS# 1153328-25-6 M.F.: C13H13N3O2 M.W.: 243.26 |
| |
QF132009 | Formoterol EP Impurity I CAS# 532414-36-1 M.F.: C19H24N2O4 M.W.: 344.40 |
| |
QP081815 | Phloroglucinol EP Impurity O CAS# 137-19-9 M.F.: C6H4Cl2O2 M.W.: 179.00 |
| |
QP081812 | Phloroglucinol EP Impurity L CAS# 626-43-7 M.F.: C6H5Cl2N M.W.: 162.02 |
| |
QP081809 | Phloroglucinol EP Impurity I CAS# 87-65-0 M.F.: C6H4Cl2O M.W.: 163.00 |
| |
QP081805 | Phloroglucinol EP Impurity E CAS# 533-73-3 M.F.: C6H6O3 M.W.: 126.11 |
| |
QP081804 | Phloroglucinol EP Impurity D CAS# 491-45-2 M.F.: C12H10O5 M.W.: 234.20 |
| |
QP081801 | Phloroglucinol EP Impurity A CAS# 87-66-1 M.F.: C6H6O3 M.W.: 126.11 |
| |
QC202600 | Ceftizoxime sodium CAS# 68401-82-1 M.F.: C13H12N5NaO5S2 M.W.: 405.38 |
| |
QP156507 | Progesterone EP Impurity G CAS# 2257421-79-5 M.F.: C27H38O2 M.W.: 394.59 |
| |
QP156503 | Progesterone EP Impurity C CAS# 145-15-3 M.F.: C21H32O2 M.W.: 316.49 |
| |
QP156501 | Progesterone EP Impurity A CAS# 24377-08-0 M.F.: C21H28O2 M.W.: 312.45 |
| |
QD241332 | Dexamethasone Acetate EP Impurity I CAS# 3949-26-6 M.F.: C26H33FO7 M.W.: 476.53 |
| |
QD241309 | Dexamethasone EP Impurity I CAS# 14622-47-0 M.F.: C22H28O5 M.W.: 372.45 |
| |
QP131215 | Pomalidomide Impurity O CAS# 50-35-1 M.F.: C13H10N2O4 M.W.: 258.23 |
| |
QP131206 | Pomalidomide Impurity F CAS# 191732-76-0 M.F.: C13H11N3O4 M.W.: 273.24 |
| |
QP131213 | Pomalidomide Impurity M CAS# 5434-20-8;6946-22-1(HCl salt) M.F.: C8H7NO4 M.W.: 181.15 |
| |
QP131205 | Pomalidomide Impurity E CAS# 19171-18-7 M.F.: C13H9N3O6 M.W.: 303.23 |
| |
QP131203 | Pomalidomide Impurity C CAS# 918314-45-1 M.F.: C13H13N3O5 M.W.: 291.26 |
| |
QP131210 | Pomalidomide Impurity J CAS# 2635-64-5 M.F.: C13H13N3O5 M.W.: 291.26 |
| |
QP131202 | Pomalidomide Impurity B CAS# 497147-11-2 M.F.: C13H11N3O5 M.W.: 289.24 |
| |
QF030333 | Famciclovir Impurity 7 CAS# 127205-22-5 M.F.: C10H15N5O3 M.W.: 253.26 |
| |
QB131600 | Bimatoprost Acid CAS# 38344-08-0 M.F.: C23H32O5 M.W.: 388.50 |
| |
QB131627 | Bimatoprost Impurity 1; (15R)-Bimatoprost CAS# 1163135-92-9 M.F.: C25H37NO4 M.W.: 415.57 |
| |
QT060352 | Tofacitinib Impurity 26 CAS# 1812890-23-5 M.F.: C13H21N5 M.W.: 247.34 |
| |
QT060351 | Tofacitinib Impurity 25 CAS# NA M.F.: C16H20N6O2 M.W.: 328.37 |
| |
QT060350 | Tofacitinib Impurity 24 CAS# 2459302-85-1 M.F.: C21H27N7O3 M.W.: 425.48 |
| |
QT060348 | Tofacitinib Impurity 22 CAS# 1640972-35-5;1809002-40-1(citrate salt) M.F.: C16H22N6O M.W.: 314.39 |
| |
QA120712 | Alogliptin Impurity L CAS# NA M.F.: C18H22N4O4 M.W.: 358.39 |
| |
QA120711 | Alogliptin Impurity K CAS# 865758-98-1 M.F.: C17H19N5O2 M.W.: 325.37 |
| |
QA120710 | Alogliptin Impurity J CAS# 2089611-85-6 M.F.: C18H21N5O2 M.W.: 339.39 |
| |
QL050318 | Lercanidipine Impurity 4 CAS# 1119226-97-9 M.F.: C35H37N3O6 M.W.: 595.68 |
| |
QT120200 | Tulobuterol Hydrochloride CAS# 56776-01-3;41570-61-0(free base) M.F.: C12H19Cl2NO M.W.: 264.19 |
| |
QA070203 | Argatroban Impurity C CAS# 951130-92-0 M.F.: C23H32N6O5S M.W.: 504.60 |
| |
QA070201 | Argatroban Impurity A CAS# 1448301-07-2 M.F.: C23H35N7O7S M.W.: 553.63 |
| |
QC030337 | Cinacalcet Impurity 7 CAS# NA M.F.: C23H25ClF3N M.W.: 407.90 |
| |
QC030336 | Cinacalcet Impurity 6 CAS# 1020414-33-8 ;802918-35-0(free base) M.F.: C22H25ClF3N M.W.: 395.89 |
| |
QC030335 | Cinacalcet Impurity 5 CAS# NA M.F.: C13H15N M.W.: 185.26 |
| |
QC030334 | Cinacalcet Impurity 4 CAS# NA M.F.: C12H16ClN M.W.: 209.72 |
| |
QC030332 | Cinacalcet Impurity 2 CAS# NA M.F.: C12H18ClN M.W.: 211.73 |
| |
QD020735 | Dabigatran Etexilate Impurity 6 CAS# NA M.F.: C13H14N4O M.W.: 242.28 |
| |
QD020734 | Dabigatran Etexilate Impurity 5 CAS# NA M.F.: C11H14N2O4 M.W.: 238.24 |
| |
QD020733 | Dabigatran Etexilate Impurity 4 CAS# 104961-64-0 M.F.: C8H10N2O2 M.W.: 166.18 |
| |
QD020732 | Dabigatran Etexilate Impurity 3 CAS# 89-41-8 M.F.: C8H7NO5 M.W.: 197.14 |
| |
QD020730 | Dabigatran Etexilate Impurity 1 CAS# 36242-50-9 M.F.: C9H10N2O4 M.W.: 210.19 |
| |
QH042430 | Hydroxychloroquine sulfate EP Impurity G CAS# 86-98-6 M.F.: C9H5Cl2N M.W.: 198.05 |
| |
QH042429 | Hydroxychloroquine sulfate Impurity 3 CAS# 86-99-7 M.F.: C9H6ClNO M.W.: 179.60 |
| |
QH042428 | Hydroxychloroquine sulfate Impurity 2 CAS# 5891-21-4 M.F.: C5H9ClO M.W.: 120.58 |
| |
QH042427 | Hydroxychloroquine sulfate Impurity 1 CAS# 21617-18-5 M.F.: C9H5Cl2N M.W.: 198.05 |
| |
QC182533 | Canagliflozin Impurity 7 CAS# NA M.F.: C24H25FO5S M.W.: 444.52 |
| |
QE200331 | Entecavir EP Impurity F CAS# 649761-24-0 M.F.: C27H31N5O2Si M.W.: 485.65 |
| |
QP080504 | Phenytoin Sodium EP Impurity D CAS# 5157-15-3 M.F.: C16H14N4O2 M.W.: 294.32 |
| |
QT041243 | Tadalafil Impurity 21 CAS# NA M.F.: C19H17ClN2O4 M.W.: 372.80 |
| |
QT022001 | Terbutaline EP Impurity A CAS# 99-10-5 M.F.: C7H6O4 M.W.: 154.12 |
| |
QT060347 | Tofacitinib Impurity 21 CAS# NA M.F.: C23H26N6O3S M.W.: 466.56 |
| |
QE131927 | Exemestane Impurity 1 CAS# NA M.F.: C19H26O2 M.W.: 286.41 |
| |
QO022031 | Obeticholic Acid Impurity 5 CAS# 1537866-49-1 M.F.: C26H46O3 M.W.: 406.65 |
| |
QO022029 | Obeticholic Acid Impurity 3 CAS# 1908444-28-9 M.F.: C52H86O7 M.W.: 823.24 |
| |
QO022027 | Obeticholic Acid Impurity 1 CAS# 1708092-13-0 M.F.: C26H44O4 M.W.: 420.63 |
| |
QO022028 | Obeticholic Acid Impurity 2 CAS# 915038-27-6 M.F.: C26H44O4 M.W.: 420.63 |
| |
QL191833 | Lesinurad Impurity 13 CAS# NA M.F.: C17H13Br2N3O2S M.W.: 483.18 |
| |
QL191832 | Lesinurad Impurity 12 CAS# NA M.F.: C17H12Br3N3O2S M.W.: 562.07 |
| |
QL191831 | Lesinurad Impurity 11 CAS# NA M.F.: C17H14BrN3O2S M.W.: 404.28 |
| |
QL191824 | Lesinurad Impurity 4 CAS# 1533519-97-9 M.F.: C17H14BrN3O2S M.W.: 404.28 |
| |
QL191830 | Lesinurad Impurity 10 CAS# NA M.F.: C16H14BrN3O2S M.W.: 392.27 |
| |
QL191828 | Lesinurad Impurity 8 CAS# 1158970-49-0 M.F.: C15H12BrN3O2S M.W.: 378.25 |
| |
QG131814 | Gimeracil Impurity 14 CAS# 89942-45-0 M.F.: C8H7NO M.W.: 133.15 |
| |
QH042406 | Hydroxychloroquine sulfate EP Impurity F CAS# 6281-58-9 M.F.: C14H15ClN2 M.W.: 246.74 |
| |
QH042405 | Hydroxychloroquine sulfate EP Impurity E CAS# 10500-64-8 M.F.: C14H17ClN2O M.W.: 264.75 |
| |
QC182532 | Canagliflozin Impurity 6 CAS# 542-69-8 M.F.: C4H9I M.W.: 184.02 |
| |
QC182531 | Canagliflozin Impurity 5 CAS# NA M.F.: C24H25FO5S M.W.: 444.52 |
| |
QC182530 | Canagliflozin Impurity 4 CAS# 2005454-69-1 M.F.: C18H15FS M.W.: 282.38 |
| |
QC182529 | Canagliflozin Impurity 3 CAS# 2338840-88-1 M.F.: C18H15FOS M.W.: 298.37 |
| |
QC182528 | Canagliflozin Impurity 2 CAS# NA M.F.: C24H27FO6S M.W.: 462.53 |
| |
QA261930 | Azilsartan Impurity 2 CAS# 147403-52-9 M.F.: C26H22N4O5 M.W.: 470.48 |
| |
QE201927 | LCZ696 CAS# 936623-90-4 M.F.: C48H55N6Na3O8.5/2H2O M.W.: 912.96 45.05 |
| |
QA261929 | Azilsartan Impurity 1 CAS# 1403474-70-3 M.F.: C27H24N4O5 M.W.: 484.50 |
| |
QI071832 | Iguratimod Impurity 6 CAS# 76838-72-7 M.F.: C13H13NO2 M.W.: 215.25 |
| |
QI071831 | Iguratimod Impurity 5 CAS# 84594-95-6 M.F.: C13H11NO4 M.W.: 245.24 |
| |
QI071827 | Iguratimod Impurity 1 CAS# 16156-59-5 M.F.: C7H8O3S M.W.: 172.20 |
| |
QE151330 | Esomeprazole Impurity 13 CAS# 615-05-4;614-94-8(2HCl salt) M.F.: C7H10N2O M.W.: 138.17 |
| |
QE151328 | Esomeprazole Impurity 11 CAS# 610-81-1 M.F.: C6H6N2O3 M.W.: 154.12 |
| |
QC160729 | Clopidogrel Impurity 29 CAS# 53885-64-6 M.F.: C14H11Cl2NS M.W.: 296.21 |
| |
QT140688 | Tenofovir Impurity 54 CAS# NA M.F.: C19H25N6O5P M.W.: 448.41 |
| |
QT140687 | Tenofovir Impurity 53 CAS# NA M.F.: C21H29N6O5P M.W.: 476.47 |
| |
QT140684 | Tenofovir Impurity 50 CAS# NA M.F.: C16H20N5O4P M.W.: 377.33 |
| |
QT140683 | Tenofovir Impurity 49 CAS# NA M.F.: C16H20N5O4P M.W.: 377.33 |
| |
QT140682 | Tenofovir Impurity 48 CAS# 383365-04-6 M.F.: C21H29N6O5P M.W.: 476.47 |
| |
QP132610 | Promethazine Sulfone CAS# 13754-56-8 M.F.: C17H20N2O2S M.W.: 316.42 |
| |
QC190604 | Caspofungin Impurity D CAS# NA M.F.: C50H82N8O16 M.W.: 1051.23 |
| |
QC190602 | Caspofungin Impurity B CAS# NA M.F.: C52H88N10O15 M.W.: 1093.31 |
| |
QC190610 | Caspofungin Impurity I CAS# NA M.F.: C52H88N10O15 M.W.: 1093.31 |
| |
QG021800 | Glibornuride (Mixture of Diastereomers) CAS# 26944-48-9 M.F.: C18H26N2O4S M.W.: 366.48 |
| |
QC061848 | Cefuroxime axetil dimer CAS# 1202925-10-7 M.F.: C36H38N8O17S2 M.W.: 918.86 |
| |
QT182628 | Terazosin EP Impurity N CAS# 63074-07-7 M.F.: C9H16N2O2 M.W.: 184.24 |
| |
QT182627 | Terazosin Impurity 1 CAS# 16874-33-2 M.F.: C5H8O3 M.W.: 116.12 |
| |
QP136039 | Pidotimod Impurity 13 CAS# NA M.F.: C8H13NO3S M.W.: 203.26 |
| |
QT022010 | Terbutaline Impurity 10 CAS# 52144-90-8;28924-20-1(HBr salt) M.F.: C26H29NO3 M.W.: 403.51 |
| |
QD171203 | Dequalinium chloride EP Impurity C CAS# NA M.F.: C50H69I3N6 M.W.: 1134.84 |
| |
QD171202 | Dequalinium chloride EP Impurity B CAS# 171980-52-2(Cl-) M.F.: C30H39IN4 M.W.: 582.56 |
| |
QD030432 | Diclofenac Impurity 32 CAS# 90798-25-7 M.F.: C10H9Cl2NO2 M.W.: 246.09 |
| |
QD030431 | Diclofenac Impurity 31 CAS# NA M.F.: C20H13Cl4NO2 M.W.: 441.13 |
| |
QD030430 | Diclofenac Impurity 30 CAS# 123790-84-1 M.F.: C12H9BrClN M.W.: 282.56 |
| |
QD030428 | Diclofenac Impurity 28 CAS# NA M.F.: C22H15Cl4NO4 M.W.: 499.17 |
| |
QL141236 | Linagliptin Impurity 36 CAS# NA M.F.: C10H6D3BrN4O2 M.W.: 300.13 |
| |
QF226829 | Fasudil Impurity 3 CAS# 1423155-03-6 M.F.: C14H17N3O2S M.W.: 291.37 |
| |
QP181328 | Pramipexole Impurity 2 CAS# 1052691-22-1 M.F.: C10H19N3S M.W.: 213.34 |
| |
QD201927 | 5β-Dutasteride Impurity CAS# 957229-52-6 M.F.: C27H30F6N2O2 M.W.: 528.53 |
| |
QD201908 | Dutasteride EP Impurity G CAS# 1430804-85-5 M.F.: C27H28F6N2O2 M.W.: 526.51 |
| |
QN140438 | Intedanib Impurity 12 CAS# 1139453-98-7 M.F.: C14H20N4O3 M.W.: 292.33 |
| |
QN140437 | Intedanib Impurity 11 CAS# 2653-16-9 M.F.: C9H9ClN2O3 M.W.: 228.63 |
| |
QN140436 | Intedanib Impurity 10 CAS# 100-15-2 M.F.: C7H8N2O2 M.W.: 152.15 |
| |
QN140435 | Intedanib Impurity 9 CAS# 98-07-7 M.F.: C7H5Cl3 M.W.: 195.47 |
| |
QN140434 | Intedanib Impurity 8 CAS# 1125-88-8 M.F.: C9H12O2 M.W.: 152.19 |
| |
QN140433 | Intedanib Impurity 7; Guaiacol EP Impurity E CAS# 93-58-3 M.F.: C8H8O2 M.W.: 136.15 |
| |
QN140432 | Intedanib Impurity 6 CAS# 707-07-3 M.F.: C10H14O3 M.W.: 182.22 |
| |
QN140431 | Intedanib Impurity 5 CAS# 40872-87-5 M.F.: C8H8ClNO2 M.W.: 185.61 |
| |
QN140430 | Intedanib Impurity 4 CAS# 2840-28-0 M.F.: C7H6ClNO2 M.W.: 171.58 |
| |
QN140429 | Intedanib Impurity 3 CAS# 1160293-27-5 M.F.: C13H13NO8 M.W.: 311.24 |
| |
QN140428 | Intedanib Impurity 2 CAS# 14719-83-6 M.F.: C8H6ClNO4 M.W.: 215.59 |
| |
QN140427 | Intedanib Impurity 1 CAS# 96-99-1 M.F.: C7H4ClNO4 M.W.: 201.56 |
| |
QN032005 | Nicotinic Acid EP Impurity E; Isoniazid EP Impurity A CAS# 55-22-1 M.F.: C6H5NO2 M.W.: 123.11 |
| |
QI210429 | Ibuprofen Impurity 3 CAS# NA M.F.: C15H22O3 M.W.: 250.33 |
| |
QI210428 | Ibuprofen Impurity 2 CAS# 623-61-0 M.F.: C5H10O3 M.W.: 118.13 |
| |
QP122407 | Plerixafor Impurity G CAS# 771464-86-9 M.F.: C46H84N12 M.W.: 805.24 |
| |
QP122405 | Plerixafor Impurity E CAS# 176252-20-3 M.F.: C18H32N4O M.W.: 320.47 |
| |
QP122404 | Plerixafor Hydrochloride CAS# 155148-31-5 M.F.: C28H54N8 M.W.: 502.78 |
| |
QI220222 | Ivabradine Impurity 3 CAS# 1132667-04-9;1204612-29-2(HCl salt) M.F.: C12H17NO2 M.W.: 207.27 |
| |
QE130401 | Emedastine EP Impurity F CAS# NA M.F.: C15H24N4O M.W.: 276.38 |
| |
QP136038 | Pidotimod Impurity 12 CAS# 4128-37-4 M.F.: C7H16N2O M.W.: 144.21 |
| |
QP136037 | Pidotimod Impurity 11 CAS# 42258-90-2 M.F.: C5H9NO2S M.W.: 147.20 |
| |
QE042236 | Edaravone Impurity 10 CAS# 53341-66-5 M.F.: C11H13NO3 M.W.: 207.23 |
| |
QE042235 | Edaravone Impurity 9 CAS# 100-65-2 M.F.: C6H7NO M.W.: 109.13 |
| |
QE042234 | Edaravone Impurity 8 CAS# NA M.F.: C10H12N2O M.W.: 176.22 |
| |
QE042233 | Edaravone Impurity 7 CAS# 92-43-3 M.F.: C9H10N2O M.W.: 162.19 |
| |
QE042230 | Edaravone Impurity 4 CAS# 177415-76-8 M.F.: C20H18N4O2 M.W.: 346.38 |
| |
QD141627 | Donepezil Impurity 1; Donepezil EP Impurity B CAS# 2107-69-9 M.F.: C11H12O3 M.W.: 192.22 |
| |
QC061847 | Cefuroxime Axetil Impurity 7 CAS# NA M.F.: C9H11N3O5S M.W.: 273.27 |
| |
QC061846 | Cefuroxime Axetil Impurity 6 CAS# NA M.F.: C15H17N3O8S M.W.: 399.38 |
| |
QC061843 | Cefuroxime Axetil Impurity 3 CAS# 69384-96-9 M.F.: C7H7NO4 M.W.: 169.13 |
| |
QC061842 | Cefuroxime Axetil Impurity 2 CAS# NA M.F.: C6H12O3 M.W.: 132.16 |
| |
QC061841 | Cefuroxime Axetil Impurity 1 CAS# NA M.F.: C4H6Br2O2 M.W.: 245.90 |
| |
QP202239 | Pitavastatin Impurity 13 CAS# 2124275-54-1 M.F.: C13H22O5 M.W.: 258.31 |
| |
QP202238 | Pitavastatin Impurity 12 CAS# NA M.F.: C13H22O5 M.W.: 258.31 |
| |
QF226828 | Fasudil Impurity 2 CAS# NA M.F.: C9H7NO3S M.W.: 209.22 |
| |
QL130609 | Lamivudine EP Impurity I CAS# 145918-75-8 M.F.: C8H11N3O4 M.W.: 213.19 |
| |
QD190627 | Doxofylline Impurity 1 CAS# 1429636-74-7 M.F.: C10H16N4O3 M.W.: 240.26 |
| |
QC180802 | Chlorphenamine EP Impurity B CAS# 1202-34-2 M.F.: C10H9N3 M.W.: 171.20 |
| |
QC180801 | Chlorphenamine EP Impurity A CAS# 1246816-57-8 M.F.: C16H24ClN3 M.W.: 293.83 |
| |
QE151316 | Esomeprazole Impurity 7 CAS# 727375-13-5 M.F.: C8H11NO2 M.W.: 153.18 |
| |
QE151313 | Esomeprazole Impurity 4 CAS# 73590-93-9 M.F.: C8H10ClN.HCl M.W.: 155.63 36.46 |
| |
QL040302 | Lidocaine EP Impurity B;Lidocaine N-oxide CAS# 2903-45-9 M.F.: C14H22N2O2 M.W.: 250.34 |
| |
QL050315 | Lercanidipine Impurity 1 CAS# 74936-72-4 M.F.: C16H16N2O6 M.W.: 332.31 |
| |
QC121201 | Cholecalciferol EP Impurity A; trans-Cholecalciferol;trans-Vitamin D3 CAS# 22350-41-0 M.F.: C27H44O M.W.: 384.64 |
| |
QI220220 | Ivabradine Impurity 1 CAS# 2247881-26-9 M.F.: C26H34N2O5 M.W.: 454.56 |
| |
QS120716 | Saxagliptin (S,R,S,R)-Isomer CAS# 1564266-03-0 M.F.: C18H25N3O2 M.W.: 315.41 |
| |
QS120711 | Saxagliptin (S,S,S,R)-Isomer CAS# 1564265-93-5 M.F.: C18H25N3O2 M.W.: 315.41 |
| |
QA260312 | Azacitidine Impurity L CAS# 16352-06-0 M.F.: C4H6N4O M.W.: 126.12 |
| |
QA260310 | Azacitidine Impurity J CAS# 1415316-72-1 M.F.: C12H16N4O7 M.W.: 328.28 |
| |
QA260309 | Azacitidine Impurity I CAS# NA M.F.: C10H14N4O6 M.W.: 286.24 |
| |
QA260308 | Azacitidine Impurity H CAS# NA M.F.: C9H14N4O5 M.W.: 258.23 |
| |
QA260313 | Azacitidine Impurity 13 CAS# 105331-00-8 M.F.: C8H13N5O5 M.W.: 259.22 |
| |
QA260307 | Azacitidine Impurity G CAS# 504-08-5 M.F.: C3H5N5 M.W.: 111.11 |
| |
QS142012 | Sunitinib Ketone Impurity CAS# 2411816-47-0 M.F.: C22H25FN4O3 M.W.: 412.47 |
| |
QE151310 | Esomeprazole Impurity 1 CAS# 862270-90-4 M.F.: C7H12Cl2N2O M.W.: 211.09 |
| |
QC042029 | Cefditoren pivaloyl CAS# 878002-84-7 M.F.: C30H36N6O8S3 M.W.: 704.84 |
| |
QA261928 | Azilsartan Impurity (U-3) CAS# 1417576-00-1 M.F.: C28H20N4O8 M.W.: 540.48 |
| |
QC120422 | Clindamycin Hydrochloride EP Impurity B; Clindamycin B CAS# 18323-43-8 M.F.: C17H31ClN2O5S M.W.: 410.96 |
| |
QP132029 | Pemetrexed Impurity 3 CAS# 1075-59-8 M.F.: C5H7N3O3 M.W.: 157.13 |
| |
QP132028 | Pemetrexed Impurity 2 CAS# NA M.F.: C22H25N5O6 M.W.: 455.46 |
| |
QP132027 | Pemetrexed Impurity 1; DL-Glutamic acid CAS# 617-65-2 M.F.: C5H9NO4 M.W.: 147.13 |
| |
QC042419 | Cefadroxil Dimer Trifluoroacetate CAS# NA M.F.: C34H33F3N6O11S2 M.W.: 822.78 |
| |
QC042417 | N-Phenylglycyl delta-3 cefadroxil CAS# NA M.F.: C24H24N4O7S M.W.: 512.53 |
| |
QC042416 | Cefadroxil ethyl homolog CAS# 2243976-70-5 M.F.: C17H19N3O5S M.W.: 377.41 |
| |
QC042406 | Cefadroxil EP Impurity F CAS# NA M.F.: C24H24N4O7S M.W.: 512.53 |
| |
QC042404 | Cefadroxil EP Impurity D;L-Cefadroxil CAS# 144790-28-3 M.F.: C16H17N3O5S M.W.: 363.39 |
| |
QC042403 | Cefadroxil EP Impurity C CAS# NA M.F.: C16H19N3O6S M.W.: 381.40 |
| |
QP136036 | Pidotimod Impurity 10 CAS# NA M.F.: C6H11NO3S M.W.: 177.22 |
| |
QC160610 | Ciprofloxacin EP Impurity C HCl CAS# 528851-31-2 M.F.: C15H17ClFN3O3 M.W.: 341.77 |
| |
QP202228 | Pitavastatin Impurity 2 CAS# 1044518-75-3 M.F.: C13H22O5 M.W.: 258.31 |
| |
QT140645 | Tenofovir Impurity 19 CAS# 2053424-82-9;2055343-42-3(fumarate) M.F.: C21H29N6O5P M.W.: 476.47 |
| |
QT060345 | Tofacitinib Impurity 20 CAS# 1092578-48-7+1092578-46-5 M.F.: C16H20N6O M.W.: 312.37 |
| |
QP160414 | Paliperidone hydroxybenzoyl analog CAS# 152542-03-5 M.F.: C23H28FN3O4 M.W.: 429.48 |
| |
QS120635 | Solifenacin EP Impurity I CAS# 180272-28-0 M.F.: C23H26N2O3 M.W.: 378.46 |
| |
QS120634 | Solifenacin EP Impurity H CAS# 732228-02-3;862207-71-4(succinate salt) M.F.: C23H26N2O2 M.W.: 362.46 |
| |
QS120630 | Solifenacin EP Impurity D CAS# NA M.F.: C31H28N2O M.W.: 444.57 |
| |
QS120629 | Solifenacin EP Impurity C CAS# 1534326-81-2 M.F.: C31H28N2O M.W.: 444.57 |
| |
QS120627 | Solifenacin EP Impurity A CAS# 118864-75-8 M.F.: C15H15N M.W.: 209.29 |
| |
QP182010 | Paracetamol EP Impurity J CAS# 539-03-7 M.F.: C8H8ClNO M.W.: 169.61 |
| |
QP182009 | Paracetamol EP Impurity I CAS# 118-93-4 M.F.: C8H8O2 M.W.: 136.15 |
| |
QP182008 | Paracetamol EP Impurity H CAS# 2623-33-8 M.F.: C10H11NO3 M.W.: 193.20 |
| |
QP182007 | Paracetamol EP Impurity G CAS# 34523-34-7 M.F.: C8H9NO2 M.W.: 151.16 |
| |
QP182005 | Paracetamol EP Impurity E CAS# 99-93-4 M.F.: C8H8O2 M.W.: 136.15 |
| |
QP182003 | Paracetamol EP Impurity C CAS# 3964-54-3 M.F.: C8H8ClNO2 M.W.: 185.61 |
| |
QP182002 | Paracetamol EP Impurity B CAS# 1693-37-4 M.F.: C9H11NO2 M.W.: 165.19 |
| |
QP182001 | Paracetamol EP Impurity A CAS# 614-80-2 M.F.: C8H9NO2 M.W.: 151.16 |
| |
QT081106 | Trihexyphenidyl Impurity F CAS# NA M.F.: C20H29N M.W.: 283.45 |
| |
QT081101 | Trihexyphenidyl Impurity A CAS# 886-06-6 ;73-63-2(free base) M.F.: C14H20ClNO M.W.: 253.77 |
| |
QL130610 | Lamivudine EP Impurity J CAS# 145986-07-8 M.F.: C8H10N2O4S M.W.: 230.24 |
| |
QP182213 | Peramivir Amino acid Impurity CAS# NA M.F.: C6H9NO2 M.W.: 127.14 |
| |
QP182212 | Peramivir Methyl Ester Impurity CAS# NA M.F.: C7H11NO2 M.W.: 141.17 |
| |
QP182208 | Peramivir Impurity 8 CAS# 229614-37-3;1352062-19-1(HCl salt) M.F.: C14H26N2O4 M.W.: 286.37 |
| |
QP182207 | Peramivir Impurity 7 CAS# NA M.F.: C15H28N2O4 M.W.: 300.39 |
| |
QP182210 | Peramivir Impurity 10 CAS# 316173-29-2 M.F.: C18H34N2O5 M.W.: 358.47 |
| |
QP182206 | Peramivir Impurity 6 CAS# 1988779-15-2 M.F.: C20H36N2O6 M.W.: 400.51 |
| |
QP182204 | Peramivir Impurity 4 CAS# 383910-24-5 M.F.: C18H30N2O5 M.W.: 354.44 |
| |
QC160928 | Cefpirome Impurity 2; Cefepime EP Impurity C CAS# 104301-63-5 M.F.: C8H10N4O3S M.W.: 242.26 |
| |
QP182202 | Peramivir Impurity 2 CAS# 229613-93-8 M.F.: C18H30N2O5 M.W.: 354.44 |
| |
QP182211 | Peramivir Impurity 11 CAS# NA M.F.: C15H28N4O4 M.W.: 328.41 |
| |
QF120401 | Fluocinonide Impurity A CAS# NA M.F.: C26H30F2O7 M.W.: 492.51 |
| |
QL162001 | Lapatinib Impurity 1 (O-De(3-fluorobenzyl) Lapatinib) CAS# 1268997-70-1 M.F.: C22H21ClN4O4S M.W.: 472.95 |
| |
QA202202 | Atorvastatin EP Impurity B CAS# NA M.F.: C33H34FN2O5 . 1/2Ca M.W.: 577.67 |
| |
QC030331 | Cinacalcet USP RC E CAS# 78573-45-2 M.F.: C10H11F3O M.W.: 204.19 |
| |
QC030327 | Cinacalcet Impurity 27 CAS# 21172-43-0 M.F.: C11H13F3O3S M.W.: 282.28 |
| |
QG031902 | Glucosamine EP Impurity B;Fructosazine CAS# 13185-73-4 M.F.: C12H20N2O8 M.W.: 320.30 |
| |
QC160935 | Cefpirome Impurity 9 CAS# NA M.F.: C22H22N6O6S2 M.W.: 530.58 |
| |
QC160933 | Cefpirome Impurity 7 CAS# NA M.F.: C22H22N6O5S2 M.W.: 514.58 |
| |
QC160930 | Cefpirome Impurity 4 CAS# NA M.F.: C22H22N6O5S2 M.W.: 514.58 |
| |
QI200330 | Irinotecan Impurity 4 CAS# 176515-52-9 M.F.: C32H38N4O4 M.W.: 542.68 |
| |
QI210616 | Ibuprofen EP Impurity P CAS# 36039-36-8 M.F.: C13H20O M.W.: 192.30 |
| |
QI210614 | Ibuprofen EP Impurity N CAS# 3585-52-2 M.F.: C11H14O2 M.W.: 178.23 |
| |
QI210613 | Ibuprofen EP Impurity M CAS# 60057-62-7 M.F.: C13H18O3 M.W.: 222.28 |
| |
QI210610 | Ibuprofen EP Impurity J CAS# 65813-55-0 M.F.: C13H16O3 M.W.: 220.27 |
| |
QI210606 | Ibuprofen EP Impurity F CAS# 65322-85-2 M.F.: C13H18O2 M.W.: 206.29 |
| |
QI210604 | Ibuprofen EP Impurity D CAS# 938-94-3 M.F.: C10H12O2 M.W.: 164.21 |
| |
QP182444 | Parecoxib Sodium Impurity M CAS# 75115-00-3 M.F.: C16H13NO M.W.: 235.28 |
| |
QB201427 | Bortezomib Impurity 1 CAS# 289472-78-2 M.F.: C19H24N4O3 M.W.: 356.42 |
| |
QC120309 | Celecoxib Impurity I CAS# 720-94-5 M.F.: C11H9F3O2 M.W.: 230.18 |
| |
QL141232 | Lenalidomide Impurity 7 CAS# NA M.F.: C13H16N4O3 M.W.: 276.29 |
| |
QC060406 | Cefodizime Impurity F CAS# NA M.F.: C20H20N6O7S4 M.W.: 584.67 |
| |
QF022452 | Febuxostat Impurity 8 CAS# 528607-60-5 M.F.: C12H13NO3 M.W.: 219.24 |
| |
QF022451 | Febuxostat Impurity 25 CAS# NA M.F.: C16H18N2O4S M.W.: 334.39 |
| |
QT060344 | Tofacitinib Impurity 19 CAS# NA M.F.: C14H22N2O M.W.: 234.34 |
| |
QL062427 | Levofloxacin Impurity 1; Ofloxacin EP Impurity A CAS# 82419-35-0 M.F.: C13H9F2NO4 M.W.: 281.21 |
| |
QC030804 | Cinchocaine EP Impurity D CAS# 10222-61-4 M.F.: C14H15NO3 M.W.: 245.27 |
| |
QC030803 | Cinchocaine EP Impurity C CAS# 87864-08-2 M.F.: C16H21N3O2 M.W.: 287.36 |
| |
QC030802 | Cinchocaine EP Impurity B CAS# 15733-89-8 M.F.: C10H7NO3 M.W.: 189.17 |
| |
QC030801 | Cinchocaine EP Impurity A CAS# 87864-14-0 M.F.: C16H20ClN3O M.W.: 305.80 |
| |
QL141204 | Lenalidomide Impurity D CAS# 295357-66-3 M.F.: C13H14N2O5 M.W.: 278.26 |
| |
QC061728 | Cefoperazone Impurity 1 CAS# 62893-24-7 M.F.: C15H17N3O6 M.W.: 335.31 |
| |
QL201522 | Letrozole Impurity 22 CAS# 123-56-8 M.F.: C4H5NO2 M.W.: 99.09 |
| |
QL201513 | Letrozole Impurity 13 CAS# 128-08-5 M.F.: C4H4BrNO2 M.W.: 177.98 |
| |
QL201521 | Letrozole Impurity 21 CAS# 394-47-8 M.F.: C7H4FN M.W.: 121.11 |
| |
QL201516 | Letrozole Impurity 16 CAS# 529-19-1 M.F.: C8H7N M.W.: 117.15 |
| |
QL201508 | Letrozole Impurity 8 CAS# 22115-41-9 M.F.: C8H6BrN M.W.: 196.04 |
| |
QL201505 | Letrozole Impurity 3 CAS# 28188-41-2 M.F.: C8H6BrN M.W.: 196.04 |
| |
QC132426 | Cefmenoxime Impurity 26 CAS# 94088-75-2 M.F.: C13H10N4O2S3 M.W.: 350.44 |
| |
QC132420 | Cefmenoxime Impurity 20 CAS# 149-30-4 M.F.: C7H5NS2 M.W.: 167.25 |
| |
QC132415 | Cefmenoxime Impurity 15 CAS# 120-78-5 M.F.: C14H8N2S4 M.W.: 332.49 |
| |
QC132413 | Cefmenoxime Impurity 13 CAS# 126437-69-2 M.F.: C11H13N5O3S2 M.W.: 327.38 |
| |
QC132412 | Cefmenoxime Impurity 12 CAS# 392718-98-8 M.F.: C4H6N4OS M.W.: 158.18 |
| |
QC132408 | Cefmenoxime Impurity 8 CAS# NA M.F.: C12H14N6O4S2 M.W.: 370.41 |
| |
QC132402 | Cefmenoxime Impurity 2 CAS# NA M.F.: C16H21N7O6S2 M.W.: 471.51 |
| |
QS161828 | Sulpiride Impurity 2 CAS# NA M.F.: C15H22N2O5S M.W.: 342.41 |
| |
QT060343 | Tofacitinib Impurity 18 CAS# 2028267-73-2 M.F.: C16H20N6O2 M.W.: 328.37 |
| |
QP182443 | Parecoxib Impurity 11 CAS# 181696-12-8 M.F.: C16H14N2O3S M.W.: 314.36 |
| |
QP202233 | Pitavastatin Impurity 7 CAS# NA M.F.: C32H36FNO4 M.W.: 517.65 |
| |
QP202236 | Pitavastatin Impurity 10 CAS# NA M.F.: C32H36FNO4 M.W.: 517.65 |
| |
QP202231 | Pitavastatin Impurity 5 CAS# NA M.F.: C32H36FNO4 M.W.: 517.65 |
| |
QL052020 | Levetiracetam EP Impurity E CAS# 3886-69-9 M.F.: C8H11N M.W.: 121.18 |
| |
QI091612 | Ipratropium Bromide Impurity L CAS# 3979-14-4 M.F.: C11H14O3 M.W.: 194.23 |
| |
QI091611 | Ipratropium Bromide Impurity K CAS# 17838-69-6 M.F.: C11H12O3 M.W.: 192.21 |
| |
QI091610 | Ipratropium Bromide Impurity J CAS# NA M.F.: C13H24BrNO2 M.W.: 306.24 |
| |
QI091609 | Ipratropium Bromide Impurity I CAS# 3423-28-7 M.F.: C10H17NO M.W.: 167.25 |
| |
QI091608 | Ipratropium Bromide Impurity H CAS# NA M.F.: C22H32BrNO4 M.W.: 454.40 |
| |
QC061313 | Cefotiam Impurity 13 CAS# NA M.F.: C18H25N9O5S3 M.W.: 543.64 |
| |
QS061904 | Sulfasalazine EP Impurity D CAS# 66364-70-3 M.F.: C17H14N4O3S M.W.: 354.39 |
| |
QE201207 | Estriol EP Impurity G CAS# 793-89-5 M.F.: C18H24O3 M.W.: 288.39 |
| |
QE161229 | Epalrestat Impurity 3 CAS# 682775-71-9 M.F.: C17H17NO3S2 M.W.: 347.45 |
| |
QP132018 | Pemetrexed Impurity F CAS# NA M.F.: C20H19N5Na2O7 M.W.: 487.37 |
| |
QV122212 | Valaciclovir EP Impurity L;Aciclovir EP Impurity K CAS# 1797131-64-6 M.F.: C17H22N10O6 M.W.: 462.42 |
| |
QC120903 | Calcipotriol EP Impurity C; (5E)-Calcipotriol CAS# 113082-99-8 M.F.: C27H40O3 M.W.: 412.62 |
| |
QE161228 | Epalrestat Impurity 2 CAS# 23176-01-4 M.F.: C7H9NO3S2 M.W.: 219.28 |
| |
QE161227 | Epalrestat Impurity 1 CAS# 82159-06-6 M.F.: C12H9NO3S2 M.W.: 279.33 |
| |
QC120414 | Clindamycin B 2-Palmitate HCl CAS# 68206-99-5(base) M.F.: C33H61ClN2O6S HCl M.W.: 649.37 36.46 |
| |
QC120413 | Clindamycin 2-Palmitate HCl CAS# 25507-04-4 M.F.: C34H64Cl2N2O6S M.W.: 699.85 |
| |
QC221207 | Clavulanate Potassium EP Impurity G CAS# 374816-32-7 M.F.: C13H15NO6 M.W.: 281.26 |
| |
QC221206 | Clavulanate Potassium EP Impurity F CAS# 1260857-16-6 M.F.: C13H14N2O5 M.W.: 278.26 |
| |
QC221205 | Clavulanate Potassium EP Impurity E CAS# 1260617-10-4 M.F.: C16H18N2O10 M.W.: 398.32 |
| |
QC221204 | Clavulanate Potassium EP Impurity D CAS# 404839-11-8 M.F.: C7H9NO3 M.W.: 155.15 |
| |
QC221203 | Clavulanate Potassium EP Impurity C CAS# 86917-74-0 M.F.: C10H16N2O2 M.W.: 196.25 |
| |
QC221202 | Clavulanate Potassium EP Impurity B CAS# 96681-85-5 M.F.: C11H16N2O4 M.W.: 240.26 |
| |
QP020330 | Palbociclib Impurity 4 CAS# 1376615-91-6 M.F.: C24H31N7O2 M.W.: 449.56 |
| |
QC162635 | Cefprozil Impurity 35 CAS# NA M.F.: C26H26N4O7S M.W.: 538.57 |
| |
QF121304 | Flumazenil EP Impurity D CAS# 78755-80-3 M.F.: C10H9FN2O2 M.W.: 208.19 |
| |
QF121305 | Flumazenil EP Impurity E CAS# 78756-03-3 M.F.: C15H15N3O3 M.W.: 285.3 |
| |
QC182527 | Canagliflozin Dimer Impurity 1 CAS# NA M.F.: C48H48F2O10S2 M.W.: 887.02 |
| |
QL141201 | Lenalidomide Impurity A CAS# 1198299-72-7 M.F.: C13H13N3O6 M.W.: 307.26 |
| |
QR121602 | rac-Lipoic Acid Impurity 2 (S-Oxide) CAS# 6992-30-9 M.F.: C8H14O3S2 M.W.: 222.33 |
| |
QR121601 | rac-Lipoic Acid Impurity 1 (S-Oxide) CAS# 108015-78-7 M.F.: C8H14O3S2 M.W.: 222.33 |
| |
QA262007 | Azathioprine EP Impurity G CAS# 5581-52-2 M.F.: C9H8N8O2S M.W.: 292.28 |
| |
QA262005 | Azathioprine EP Impurity E CAS# 35681-68-6 (sodium salt) M.F.: C4H4N3NaO3 M.W.: 165.08 |
| |
QA262004 | Azathioprine EP Impurity D CAS# 6339-54-4 M.F.: C4H5N3O2S M.W.: 159.17 |
| |
QA262002 | Azathioprine EP Impurity B CAS# 157930-13-7 M.F.: C5H4N4S M.W.: 152.18 |
| |
QA262001 | Azathioprine EP Impurity A CAS# 4531-54-8 M.F.: C4H6N4O2 M.W.: 142.12 |
| |
QH040310 | Hydrocortisone EP Impurity J CAS# 16463-74-4 M.F.: C23H32O6 M.W.: 404.50 |
| |
QH040308 | Hydrocortisone EP Impurity H CAS# NA M.F.: C21H30O6 M.W.: 378.46 |
| |
QH040305 | Hydrocortisone EP Impurity E CAS# 600-99-7 M.F.: C21H28O5 M.W.: 360.44 |
| |
QC061429 | Cefdinir Related Compound B CAS# 79350-10-0 M.F.: C14H14N4O4S2 M.W.: 366.41 |
| |
QC061428 | Cefdinir USP Related Compound A CAS# 178422-42-9 M.F.: C14H15N5O6S2 M.W.: 413.43 |
| |
QC061427 | Cefdinir Impurity 1 CAS# NA M.F.: C13H13N5O5S2 M.W.: 383.41 |
| |
QP136032 | Pidotimod Impurity 6 CAS# NA M.F.: C9H12N2O4S M.W.: 244.27 |
| |
QP136030 | Pidotimod Impurity 4 CAS# 1116-22-9 M.F.: C10H16N2O7 M.W.: 276.24 |
| |
QA260306 | Azacitidine Impurity F CAS# NA M.F.: C13H20N4O9 M.W.: 376.32 |
| |
QC022010 | Cabazitaxel Impurity 10 CAS# 145514-62-1 M.F.: C14H19NO5 M.W.: 281.31 |
| |
QC022015 | Cabazitaxel Impurity 15 CAS# 859498-34-3 M.F.: C22H25NO6 M.W.: 399.44 |
| |
QC022026 | Cabazitaxel Impurity 26 CAS# NA M.F.: C30H38O10 M.W.: 558.62 |
| |
QC202405 | Cefotaxime EP Impurity E;Ceftriaxone EP Impurity B CAS# 66340-33-8 M.F.: C14H13N5O5S2 M.W.: 395.41 |
| |
QC202404 | Cefotaxime EP Impurity D Sodium Salt CAS# 65715-12-0;63527-53-7(free base) M.F.: C16H16N5NaO7S2 M.W.: 477.45 |
| |
QC202401 | Cefotaxime EP Impurity A CAS# 65052-63-3 M.F.: C14H15N5O5S2 M.W.: 397.42 |
| |
QL011307 | Lamotrigine EP Impurity G CAS# 38943-76-9 M.F.: C9H7Cl2N5 M.W.: 256.09 |
| |
QL011305 | Lamotrigine EP Impurity E CAS# 50-45-3 M.F.: C7H4Cl2O2 M.W.: 191.01 |
| |
QL011302 | Lamotrigine EP Impurity B CAS# 94213-24-8 M.F.: C9H7Cl2N5 M.W.: 256.09 |
| |
QC162630 | Cefprozil Impurity 4 CAS# NA M.F.: C36H36N6O9S2 M.W.: 760.84 |
| |
QC162628 | Cefprozil Impurity 2 CAS# NA M.F.: C18H19N3O5S M.W.: 389.43 |
| |
QC162627 | Cefprozil Impurity 1 CAS# NA M.F.: C17H19N3O6S M.W.: 393.41 |
| |
QC162614 | Cefprozil EP Impurity N CAS# NA M.F.: C21H23N3O7S M.W.: 461.49 |
| |
QC162613 | Cefprozil EP Impurity M CAS# NA M.F.: C21H23N3O7S M.W.: 461.49 |
| |
QC162611 | Cefprozil EP Impurity K CAS# NA M.F.: C18H19N3O5S M.W.: 389.43 |
| |
QC162610 | Cefprozil EP Impurity J CAS# NA M.F.: C26H26N4O7S M.W.: 538.57 |
| |
QC162609 | Cefprozil EP Impurity I CAS# NA M.F.: C18H21N3O6S M.W.: 407.44 |
| |
QC162608 | Cefprozil EP Impurity H CAS# NA M.F.: C26H26N4O7S M.W.: 538.57 |
| |
QC162607 | Cefprozil EP Impurity G CAS# NA M.F.: C18H21N3O6S M.W.: 407.44 |
| |
QC162605 | Cefprozil EP Impurity E CAS# NA M.F.: C26H26N4O7S M.W.: 538.57 |
| |
QC162604 | Cefprozil EP Impurity D CAS# 106447-44-3 M.F.: C10H12N2O3S M.W.: 240.28 |
| |
QC162602 | Cefprozil EP Impurity B;Cefadroxil CAS# 50370-12-2;66592-87-8(monohydrate) M.F.: C16H17N3O5S M.W.: 363.39 |
| |
QL201534 | Letrozole Impurity 7 CAS# 134521-16-7 M.F.: C15H10N2O M.W.: 234.25 |
| |
QL201533 | Letrozole Impurity D CAS# 10466-37-2 M.F.: C15H10N2 M.W.: 218.25 |
| |
QL201532 | Letrozole Impurity 6 CAS# NA M.F.: C26H18N6 M.W.: 414.46 |
| |
QL201531 | Letrozole Impurity 5 CAS# 1644566-39-1 M.F.: C17H13N3O4 M.W.: 323.3 |
| |
QL201530 | Letrozole Impurity 4 CAS# NA M.F.: C18H13N5 M.W.: 299.33 |
| |
QI591803 | Imidacloprid Guanidine Impurity CAS# NA M.F.: C9H11ClN4 M.W.: 210.66 |
| |
QI591802 | Imidacloprid Nitrosimine Impurity CAS# NA M.F.: C9H10ClN5O M.W.: 239.66 |
| |
QI210624 | Ibuprofen Impurity X CAS# NA M.F.: C22H29NO3 M.W.: 355.47 |
| |
QO022016 | 6-epi-Obeticholic Acid CAS# 915038-27-6 M.F.: C26H44O4 M.W.: 420.63 |
| |
QK202007 | Ketotifen EP Impurity G CAS# 43076-16-0 M.F.: C19H17NO2S M.W.: 323.41 |
| |
QK202005 | Ketotifen EP Impurity E CAS# 1346603-71-1 M.F.: C19H19NOS M.W.: 309.43 |
| |
QK202004 | Ketotifen EP Impurity D CAS# 88456-70-6 M.F.: C19H19NO2S M.W.: 325.42 |
| |
QK202003 | Ketotifen EP Impurity C CAS# 126939-27-3 M.F.: C19H21NO2S M.W.: 327.44 |
| |
QK202001 | Ketotifen EP Impurity A CAS# 4673-38-5 M.F.: C19H19NS M.W.: 293.43 |
| |
QD030408 | Diclofenac EP Impurity F CAS# 560075-65-2 M.F.: C14H10Cl3NO M.W.: 314.59 |
| |
QF226813 | Fasudil Impurity M CAS# NA M.F.: C14H18ClN3O2S M.W.: 327.83 |
| |
QI200310 | Irinotecan Impurity 10 CAS# 176515-52-9 M.F.: C32H38N4O4 M.W.: 542.67 |
| |
QE201609 | Eletriptan Impurity 9 CAS# 143322-57-0 M.F.: C14H17BrN2 M.W.: 293.21 |
| |
QP181510 | (S)-Propranolol HCl CAS# 4199-10-4 M.F.: C16H22ClNO2 M.W.: 295.8 |
| |
QA260305 | Azacitidine Impurity E CAS# 3530-56-1 M.F.: C9H13N3O5 M.W.: 243.22 |
| |
QC160316 | Capecitabine Impurity 16 CAS# NA M.F.: C13H16FN3O6 M.W.: 329.28 |
| |
QC160313 | Capecitabine EP Impurity C CAS# 161599-46-8 M.F.: C13H16FN3O6 M.W.: 329.28 |
| |
QC160308 | Capecitabine Impurity 8 CAS# 1262133-64-1 M.F.: C20H30FN3O9 M.W.: 475.48 |
| |
QA032030 | Acotiamide Impurity 4 CAS# NA M.F.: C13H14N2O4S M.W.: 294.33 |
| |
QC181310 | Clarithromycin EP Impurity M CAS# 127182-43-8 M.F.: C37H68N2O13 M.W.: 748.94 |
| |
QC031903 | Cyclophosphamide USP RC C CAS# 1071-28-9 M.F.: C3H10NO4P M.W.: 155.09 |
| |
QC181300 | Clarithromycin CAS# 81103-11-9 M.F.: C38H69NO13 M.W.: 747.95 |
| |
QC181318 | Clarithromycin Impurity R; Erythromycin EP Impurity B; 3″-N-Demethylerythromycin A CAS# 992-62-1 M.F.: C36H65NO13 M.W.: 719.90 |
| |
QC181306 | Clarithromycin EP Impurity F CAS# 128940-83-0 M.F.: C39H71NO13 M.W.: 761.98 |
| |
QC181305 | Clarithromycin EP Impurity E; 6,11-di-O-methylerythromycin A CAS# 81103-14-2 M.F.: C39H71NO13 M.W.: 761.98 |
| |
QP136028 | Pidotimod Impurity 2 CAS# NA M.F.: C9H12N2O5S M.W.: 260.27 |
| |
QT130202 | Trimebutine Impurity B CAS# 144095-19-2 M.F.: C10H14N2O M.W.: 178.23 |
| |
QT130201 | Trimebutine Impurity A CAS# 298689-33-5 M.F.: C10H13ClN2 M.W.: 196.68 |
| |
QC031207 | Cefaclor EP Impurity G CAS# NA M.F.: C16H17N3O4S M.W.: 347.40 |
| |
QC062007 | Cefathiamidine Impurity G CAS# NA M.F.: C17H26N4O4S2 M.W.: 414.54 |
| |
QL201504 | Letrozole Impurity 2 CAS# [NA] M.F.: C17H11N5 M.W.: 285.30 |
| |
QC160717 | Clopidogrel N-Methyl Impurity I HCl CAS# 1346605-15-9 (free base) M.F.: C16H19Cl2NO2S M.W.: 360.3 |
| |
QC160716 | Clopidogrel Ethyl Ester Sulfate CAS# 1332612-57-3 M.F.: C17H20ClNO6S2 M.W.: 433.93 |
| |
QE200330 | Entecavir EP Impurity D CAS# 1367369-80-9 M.F.: C12H15N5O3 M.W.: 277.29 |
| |
QD121819 | USP Desloratadine Related Compound A CAS# 117796-50-6 M.F.: C19H19BrN2 M.W.: 355.27 |
| |
QU190409 | Ursodeoxycholic Acid EP Impurity I CAS# 130593-75-8 M.F.: C24H42O3 M.W.: 378.60 |
| |
QU190407 | Ursodeoxycholic Acid EP Impurity G; Chenodeoxycholic acid EP Impurity G CAS# 10538-55-3 M.F.: C25H42O4 M.W.: 406.60 |
| |
QU190408 | Ursodeoxycholic Acid EP Impurity H CAS# 78919-26-3 M.F.: C24H40O4 M.W.: 392.58 |
| |
QU190406 | Ursodeoxycholic Acid EP Impurity F; Chenodeoxycholic acid EP Impurity F CAS# 4651-67-6 M.F.: C24H38O4 M.W.: 390.56 |
| |
QU190405 | Ursodeoxycholic Acid EP Impurity E; Chenodeoxycholic acid EP Impurity E; Deoxycholic acid CAS# 83-44-3;302-95-4(Na salt) M.F.: C24H40O4 M.W.: 392.57 |
| |
QU190404 | Ursodeoxycholic Acid EP Impurity D; Chenodeoxycholic acid EP Impurity D CAS# 2955-27-3 M.F.: C24H40O5 M.W.: 408.58 |
| |
QU190403 | Ursodeoxycholic Acid EP Impurity C; Chenodeoxycholic acid EP Impurity C; Lithocholic acid CAS# 434-13-9 M.F.: C24H40O3 M.W.: 376.57 |
| |
QU190402 | Ursodeoxycholic Acid EP Impurity B; Chenodeoxycholic acid EP Impurity B CAS# 81-25-4 M.F.: C24H40O5 M.W.: 408.57 |
| |
QU190401 | Ursodeoxycholic Acid EP Impurity A ; Chenodeoxycholic acid CAS# 474-25-9 M.F.: C24H40O4 M.W.: 392.57 |
| |
QF226812 | Fasudil Impurity L CAS# NA M.F.: C14H17N3O3S M.W.: 307.37 |
| |
QC031231 | Cefaclor Impurity 5 CAS# NA M.F.: C30H26Cl2N6O7S2 M.W.: 717.59 |
| |
QC031230 | Cefaclor Impurity 4 CAS# NA M.F.: C23H21ClN4O5S M.W.: 500.95 |
| |
QC031229 | Cefaclor Impurity 3 CAS# NA M.F.: C23H21ClN4O5S M.W.: 500.95 |
| |
QC031228 | Cefaclor Impurity 2 CAS# NA M.F.: C15H16ClN3O4S M.W.: 369.82 |
| |
QD141616 | Donepezil Impurity P CAS# NA M.F.: C24H31NO2 M.W.: 365.51 |
| |
QD141615 | Donepezil Impurity O CAS# 120014-07-5 M.F.: C24H27NO3 M.W.: 377.49 |
| |
QL142623 | Linezolid Impurity N;rac-Linezolid CAS# 224323-50-6 M.F.: C16H20FN3O4 M.W.: 337.35 |
| |
QL040308 | Lidocaine EP Impurity H CAS# 1131-01-7 M.F.: C10H12ClNO M.W.: 197.67 |
| |
QL040303 | Lidocaine EP Impurity C CAS# 2198-53-0 M.F.: C10H13NO M.W.: 163.22 |
| |
QD192400 | Desoximetasone; Dexamethasone EP Impurity F CAS# 382-67-2 M.F.: C22H29FO4 M.W.: 376.46 |
| |
QL040301 | Lidocaine EP Impurity A;Xylazine EP Impurity A; Ropivacaine EP Impurity H;Bupivacaine EP Impurity F; Mepivacaine EP Impurity A CAS# 87-62-7;21436-98-6(HCl salt) M.F.: C8H11N M.W.: 121.18 |
| |
QC121801 | Chloroquine Impurity A CAS# 6281-58-9 M.F.: C14H15ClN2 M.W.: 246.74 |
| |
QE200210 | Eltrombopag Dimer Impurity CAS# NA M.F.: C50H42N8O8 M.W.: 882.94 |
| |
QE201600 | Eletriptan CAS# 143322-58-1;177834-92-3(HBr salt) M.F.: C22H26N2O2S M.W.: 382.52 |
| |
QE201620 | Eletriptan N-Oxide CAS# 1217641-89-8 M.F.: C22H26N2O3S M.W.: 398.52 |
| |
QC031610 | E-Cefcapene Pivoxil CAS# NA M.F.: C23H29N5O8S2 M.W.: 567.64 |
| |
QC202406 | Cefotaxime EP Impurity F CAS# 175032-97-0 M.F.: C30H30N10O12S4 M.W.: 850.88 |
| |
QB031211 | Bicalutamide EP Impurity F CAS# 1080647-26-2 M.F.: C18H14F4N2O3S M.W.: 414.37 |
| |
QE181410 | Eplerenone Impurity J (11α-Hydroxy Canrenone) CAS# NA M.F.: C22H28O4 M.W.: 356.46 |
| |
QE181408 | Eplerenone EP Impurity D CAS# 209253-82-7 M.F.: C23H28O6 M.W.: 400.46 |
| |
QE181407 | Eplerenone EP Impurity C CAS# NA M.F.: C24H30O5 M.W.: 398.49 |
| |
QB162228 | (R)-Bupivacaine HCl CAS# 27262-46-0;27262-45-9(free base) M.F.: C18H28N2O.HCl M.W.: 288.44 36.46 |
| |
QC061834 | Cefuroxime Axetil EP Impurity D; Cefuroxime Sodium CAS# 56238-63-2;55268-75-2(free base) M.F.: C16H15N4NaO8S M.W.: 446.37 |
| |
QL052011 | Levetiracetam Impurity K CAS# NA M.F.: C9H16ClNO3 M.W.: 221.68 |
| |
QL052010 | Levetiracetam Impurity J CAS# NA M.F.: C8H14ClNO3 M.W.: 207.65 |
| |
QL052009 | Levetiracetam Impurity I CAS# 358629-51-3 M.F.: C9H15NO3 M.W.: 185.22 |
| |
QC131404 | Cefminox Sodium impurity 4 CAS# NA M.F.: C16H20N3NaO9S2 M.W.: 485.46 |
| |
QP160451 | Paliperidone Impurity 25 CAS# 16867-03-1 M.F.: C5H6N2O M.W.: 110.11 |
| |
QP160446 | Paliperidone Impurity 20 CAS# 517-23-7 M.F.: C6H8O3 M.W.: 128.13 |
| |
QP160437 | Paliperidone Impurity 11 CAS# 70381-47-4 M.F.: C11H12N2O2 M.W.: 204.23 |
| |
QP160436 | Paliperidone Impurity 10 CAS# 260273-82-3;849727-62-4(HCl salt) M.F.: C11H11ClN2O2 M.W.: 238.67 |
| |
QP160431 | Paliperidone Impurity 5 CAS# 1008796-22-2 M.F.: C18H18N2O3 M.W.: 310.35 |
| |
QP160430 | Paliperidone Impurity 4 CAS# 147687-17-0 M.F.: C18H17ClN2O2 M.W.: 328.79 |
| |
QP160427 | Paliperidone Impurity 1 CAS# 24016-03-3 M.F.: C12H12N2O M.W.: 200.24 |
| |
QT041241 | Tadalafil Impurity T CAS# 629652-40-0 M.F.: C22H19ClN2O5 M.W.: 426.85 |
| |
QT041237 | Tadalafil Impurity 15 CAS# 629652-44-4 M.F.: C22H19ClN2O5 M.W.: 426.85 |
| |
QT041239 | Tadalafil Impurity Ⅵ CAS# 171596-42-2 M.F.: C20H18N2O4 M.W.: 350.37 |
| |
QT041236 | Tadalafil Impurity 7 CAS# NA M.F.: C20H18N2O4 M.W.: 350.37 |
| |
QP032011 | Procaterol Impurity 11 CAS# 68304-21-2 M.F.: C10H7NO3 M.W.: 189.17 |
| |
QC-P221900 | Pravastatin Sodium Salt CAS# 81131-70-6;81093-37-0(free base) M.F.: C23H35NaO7 M.W.: 446.51 |
| |
QE061404 | Efinaconazole Impurity D CAS# NA M.F.: C12H11F2N3O M.W.: 251.23 |
| |
QE061403 | Efinaconazole Impurity C CAS# NA M.F.: C12H11F2N3O M.W.: 251.23 |
| |
QE061401 | Efinaconazole Impurity A CAS# NA M.F.: C12H13F2N3O2 M.W.: 269.25 |
| |
QC132602 | Cefmetazole Impurity B CAS# NA M.F.: C15H17N7O5S3 M.W.: 471.53 |
| |
QP136017 | Pidotimod Impurity Q CAS# NA M.F.: C11H16N2O4S M.W.: 272.32 |
| |
QP136015 | Pidotimod Impurity O CAS# NA M.F.: C11H16N2O4S M.W.: 272.32 |
| |
QS221802 | Controlled Substance (Suvorexant Impurity B) CAS# 1030377-80-0 M.F.: C23H23ClN6O2 M.W.: 450.92 |
| |
QS221801 | Suvorexant Impurity A CAS# 1276666-19-3 M.F.: C23H23ClN6O2 M.W.: 450.92 |
| |
QE042206 | Edaravone Related Compound CAS# 19735-89-8 M.F.: C10H10N2O M.W.: 174.2 |
| |
QD121227 | Diallylacetic Acid CAS# 99-67-2 M.F.: C8H12O2 M.W.: 140.18 |
| |
QA261914 | Azilsartan Impurity N CAS# 1397836-41-7 M.F.: C26H26N4O4 M.W.: 458.51 |
| |
QB121414 | Blonanserin Impurity N CAS# 132813-14-0 M.F.: C17H17ClFN M.W.: 289.77 |
| |
QC061811 | Cefuroxime Sodium EP Impurity E CAS# 97232-97-8 M.F.: C16H16N4O8S M.W.: 424.39 |
| |
QA190206 | Ascorbic Acid EP Impurity F Sodium Salt CAS# 6381-77-7 M.F.: C6H7NaO6 M.W.: 198.11 |
| |
QP136013 | Pidotimod Impurity M CAS# NA M.F.: C9H14N2O5S M.W.: 262.28 |
| |
QP136012 | Pidotimod Impurity L CAS# NA M.F.: C9H12N2O4S M.W.: 244.27 |
| |
QT081505 | Theophylline EP Impurity E CAS# 944-73-0 M.F.: C7H8N4O3 M.W.: 196.16 |
| |
QT081503 | Theophylline EP Impurity C;Caffeine EP Impurity B CAS# 7597-60-6 M.F.: C7H10N4O3 M.W.: 198.18 |
| |
QC061804 | Cefuroxime Sodium EP Impurity A CAS# 56271-94-4 M.F.: C15H15N3O7S M.W.: 381.36 |
| |
QT151604 | Tiopronin Impurity D CAS# 21269-37-4 M.F.: C10H16N2O6S2 M.W.: 324.37 |
| |
QT151603 | Tiopronin Impurity C CAS# 21709-90-0 M.F.: C5H9NO3 M.W.: 131.13 |
| |
QF041809 | Fludarabine Phosphate EP Impurity I CAS# 7561-54-8 M.F.: C10H15N6O7P M.W.: 362.24 |
| |
QF041808 | Fludarabine Phosphate EP Impurity H CAS# 548774-57-8 M.F.: C10H10FN5O3 M.W.: 267.22 |
| |
QF041804 | Fludarabine Phosphate EP Impurity D CAS# 700-49-2 M.F.: C5H4FN5 M.W.: 153.12 |
| |
QC062005 | Cefathiamidine Impurity E CAS# 2986-17-6 M.F.: C7H16N2S M.W.: 160.28 |
| |
QC062002 | Cefathiamidine Impurity B CAS# NA M.F.: C19H28N4O6S2 M.W.: 472.58 |
| |
QA202241 | Atorvastatin Lactone Diepoxide CAS# 1046118-40-4 M.F.: C33H33FN2O6 M.W.: 572.62 |
| |
QA161904 | Acetylsalicylic Acid EP Impurity D; Carbasalate calcium EP Impurity B; DL-Lysine acetylsalicylate EP Impurity L CAS# 530-75-6 M.F.: C16H12O6 M.W.: 300.27 |
| |
QA161906 | Aspirin Impurity F; Acetylsalicylic Acid EP Impurity F; Carbasalate calcium EP Impurity A CAS# 1466-82-6 M.F.: C18H14O7 M.W.: 342.30 |
| |
QA161905 | Aspirin Impurity E; Acetylsalicylic Acid EP Impurity E; Carbasalate calcium EP Impurity D; DL-Lysine acetylsalicylate EP Impurity M CAS# 552-94-3 M.F.: C14H10O5 M.W.: 258.23 |
| |
QA161902 | Aspirin Impurity B ;Acetylsalicylic Acid EP Impurity B CAS# 636-46-4 M.F.: C8H6O5 M.W.: 182.13 |
| |
QA161901 | Acetylsalicylic Acid EP Impurity A; Propyl Parahydroxybenzoate EP Impurity A; Sodium ethyl parahydroxybenzoate EP Impurity A; Butyl parahydroxybenzoate EP Impurity A CAS# 99-96-7 M.F.: C7H6O3 M.W.: 138.12 |
| |
QC061207 | Cefalexin Impurity 7 CAS# 72820-16-7 M.F.: C11H14N2O5S M.W.: 286.31 |
| |
QC061227 | Cephalexin Diketopiperazine CAS# 59865-11-1 M.F.: C16H17N3O4S M.W.: 347.39 |
| |
QT182612 | Terazosin EP Impurity L CAS# 40172-95-0 M.F.: C9H12N2O2 M.W.: 180.2 |
| |
QC060429 | Cefodizime Impurity 3 CAS# NA M.F.: C20H20N6O9S4 M.W.: 616.67 |
| |
QB082428 | Bromhexine EP Impurity B CAS# 50910-55-9 M.F.: C7H5Br2NO M.W.: 278.93 |
| |
QB082427 | Bromhexine EP Impurity A CAS# 50739-76-9 M.F.: C7H7Br2NO M.W.: 280.95 |
| |
QF210616 | Flurbiprofen impurity Ⅵ CAS# 927-68-4 M.F.: C4H7BrO2 M.W.: 167 |
| |
QF210615 | Flurbiprofen impurity Ⅴ CAS# 108-05-4 M.F.: C4H6O2 M.W.: 86.09 |
| |
QF210611 | Flurbiprofen impurityⅠ CAS# 41604-19-7 M.F.: C12H8BrF M.W.: 251.09 |
| |
QT140678 | Tenofovir Alafenamide Impurity 1 CAS# NA M.F.: C27H33N6O6PS M.W.: 600.63 |
| |
QG121907 | Granisetron EP Impurity G CAS# 34252-44-3 M.F.: C9H8N2O2 M.W.: 176.18 |
| |
QI192209 | Isavuconazole Impurity I CAS# 2170932-49-5 M.F.: C13H14F2N4OS M.W.: 312.34 |
| |
QT140676 | Tenofovir Disoproxil Impurity 76 CAS# NA M.F.: C19H30N5O10P M.W.: 519.45 |
| |
QC061419 | Cefdinir Impurity S CAS# NA M.F.: C16H15N5O6S2 M.W.: 437.45 |
| |
QA200305 | Atracurium Besylate Impurity 5 CAS# 1075727-04-6 M.F.: C24H31NO6 M.W.: 429.52 |
| |
QA200304 | Cisatracurium Besylate EP Impurity F Iodide CAS# NA M.F.: C29H42NO7. I M.W.: 516.65 |
| |
QI192208 | Isavuconazole Impurity H CAS# 219872-85-2 M.F.: C13H14F2N4O2 M.W.: 296.27 |
| |
QI192207 | Isavuconazole Impurity G CAS# 368421-58-3 M.F.: C13H14F2N4OS M.W.: 312.34 |
| |
QI192206 | Isavuconazole Impurity F CAS# 241479-74-3 M.F.: C13H12F2N4O M.W.: 278.26 |
| |
QC141507 | Cinepazide Impurity G CAS# 20329-98-0 M.F.: C12H14O5 M.W.: 238.24 |
| |
QP136011 | Pidotimod Impurity K CAS# NA M.F.: C4H7NO3S M.W.: 149.17 |
| |
QF041803 | Fludarabine phosphate EP impurity C CAS# 548774-53-4 M.F.: C10H14FN5O10P2 M.W.: 445.2 |
| |
QF041801 | Fludarabine phosphate EP Impurity A CAS# 62314-92-5 M.F.: C10H14N5O8P M.W.: 363.23 |
| |
QB191411 | Bosentan Impurity CAS# 1218951-81-5 M.F.: C35H38N6O6S2 M.W.: 702.84 |
| |
QM191613 | Mosapride Impurity M CAS# 1215825-20-9(free base) M.F.: C27H29ClFN3Na2O9 M.W.: 639.96 |
| |
QM191610 | Mosapride Impurity J CAS# 152013-26-8 M.F.: C14H20ClN3O3 M.W.: 313.78 |
| |
QD261605 | Diazepam EP Impurity E CAS# 20927-53-1 M.F.: C15H11ClN2O M.W.: 270.72 |
| |
QC061415 | Cefdinir Impurity O CAS# 178601-89-3 M.F.: C14H13N5O5S2 M.W.: 395.41 |
| |
QS060226 | Sofosbuvir Impurity 2 CAS# 1714114-25-6 M.F.: C18H17F5NO5P M.W.: 453.30 |
| |
QC122200 | Clevidipine CAS# 167221-71-8 M.F.: C21H23Cl2NO6 M.W.: 456.32 |
| |
QA121200 | Apronal CAS# 528-92-7 M.F.: C9H16N2O2 M.W.: 184.24 |
| |
QF120370 | Folic Acid Impurity 70 CAS# 1391194-56-1 M.F.: C7H6ClN5O M.W.: 211.61 |
| |
QF120369 | Folic Acid Impurity 69 CAS# 35011-47-3 M.F.: C4H9N5O5S M.W.: 239.21 |
| |
QI650900 | Inosine; Adenosine EP Impurity G; Didanosine EP Impurity B CAS# 58-63-9 M.F.: C10H12N4O5 M.W.: 268.23 |
| |
QT130200 | Trimebutine CAS# 39133-31-8 M.F.: C22H29NO5 M.W.: 387.47 |
| |
QD040235 | Disperse Blue 35 CAS# 12222-75-2 M.F.: C20H14N2O5 M.W.: 362.34 |
| |
QS161807 | Sulpiride EP Impurity G CAS# 67381-52-6 M.F.: C14H21N3O4S M.W.: 327.40 |
| |
QT081109 | Trihexyphenidyl impurity 9 CAS# 6853-22-1 M.F.: C16H25NO M.W.: 247.38 |
| |
QT140671 | Tenofovir Impurity 45 CAS# 1607007-18-0 M.F.: C18H26N10O7P2 M.W.: 556.41 |
| |
QD141613 | Donepezil Impurity M CAS# 197010-20-1 M.F.: C24H29NO4 M.W.: 395.49 |
| |
QM140408 | methyl 2-amino-3,5-dibromobenzoate CAS# 606-00-8 M.F.: C8H7Br2NO2 M.W.: 308.95 |
| |
QT120601 | Thalifendine CAS# 4668-19-3;18207-71-1(free base) M.F.: C19H16ClNO4 M.W.: 357.79 |
| |
QT140663 | Tenofovir disoproxil Impurity 37 CAS# [NA] M.F.: C9H14N5O4P M.W.: 287.21 |
| |
QT140649 | Tenofovir disoproxil Impurity 23 CAS# [NA] M.F.: C9H14N5O4P M.W.: 287.21 |
| |
QC141502 | Cinepazide Impurity B CAS# [NA] M.F.: C16H28N4O2 M.W.: 308.42 |
| |
QC141503 | Cinepazide Impurity C CAS# 1227926-25-1 M.F.: C22H31N3O6 M.W.: 433.50 |
| |
QI091602 | Ipratropium Bromide EP Impurity B CAS# 58073-59-9 M.F.: C20H30BrNO3 M.W.: 412.36 |
| |
QV701330 | L-Ascorbic acid CAS# 50-81-7 M.F.: C6H8O6 M.W.: 176.12 |
| |
QF141903 | Finasteride EP Impurity C CAS# 1329611-51-9;1800205-94-0 M.F.: C23H34N2O2 M.W.: 370.53 |
| |
QF120367 | Folic Acid EP Impurity E CAS# 1391068-26-0 M.F.: C26H24N12O7 M.W.: 616.54 |
| |
QF120368 | Folic Acid EP Impurity C;Isofolic acid CAS# 47707-78-8 M.F.: C19H19N7O6 M.W.: 441.40 |
| |
QF120366 | Folic Acid Isomer CAS# [NA] M.F.: C19H19N7O6 M.W.: 441.40 |
| |
QT060341 | Tofacitinib Impurity 16 CAS# [NA] M.F.: C29H38N10O2 M.W.: 558.68 |
| |
QT050241 | Tofacitinib Impurity 11 CAS# [NA] M.F.: C13H11N3O3S M.W.: 289.31 |
| |
QA130301 | Aminocaproic acid Impurity A CAS# 2014-58-6 M.F.: C12H24N2O3 M.W.: 244.33 |
| |
QP132016 | Pemetrexed EP Impurity E CAS# 182009-04-7;937370-10-0(2Na salt) M.F.: C20H21N5O6 M.W.: 427.41 |
| |
QT021407 | Terbinafine Impurity G; Terbinafine N-Oxide CAS# [NA] M.F.: C21H25NO M.W.: 307.43 |
| |
QF121306 | Flumazenil EP Impurity A CAS# 84378-44-9 M.F.: C13H10FN3O3 M.W.: 275.24 |
| |
QT140641 | Tenofovir disoproxil Impurity 15 CAS# [NA] M.F.: C15H26N5O4P M.W.: 371.37 |
| |
QF226811 | Fasudil Hydrochloride Impurity K CAS# [NA] M.F.: C9H7NO3S M.W.: 209.22 |
| |
QF226810 | Fasudil Hydrochloride Impurity J CAS# [NA] M.F.: C9H7NO3S M.W.: 209.22 |
| |
QA690320 | Abscisic acid CAS# 14375-45-2 M.F.: C15H20O4 M.W.: 264.32 |
| |
QB702001 | Butyl acetate;Tributyl Acetylcitrate EP Impurity E CAS# 123-86-4 M.F.: C6H12O2 M.W.: 116.16 |
| |
QB701400 | 1-Butanol;Tri-n-butyl Phosphate EP Impurity C;Tributyl Acetylcitrate EP Impurity D CAS# 71-36-3 M.F.: C4H10O M.W.: 74.12 |
| |
QA690345 | (+)-Abscisic acid-D6 CAS# 721948-65-8 M.F.: C15H14D6O4 M.W.: 270.35 |
| |
QT060324 | Tofacitinib Impurity X CAS# 1252883-90-1 M.F.: C20H25N5 M.W.: 335.45 |
| |
QE200305 | Entecavir Impurity 5 CAS# [NA] M.F.: C13H16N4O3 M.W.: 276.29 |
| |
QF191606 | Fosaprepitant Impurity F CAS# 1242175-34-3 M.F.: C23H21F7N4O3 M.W.: 534.43 |
| |
QL091601 | Lipoic Acid Impurity A CAS# 728854-75-9 M.F.: C10H20N2OS2 M.W.: 248.41 |
| |
QB640900 | Sodium benzoate CAS# 532-32-1 M.F.: C7H5NaO2 M.W.: 144.10 |
| |
QA690340 | (+)-Abscisic acid CAS# 21293-29-8 M.F.: C15H20O4 M.W.: 264.32 |
| |
QC242001 | Cefoxitin Sodium EP Impurity A CAS# 54333-94-7 M.F.: C15H16N2O6S2 M.W.: 384.43 |
| |
QF120304 | Folic Acid EP Impurity D CAS# 119-24-4 M.F.: C14H12N6O3 M.W.: 312.28 |
| |
QC-L131100 | L(-)-Malic acid CAS# 97-67-6 M.F.: C4H6O5 M.W.: 134.09 |
| |
QB640302 | Benzoic acid;Glycopyrronium Bromide EP Impurity D;Mefenamic Acid EP Impurity D;Tiaprofenic acid EP Impurity D CAS# 65-85-0 M.F.: C7H6O2 M.W.: 122.12 |
| |
QF210605 | Flurbiprofen EP Impurity E CAS# 137045-30-8 M.F.: C13H9FO2 M.W.: 216.21 |
| |
QL050303 | Lercanidipine Impurity C CAS# 77888-05-2 M.F.: C21H26N2O6 M.W.: 402.45 |
| |
QC061905 | Ceftaroline Fosamil Impurity E CAS# 1427207-46-2 M.F.: C9H8N2S2 M.W.: 208.31 |
| |
QC061902 | Ceftaroline Fosamil Impurity B CAS# 1240196-56-8 M.F.: C24H22N8O6S4 M.W.: 646.74 |
| |
QC061901 | Ceftaroline Fosamil Impurity A CAS# 1286218-70-9 M.F.: C22H22N8O6S4 M.W.: 622.72 |
| |
QE262016 | Ezetimibe Impurity P CAS# 1296129-16-2 M.F.: C33H30F2N2O5 M.W.: 572.60 |
| |
QL062003 | Lafutidine Sulfone CAS# 174583-84-7 M.F.: C22H29N3O5S M.W.: 447.54 |
| |
QI210427 | Ibuprofen Impurity 27 CAS# 1009-14-9 M.F.: C11H14O M.W.: 162.23 |
| |
QI220213 | Ivabradine Impurity T CAS# 1616710-50-9 M.F.: C27H34N2O6.HCl M.W.: 482.58 36.46 |
| |
QT042635 | Tedizolid Pyrophosphate Ester CAS# 1239662-48-6 M.F.: C17H17FN6O9P2 M.W.: 530.3 |
| |
QP142001 | Pantoprazole Impurity A CAS# [NA] M.F.: C7H8Cl3NO M.W.: 228.5 |
| |
QG130302 | Gemcitabine Impurity B(1’-Epi Gemcitabine 3’,5’-Dibenzoate) CAS# 134790-40-2 M.F.: C23H19F2N3O6 M.W.: 471.41 |
| |
QT090302 | Thioctic acid Impurity 2 CAS# 17370-41-1 M.F.: C8H14O4S2 M.W.: 238.32 |
| |
QD020725 | Dabigatran Etexilate Impurity Y CAS# [NA] M.F.: C14H21N3O2 M.W.: 263.34 |
| |
QD020723 | Dabigatran Etexilate Impurity W CAS# 1702936-92-2 M.F.: C19H20N4O3 M.W.: 352.39 |
| |
QD170602 | Diquafosol Impurity B CAS# 63-39-8 ;19817-92-6(3Na salt); 116295-90-0 (3Na 2H2O salt) M.F.: C9H15N2O15P3 M.W.: 484.14 |
| |
QL151800 | L-Ornithine;Arginine EP Impurity C; Lysine acetate EP Impurity E CAS# 70-26-8 M.F.: C5H12N2O2 M.W.: 132.16 |
| |
QE200900 | Zoledronic acid EP Impurity D CAS# 22884-10-2 M.F.: C5H6N2O2 M.W.: 126.11 |
| |
QA048203 | Aspartic acid Impurity C CAS# 3184-13-2 M.F.: C5H12N2O2 HCl M.W.: 132.16 36.46 |
| |
QA048202 | Aspartic acid Impurity B CAS# 42538-31-8 M.F.: C5H10N2O.HCl M.W.: 114.15 36.46 |
| |
QM162004 | Meptazinol Impurity D CAS# [NA] M.F.: C30H44N2O M.W.: 448.68 |
| |
QM162002 | Meptazinol Impurity B CAS# [NA] M.F.: C15H23N M.W.: 217.36 |
| |
QM162001 | Meptazinol Impurity A CAS# [NA] M.F.: C15H21NO2 M.W.: 247.34 |
| |
QL140728 | Linagliptin Impurity Z2 CAS# [NA] M.F.: C25H28N8O2 M.W.: 472.55 |
| |
QE122010 | Erlotinib Hydrochloride Impurity J CAS# 1029721-32-1(free base) M.F.: C22H24ClN3O4 M.W.: 429.9 |
| |
QE122009 | Erlotinib Hydrochloride Impurity I CAS# 2204518-92-1 M.F.: C22H24ClN3O4 M.W.: 429.9 |
| |
QA261913 | Azilsartan Impurity M CAS# 1442400-65-8 M.F.: C24H22N4O3 M.W.: 414.47 |
| |
QN201127 | Methyl naltrexone bromide D3 CAS# NA M.F.: C21H23D3BrNO4 M.W.: 439.36 |
| |
QI210432 | (S)-Ibuprofen D3 CAS# 98649-76-4 M.F.: C19H26O8 M.W.: 382.4 |
| |
QI222027 | Hydroxy Itraconazole D8 CAS# 1217516-26-1 M.F.: C35H30Cl2D8N8O5 M.W.: 729.68 |
| |
QG062027 | Gefitinib D8 CAS# 857091-32-8 M.F.: C22H16ClD8FN4O3 M.W.: 454.95 |
| |
QE262040 | Ezetimibe d4 CAS# 1093659-90-5 M.F.: C24H17D4F2NO3 M.W.: 413.45 |
| |
QF210601 | Flurbiprofen EP Impurity A CAS# 6341-72-6 M.F.: C15H14O2 M.W.: 226.28 |
| |
QD152427 | Doxylamine d5 CAS# 1216840-94-6 M.F.: C21H23D5N2O5 M.W.: 393.49 |
| |
QC061231 | Cephalexin D5 (Racemic) CAS# 23325-78-2 (unlabeled) M.F.: C16H12D5N3O4S M.W.: 352.42 |
| |
QA150906 | Atomoxetine D7 HCl (Racemic) CAS# NA M.F.: C17H15D7ClNO M.W.: 298.86 |
| |
QC161818 | Captopril EP Impurity N CAS# 65134-74-9 M.F.: C8H14O4S2 M.W.: 238.32 |
| |
QC120307 | Celecoxib Impurity G CAS# 1061214-06-9 M.F.: C15H17N3O2S M.W.: 303.38 |
| |
QC120306 | Celecoxib Impurity F CAS# 915280-81-8 M.F.: C8H8F3N3O3S M.W.: 283.23 |
| |
QD031201 | Daclatasvir Impurity A CAS# 1009107-27-0 M.F.: C40H50N8O6 M.W.: 738.88 |
| |
QC161817 | Captopril Impurity Q CAS# [NA] M.F.: C18H28N2O5S2 M.W.: 416.56 |
| |
QC161802 | Captopril EP Impurity B CAS# 80629-35-2 M.F.: C9H14BrNO3 M.W.: 264.12 |
| |
QC161816 | Captopril EP Impurity L CAS# [NA] M.F.: C19H30N2O6S2 M.W.: 446.58 |
| |
QC161814 | Captopril EP Impurity M CAS# [NA] M.F.: C13H21NO5S2 M.W.: 335.44 |
| |
QD033500 | N-Dodecanoyl-L-homoserine lactone CAS# 137173-46-7 M.F.: C16H29NO3 M.W.: 283.41 |
| |
QD033200 | N-Decanoyl-L-homoserine lactone CAS# 177315-87-6 M.F.: C14H25NO3 M.W.: 255.35 |
| |
QO003800 | N-Octanoyl-L-homoserine lactone CAS# 147852-84-4 M.F.: C12H21NO3 M.W.: 227.30 |
| |
QH011100 | N-Hexanoyl-L-homoserine lactone CAS# 147852-83-3 M.F.: C10H17NO3 M.W.: 199.25 |
| |
QO005900 | N-(3-Oxodecanoyl)-L-homoserine lactone CAS# 147795-40-2 M.F.: C14H23NO4 M.W.: 269.34 |
| |
QT014700 | N-Tetradecanoyl-DL-homoserine lactone CAS# 98206-80-5 M.F.: C18H33NO3 M.W.: 311.46 |
| |
QO006000 | N-(3-Oxotetradecanoyl)-L-homoserine lactone CAS# 177158-19-9 M.F.: C18H31NO4 M.W.: 325.44 |
| |
QF201402 | Controlled Substance (Fentanyl EP Impurity K) CAS# 1474-02-8 M.F.: C21H26N2O M.W.: 322.44 |
| |
QA162434 | Apixaban Impurity N CAS# [NA] M.F.: C24H25N5O4 M.W.: 447.49 |
| |
QD061402 | Diphenoxylate EP Impurity B CAS# 4370-12-1 M.F.: C2H2N2O M.W.: 70.05 |
| |
QS010211 | 5-Hydroxy Salbutamol (5-Hydroxy Albuterol, Levalbuterol Related Compound G) CAS# 182676-90-0 M.F.: C13H21NO4 M.W.: 255.31 |
| |
QD032004 | Docetaxel EP Impurity D CAS# 162784-72-7 M.F.: C43H51NO14 M.W.: 805.86 |
| |
QD032003 | Docetaxel EP Impurity C; 7-epi-Docetaxel CAS# 153381-68-1 M.F.: C43H53NO14 M.W.: 807.88 |
| |
QB201413 | Bortezomib Impurity Q CAS# [NA] M.F.: C10H16BN3O3 M.W.: 237.07 |
| |
QB201412 | Bortezomib Impurity P CAS# [NA] M.F.: C20H26N4O3 M.W.: 370.46 |
| |
QL140727 | Linagliptin Acetamide CAS# 1803079-49-3 M.F.: C27H30N8O3 M.W.: 514.58 |
| |
QL140726 | Linagliptin Impurity Z CAS# NA M.F.: C26H28N8O3 M.W.: 500.55 |
| |
QF022445 | Febuxostat Impurity Z19 CAS# 144060-62-8 M.F.: C16H17NO4S M.W.: 319.38 |
| |
QE201301 | Etomidate Impurity A CAS# 56649-48-0 M.F.: C12H12N2O2 M.W.: 216.24 |
| |
QP150119 | Propylparaben sodium;Sodium Propyl Parahydroxybenzoate CAS# 35285-69-9;94-13-3(free base) M.F.: C10H11NaO3 M.W.: 202.18 |
| |
QL142612 | Linezolid Impurity D CAS# [NA] M.F.: C7H12ClNO3 M.W.: 193.63 |
| |
QD242001 | Dextromethorphan EP Impurity B CAS# 125-73-5 M.F.: C17H23NO M.W.: 257.38 |
| |
QA162432 | Apixaban Impurity L CAS# 4792-57-8 M.F.: C12H16N2O3 M.W.: 236.27 |
| |
QA162430 | Apixaban Impurity J CAS# 1074549-87-3 M.F.: C26H27N5O4 M.W.: 473.52 |
| |
QI191804 | Isradipine EP Impurity D CAS# NA M.F.: C19H19N3O5 M.W.: 369.37 |
| |
QI191803 | Isradipine EP Impurity C CAS# NA M.F.: C17H17N3O5 M.W.: 343.33 |
| |
QL142211 | Lenvatinib Impurity K CAS# 1882873-21-3 M.F.: C21H17ClN4O3 M.W.: 408.84 |
| |
QS142003 | Sunitinib Impurity C CAS# [NA] M.F.: C20H23FN4O2 M.W.: 370.42 |
| |
QA220311 | Avibactam Impurity K CAS# [NA] M.F.: C14H17N3O3 M.W.: 275.30 |
| |
QC061801 | Cefuroxime Impurity 1 CAS# [NA] M.F.: C16H16N4O8S M.W.: 424.39 |
| |
QO022007 | Obeticholic Acid Impurity G CAS# 865244-30-0 M.F.: C26H44O4 M.W.: 420.63 |
| |
QO022006 | Obeticholic Acid Impurity F CAS# 1708092-13-0 M.F.: C26H44O4 M.W.: 420.63 |
| |
QE262012 | Ezetimibe Impurity L CAS# 1700622-08-7 M.F.: C24H21ClFNO3 M.W.: 425.88 |
| |
QC061606 | Cefpodoxime Proxetil EP Impurity F CAS# 96680-30-7 M.F.: C22H27N5O10S2 M.W.: 585.62 |
| |
QC061605 | Cefpodoxime Proxetil EP Impurity E CAS# 217803-89-9 M.F.: C22H27N5O10S2 M.W.: 585.62 |
| |
QC061604 | Cefpodoxime Proxetil EP Impurity D CAS# 947692-13-9 M.F.: C21H27N5O9S2 M.W.: 557.61 |
| |
QC061603 | Cefpodoxime Proxetil EP Impurity C CAS# 339528-86-8 M.F.: C21H27N5O9S2 M.W.: 557.61 |
| |
QC061602 | Cefpodoxime Proxetil EP Impurity B CAS# 947692-14-0 M.F.: C20H25N5O8S2 M.W.: 527.58 |
| |
QC061601 | Cefpodoxime Proxetil EP Impurity A CAS# 80210-62-4 M.F.: C15H17N5O6S2 M.W.: 427.46 |
| |
QT021602 | Tebipenem Pivoxil Impurity 2 CAS# 1391053-29-4 M.F.: C23H35N3O7S2 M.W.: 529.67 |
| |
QA165113 | Azithromycin EP Impurity M CAS# 765927-71-7 M.F.: C37H68N2O13 M.W.: 748.96 |
| |
QB041429 | Budesonide EP Impurity F (Desonide) CAS# 638-94-8 M.F.: C24H32O6 M.W.: 416.51 |
| |
QB041427 | Budesonide EP Impurity I CAS# 113930-13-5 M.F.: C25H34O7 M.W.: 446.53 |
| |
QB041426 | Budesonide EP Impurity J (Mixture of Diastereomers) CAS# 313474-59-8 M.F.: C25H33BrO6 M.W.: 509.43 |
| |
QB041425 | Budesonide Impurity 1 (Mixture of Diastereomers) CAS# NA M.F.: C25H32O7 M.W.: 444.53 |
| |
QB041418 | 6-Beta-Hydroxy Budesonide Sulfate CAS# NA M.F.: C25H34O10S M.W.: 526.61 |
| |
QB041413 | Budesonide EP Impurity G CAS# 137174-25-5 M.F.: C25H36O6 M.W.: 432.55 |
| |
QB041405 | Budesonide (Mixture of Diastereomers) CAS# 51333-22-3 M.F.: C25H34O6 M.W.: 430.55 |
| |
QV192003 | Valsartan USP RC C CAS# 137863-20-8 M.F.: C31H35N5O3 M.W.: 525.64 |
| |
QV192001 | Valsartan EP Impurity A CAS# 137862-87-4 M.F.: C24H29N5O3 M.W.: 435.52 |
| |
QT201605 | Tiotropium EP Impurity E CAS# 26447-85-8 M.F.: C11H10O3S2 M.W.: 254.33 |
| |
QT201604 | Tiotropium EP Impurity D CAS# 136310-66-2 M.F.: C18H19NO3S2 M.W.: 361.48 |
| |
QT200304 | Topotecan Acid Sodium Salt CAS# 123949-08-6 M.F.: C23H24N3NaO6 M.W.: 461.44 |
| |
QT200300H | Topotecan HCl CAS# 119413-54-6 M.F.: C23H24ClN3O5 M.W.: 457.91 |
| |
QT192010 | Telmisartan Bromo Acid CAS# 150766-86-2 M.F.: C14H11BrO2 M.W.: 291.14 |
| |
QT142404 | Tranexamic Acid EP Impurity D CAS# 56-91-7 M.F.: C8H9NO2 M.W.: 151.16 |
| |
QT142403 | Tranexamic Acid EP Impurity C CAS# 330838-52-3;1803601-44-6(HCl salt) M.F.: C8H13NO2 M.W.: 155.19 |
| |
QT142402 | Tranexamic Acid EP Impurity B CAS# 1197-17-7;3667-38-7(HCl salt) M.F.: C8H15NO2 M.W.: 157.21 |
| |
QT142401 | Tranexamic Acid EP Impurity A CAS# 93940-19-3 M.F.: C16H27NO4 M.W.: 297.39 |
| |
QT142400 | Tranexamic Acid CAS# 1197-18-8 M.F.: C8H15NO2 M.W.: 157.21 |
| |
QT131909 | Tamsulosin EP Impurity I CAS# 3259-03-8 M.F.: C10H13BrO2 M.W.: 245.11 |
| |
QT131906 | Tamsulosin EP Impurity F CAS# 6781-17-5;1051368-80-9(HCl salt) M.F.: C10H15NO2 M.W.: 181.23 |
| |
QT120604 | Tadalafil Desmethylene Impurity CAS# 171489-03-5 M.F.: C21H19N3O4 M.W.: 377.39 |
| |
QT030300 | Ticarcillin Disodium CAS# 4697-14-7 M.F.: C15H14N2Na2O6S2 M.W.: 428.39 |
| |
QS132009 | Sumatriptan Hydrazine Impurity CAS# 88933-16-8 M.F.: C8H13N3O2S M.W.: 215.27 |
| |
QS132003 | Sumatriptan EP Impurity C CAS# 1797905-62-4 M.F.: C15H23N3O3S M.W.: 325.43 |
| |
QS132001 | Sumatriptan EP Impurity A CAS# 545338-89-4 M.F.: C27H37N5O2S M.W.: 495.68 |
| |
QR131603 | Ramipril EP Impurity C CAS# 99742-35-5 M.F.: C23H39ClN2O5 M.W.: 459.02 |
| |
QR131601 | Ramipril EP Impurity A CAS# 108313-11-7 M.F.: C22H30N2O5 M.W.: 402.48 |
| |
QR131600 | Ramipril CAS# 87333-19-5 M.F.: C23H32N2O5 M.W.: 416.51 |
| |
QP240300 | Piroxicam CAS# 36322-90-4 M.F.: C15H13N3O4S M.W.: 331.35 |
| |
QP202202 | Pitavastatin Ethyl Ester CAS# 167073-19-0 M.F.: C27H28FNO4 M.W.: 449.51 |
| |
QP201611 | Pantoprazole Sulfide N-Methyl 6-Difluoromethoxy Analog CAS# NA M.F.: C17H17F2N3O3S M.W.: 381.4 |
| |
QO041905 | Ondansetron EP Impurity E; Sildenafil EP Impurity E; Clotrimazole EP Impurity D; Enalapril maleate EP Impurity I; Bifonazole EP Impurity C; Flutrimazole EP Impurity A CAS# 288-32-4 M.F.: C3H4N2 M.W.: 68.08 |
| |
QS120604 | Solifenacin Impurity D CAS# [NA] M.F.: C22H18N2O4 M.W.: 374.39 |
| |
QS120602 | Solifenacin Impurity B CAS# 52250-50-7 M.F.: C15H13N M.W.: 207.27 |
| |
QM202607 | Mirtazapine Impurity 7 CAS# 61338-13-4 M.F.: C17H19N3O2 M.W.: 297.35 |
| |
QM202605 | Mirtazapine EP Impurity E CAS# 191546-94-8 M.F.: C17H21N3 M.W.: 267.37 |
| |
QM202604 | Mirtazapine EP Impurity D CAS# 61337-68-6 M.F.: C16H17N3 M.W.: 251.33 |
| |
QM202602 | Mirtazapine EP Impurity B CAS# 61337-89-1 M.F.: C17H21N3O M.W.: 283.37 |
| |
QM202601 | Mirtazapine EP Impurity A CAS# 155172-12-6 M.F.: C17H19N3O M.W.: 281.35 |
| |
QT060317 | Tofacitinib Impurity Q CAS# 1092578-47-6;2174011-55-1(Citrate salt) M.F.: C16H20N6O M.W.: 312.37 |
| |
QT060316 | Tofacitinib Impurity P CAS# 1092578-48-7;2174011-54-0(Citrate) M.F.: C16H20N6O M.W.: 312.37 |
| |
QL162000 | Lapatinib Ditosylate Hydrate CAS# 388082-78-8;388082-77-7 (ditosylate salt);231277-92-2 (free base) M.F.: C43H44ClFN4O11S3 M.W.: 943.48 |
| |
QL142609 | Linezolid Desacetamide Phthalimide CAS# 168828-89-5 M.F.: C22H20FN3O5 M.W.: 425.41 |
| |
QL142607 | Linezolid Descarbonyl Impurity CAS# 333753-67-6 M.F.: C15H22FN3O3 M.W.: 311.35 |
| |
QL142606 | Linezolid Desacetamide Hydroxy Impurity CAS# 168828-82-8 M.F.: C14H17FN2O4 M.W.: 296.29 |
| |
QL142604 | Linezolid Desfluoro Impurity CAS# 556801-15-1 M.F.: C16H21N3O4 M.W.: 319.36 |
| |
QL142601 | Linezolid USP RC A CAS# 168828-84-0 M.F.: C14H16FN5O3 M.W.: 321.31 |
| |
QL062405 | Levofloxacin EP Impurity C CAS# 117678-38-3 M.F.: C18H20FN3O5 M.W.: 377.37 |
| |
QL062404 | Levofloxacin EP Impurity A;R-Ofloxacin CAS# 100986-86-5 M.F.: C18H20FN3O4 M.W.: 361.37 |
| |
QL062403 | Levofloxacin EP Impurity H; USP Levofloxacin Related Compound C CAS# 177472-30-9 M.F.: C20H24FN3O4 M.W.: 389.42 |
| |
QL062402 | Levofloxacin EP Impurity F; USP Levofloxacin Related Compound B CAS# 100986-89-8 M.F.: C13H9F2NO4 M.W.: 281.21 |
| |
QL062401 | Levofloxacin EP Impurity B; Levofloxacin USP Related Compound A CAS# 117707-40-1;2254176-11-7(HCl salt) M.F.: C17H18FN3O4 M.W.: 347.34 |
| |
QL062001 | Lafutidine Phthalimide Impurity CAS# 146447-26-9 M.F.: C27H29N3O7 M.W.: 507.54 |
| |
QL061308 | Leflunomide EP Impurity H CAS# 24522-30-3 M.F.: C10H7F3N2O M.W.: 228.17 |
| |
QL061307 | Leflunomide EP Impurity G CAS# 724429-16-7 M.F.: C12H12N2O2 M.W.: 216.24 |
| |
QL061303 | Leflunomide EP Impurity C CAS# 61643-23-0 M.F.: C12H9F3N2O2 M.W.: 270.21 |
| |
QL061302 | Leflunomide EP Impurity B;Teriflunomide CAS# 163451-81-8 M.F.: C12H9F3N2O2 M.W.: 270.21 |
| |
QL052008 | Levetiracetam Carboxylic Acid CAS# 102849-49-0 M.F.: C8H13NO3 M.W.: 171.19 |
| |
QL052003 | Levetiracetam EP Impurity C CAS# 142-08-5 M.F.: C5H5NO M.W.: 95.10 |
| |
QL031601 | Levocloperastine Fendizoic Acid Impurity CAS# 84627-04-3 M.F.: C20H14O4 M.W.: 318.32 |
| |
QL031600H | Levocloperastine Hydrochloride CAS# NA M.F.: C20H25Cl2NO M.W.: 366.32 |
| |
QL031600F | Levocloperastine Fendizoate CAS# 220329-19-1 M.F.: C40H38ClNO5 M.W.: 648.19 |
| |
QK201604 | Ketoprofen EP Impurity D CAS# 107257-20-5 M.F.: C17H16O3 M.W.: 268.31 |
| |
QK201601 | Ketoprofen EP Impurity A CAS# 66067-44-5 M.F.: C15H12O2 M.W.: 224.25 |
| |
QI200308 | Irinotecan Acid Sodium Salt CAS# NA M.F.: C33H39N4NaO7 M.W.: 626.68 |
| |
QI200303 | Irinotecan EP Impurity E CAS# 86639-52-3 M.F.: C22H20N2O5 M.W.: 392.4 |
| |
QI200301 | Irinotecan EP Impurity A CAS# 103816-16-6 M.F.: C31H34N4O6 M.W.: 558.62 |
| |
QI192013 | Irbesartan N1-Trityl Impurity CAS# 138402-10-5 M.F.: C44H42N6O M.W.: 670.84 |
| |
QI032611 | Itraconazole Dioxolonyl Impurity CAS# 67914-86-7 M.F.: C14H15Cl2N3O5S M.W.: 408.26 |
| |
QI032610 | Itraconazole Methoxy Nitro Impurity CAS# NA M.F.: C17H21N3O M.W.: 283.37 |
| |
QI032604 | Itraconazole EP Impurity D CAS# 89848-49-7 M.F.: C34H36Cl2N8O4 M.W.: 691.61 |
| |
QH041204 | Hydralazine Triazolo Methyl Impurity CAS# 20062-41-3 M.F.: C10H8N4 M.W.: 184.2 |
| |
QH032004 | Hydrochlorothiazide 5-Chloro Impurity CAS# 5233-42-1 M.F.: C7H7Cl2N3O4S2 M.W.: 332.18 |
| |
QH032003 | Hydrochlorothiazide EP Impurity C CAS# 402824-96-8 M.F.: C15H16Cl2N6O8S4 M.W.: 607.49 |
| |
QH032001 | Hydrochlorothiazide EP Impurity A; Chlorothiazide CAS# 58-94-6 M.F.: C7H6ClN3O4S2 M.W.: 295.72 |
| |
QG200607 | Gatifloxacin Despropylene Impurity CAS# 172426-86-7 M.F.: C16H18FN3O4 M.W.: 335.33 |
| |
QG200606 | Gatifloxacin Desethylene Impurity CAS# 172426-87-8 M.F.: C17H20FN3O4 M.W.: 349.36 |
| |
QG121606 | Glipizide EP Impurity F CAS# 192118-08-4 M.F.: C11H16N2O4S M.W.: 272.32 |
| |
QG121601 | Glipizide EP Impurity A CAS# 33288-71-0 M.F.: C14H16N4O3S M.W.: 320.37 |
| |
QG121308 | Glimepiride EP Impurity H CAS# NA M.F.: C24H28N4O5S M.W.: 484.57 |
| |
QG121305 | Glimepiride EP Impurity E CAS# NA M.F.: C16H21N3O4S M.W.: 351.1253 |
| |
QG121304 | Glimepiride EP Impurity D CAS# 791104-62-6 M.F.: C24H34N4O5S M.W.: 490.62 |
| |
QG121303 | Glimepiride EP Impurity C CAS# 119018-30-3 M.F.: C18H23N3O6S M.W.: 409.46 |
| |
QG121302 | Glimepiride EP Impurity B CAS# 119018-29-0 M.F.: C16H21N3O4S M.W.: 351.42 |
| |
QG121301 | Glimepiride EP Impurity A CAS# 684286-46-2 M.F.: C24H34N4O5S M.W.: 490.62 |
| |
QF192007 | Fesoterodine Diol Dimer CAS# 1428856-45-4 M.F.: C44H60N2O3 M.W.: 664.96 |
| |
QF192006 | Fesoterodine Phenol Aldehyde Impurity CAS# NA M.F.: C22H29NO2 M.W.: 339.47 |
| |
QF192005 | Fesoterodine Isobutyrate Aldehyde Impurity CAS# NA M.F.: C26H35NO3 M.W.: 409.56 |
| |
QF192004 | Fesoterodine Fumarate Ester CAS# 1254942-29-4 M.F.: C30H39NO6 M.W.: 509.63 |
| |
QF192003 | Fesoterodine Diol Fumarate Ester CAS# 1428856-47-6 M.F.: C26H33NO5 M.W.: 439.54 |
| |
QF192001 | Fesoterodine Fumarate S-Isomer CAS# 1431511-18-0 M.F.: C30H41NO7 M.W.: 527.65 |
| |
QF192000 | Fesoterodine Fumarate CAS# 286930-03-8 M.F.: C30H41NO7 M.W.: 527.65 |
| |
QF191408 | Fosinopril USP RC H CAS# NA M.F.: C10H15O3P M.W.: 214.2 |
| |
QF191407 | Fosinopril USP RC G CAS# NA M.F.: C12H17O4P M.W.: 256.23 |
| |
QF191406 | Fosinopril USP RC B CAS# NA M.F.: C30H46NO7P M.W.: 563.66 |
| |
QF191405 | Fosinopril EP Impurity F CAS# NA M.F.: C29H44NO7P M.W.: 549.64 |
| |
QF191404 | Fosinopril EP Impurity E CAS# NA M.F.: C30H40NO7P M.W.: 557.61 |
| |
QF191403 | Fosinopril EP Impurity D CAS# NA M.F.: C30H46NO7P M.W.: 563.66 |
| |
QF191402 | Fosinopril EP Impurity C CAS# NA M.F.: C30H46NO7P M.W.: 563.66 |
| |
QF191401 | Fosinopril EP Impurity A CAS# 95399-71-6 M.F.: C23H34NO5P M.W.: 435.49 |
| |
QF191400NA | Fosinopril Sodium CAS# 88889-14-9 M.F.: C30H45NNaO7P M.W.: 585.64 |
| |
QF190400NA | Fusidate Sodium CAS# 751-94-0 M.F.: C31H47NaO6 M.W.: 538.69 |
| |
QF141908 | Finasteride Dehydro Carboxylic Acid Methyl Ester CAS# NA M.F.: C20H27NO3 M.W.: 329.43 |
| |
QF141907 | Finasteride Dehydro Carboxylic Acid CAS# NA M.F.: C19H25NO3 M.W.: 315.41 |
| |
QF141906 | Finasteride Dihydro Carboxylic Acid Methyl Ester CAS# NA M.F.: C20H31NO3 M.W.: 333.47 |
| |
QF141905 | Finasteride Dihydro Carboxylic Acid CAS# NA M.F.: C19H29NO3 M.W.: 319.44 |
| |
QF141901 | Finasteride EP Impurity A CAS# 98319-24-5 M.F.: C23H38N2O2 M.W.: 374.56 |
| |
QF122404 | Fluoxetine R-Isomer HCl CAS# 114247-09-5 M.F.: C17H19ClF3NO M.W.: 345.79 |
| |
QF122403 | Fluoxetine EP Impurity C CAS# 79088-29-2 M.F.: C17H19ClF3NO M.W.: 345.79 |
| |
QF122011 | Fluticasone Carboxylic Acid CAS# 28416-82-2 M.F.: C21H26F2O5 M.W.: 396.42 |
| |
QF122010 | Fluticasone USP RC B CAS# 219719-95-6 M.F.: C22H24F2O5S M.W.: 438.48 |
| |
QF122009 | Fluticasone Propionate EP Impurity I CAS# 960071-64-1 M.F.: C48H58F4O10S3 M.W.: 967.16 |
| |
QF122008 | Fluticasone Propionate EP Impurity H CAS# 201812-64-8 M.F.: C48H58F4O10S2 M.W.: 935.09 |
| |
QF122005 | Fluticasone Propionate EP Impurity E CAS# 105613-90-9 M.F.: C25H33F3O5S M.W.: 502.59 |
| |
QF122004 | Fluticasone Propionate EP Impurity D CAS# 73205-13-7 M.F.: C25H32F2O5S M.W.: 482.58 |
| |
QF122002 | Fluticasone Propionate EP Impurity B CAS# 948566-12-9 M.F.: C24H30F2O6S M.W.: 484.55 |
| |
QF122000P | Fluticasone Propionate CAS# 80474-14-2 M.F.: C25H31F3O5S M.W.: 500.57 |
| |
QF061300 | Fosfomycin Trometamol CAS# 78964-85-9 M.F.: C3H7O4P.C4H11NO3 M.W.: 138.06 121.14 |
| |
QE200313 | Entacapone EP Impurity C CAS# 116313-85-0 M.F.: C7H5NO5 M.W.: 183.12 |
| |
QE181406 | Eplerenone delta-9,11-Analog CAS# 95716-70-4 M.F.: C24H30O5 M.W.: 398.49 |
| |
QE181404 | Eplerenone 6-beta-Hydroxy Analog CAS# 209253-80-5 M.F.: C24H30O7 M.W.: 430.49 |
| |
QE181403 | Eplerenone Impurity - Canrenone;Spironolactone EP Impurity F CAS# 976-71-6 M.F.: C22H28O3 M.W.: 340.46 |
| |
QE181402 | Eplerenone Impurity - 11-alpha-Hydroxy Canrenone CAS# 192569-17-8 M.F.: C22H28O4 M.W.: 356.46 |
| |
QE181401 | Eplerenone Impurity - 9,11-Didehydro Canrenone CAS# 95716-71-5 M.F.: C22H26O3 M.W.: 338.44 |
| |
QE162002 | Epothilone B CAS# 152044-54-7 M.F.: C27H41NO6S M.W.: 507.69 |
| |
QE151303 | Esomeprazole EP Impurity C;Ufiprazole CAS# 73590-85-9 M.F.: C17H19N3O2S M.W.: 329.42 |
| |
QE141209 | Enalapril Alanyl Proline Impurity CAS# 13485-59-1 M.F.: C8H14N2O3 M.W.: 186.21 |
| |
QE141202 | Enalapril maleate EP Impurity B ; Quinapril EP Impurity B; Ramipril EP Impurity F; Spirapril EP Impurity C CAS# 82717-96-2 M.F.: C15H21NO4 M.W.: 279.33 |
| |
QE141200M | Enalapril Maleate CAS# 76095-16-4 M.F.: C24H32N2O9 M.W.: 492.52 |
| |
QE021900NA | Ecabet Sodium CAS# 86408-72-2 M.F.: C20H27NaO5S M.W.: 402.48 |
| |
QD261204 | Dorzolamide EP Impurity D CAS# 154154-90-2 (base);164455-27-0 (HCl salt) M.F.: C8H13ClN2O4S3 M.W.: 332.85 |
| |
QD261203 | Dorzolamide EP Impurity C CAS# NA M.F.: C10H17BN2O6S3 M.W.: 368.26 |
| |
QD261202 | Dorzolamide EP Impurity B CAS# 120279-37-0 M.F.: C10H17ClN2O4S3 M.W.: 360.9 |
| |
QD261200 | Dorzolamide HCl CAS# 130693-82-2 M.F.: C10H17ClN2O4S3 M.W.: 360.9 |
| |
QD242607 | Doxazosin EP Impurity G; Prazosin EP Impurity C; Terazosin EP Impurity C CAS# 60547-97-9 M.F.: C14H19N5O2 M.W.: 289.33 |
| |
QD242606 | Doxazosin EP Impurity F; Prazosin EP Impurity A; Terazosin EP Impurity A; Alfuzosin EP Impurity B CAS# 23680-84-4 M.F.: C10H10ClN3O2 M.W.: 239.66 |
| |
QD242605 | Doxazosin EP Impurity E CAS# 27631-29-4 M.F.: C10H8Cl2N2O2 M.W.: 259.09 |
| |
QD242604 | Doxazosin EP Impurity D CAS# 28888-44-0 M.F.: C10H10N2O4 M.W.: 222.2 |
| |
QD242603 | Doxazosin EP Impurity C CAS# 617677-53-9 M.F.: C22H22N2O6 M.W.: 410.42 |
| |
QD242601 | Doxazosin EP Impurity A CAS# 3663-80-7 M.F.: C9H8O4 M.W.: 180.16 |
| |
QD242600M | Doxazosin Mesylate CAS# 77883-43-3 M.F.: C24H29N5O8S M.W.: 547.58 |
| |
QD241300SP | Dexamethasone Sodium Phosphate CAS# 2392-39-4 M.F.: C22H28FNa2O8P M.W.: 516.4 |
| |
QD221208 | Desvenlafaxine Spiro Impurity CAS# NA M.F.: C16H23NO2.HCl M.W.: 261.37 36.46 |
| |
QD221207 | Desvenlafaxine N-Desmethyl Impurity CAS# 135308-74-6 M.F.: C15H23NO2 M.W.: 249.35 |
| |
QD221206 | Desvenlafaxine S-Isomer CAS# NA M.F.: C16H25NO2 M.W.: 263.38 |
| |
QD221204 | Desvenlafaxine R-Isomer CAS# 142761-11-3 M.F.: C16H25NO2 M.W.: 263.38 |
| |
QD221202 | Desvenlafaxine N,N-Didesmethyl Impurity CAS# 135308-76-8 M.F.: C14H21NO2.HCl M.W.: 235.33 36.46 |
| |
QD221201 | Desvenlafaxine Phenol Impurity CAS# 539-15-1;62493-39-4(H2SO4 salt) M.F.: C10H15NO M.W.: 165.23 |
| |
QD181600 | Doripenem Monohydrate CAS# 364622-82-2;148016-81-3(free base) M.F.: C15H24N4O6S2.H2O M.W.: 420.50 18.02 |
| |
QD180609 | Darifenacin Pyrrolidine Impurity S-Isomer CAS# 134002-26-9 M.F.: C22H26N2O7 M.W.: 430.45 |
| |
QD180608 | Darifenacin Pyrrolidine Impurity Racemate CAS# 103887-32-7 M.F.: C18H20N2O M.W.: 280.36 |
| |
QD180607 | Darifenacin Dimer-2 Impurity CAS# NA M.F.: C38H40N2O3 M.W.: 572.74 |
| |
QD180606 | Darifenacin Dimer-1 Impurity CAS# NA M.F.: C38H40N2O3 M.W.: 572.74 |
| |
QD180605 | Darifenacin Dehydro Impurity CAS# NA M.F.: C28H28N2O2 M.W.: 424.53 |
| |
QD180604 | Darifenacin Cyano Impurity CAS# 1159977-31-7 M.F.: C23H26N2O2 M.W.: 362.46 |
| |
QD180603 | Darifenacin Carboxylic Acid Impurity CAS# 69999-16-2 M.F.: C10H10O3 M.W.: 178.18 |
| |
QD180602 | Darifenacin Bromo Impurity CAS# 127264-14-6 M.F.: C10H11BrO M.W.: 227.1 |
| |
QD180601 | Darifenacin R-Isomer CAS# NA M.F.: C28H31BrN2O2 M.W.: 507.46 |
| |
QD180600H | Darifenacin HBr CAS# 133099-07-7 M.F.: C28H31BrN2O2 M.W.: 507.46 |
| |
QD161801 | Dipyridamole EP Impurity A CAS# 16982-40-4 M.F.: C25H40N8O2 M.W.: 484.64 |
| |
QD160405 | Domperidone EP Impurity E CAS# 1346602-50-3 M.F.: C32H34ClN7O3 M.W.: 600.11 |
| |
QD160404 | Domperidone EP Impurity D CAS# 1614255-34-3 M.F.: C32H34ClN7O3 M.W.: 600.11 |
| |
QD160403 | Domperidone Impurity C CAS# 118435-03-3 M.F.: C22H24ClN5O3 M.W.: 441.91 |
| |
QD160402 | Domperidone EP Impurity B CAS# 1346598-11-5 M.F.: C13H14ClN3O2 M.W.: 279.72 |
| |
QD160401 | Domperidone EP Impurity A CAS# 53786-28-0 M.F.: C12H14ClN3O M.W.: 251.71 |
| |
QD141612 | Donepezil Aldehyde Impurity CAS# 22065-85-6 M.F.: C13H17NO M.W.: 203.28 |
| |
QD141611 | Donepezil Keto Acid Impurity CAS# NA M.F.: C24H29NO5 M.W.: 411.49 |
| |
QD141610 | Donepezil Hydroxy Acid Impurity CAS# NA M.F.: C24H31NO5 M.W.: 413.51 |
| |
QD141609 | Donepezil Pyridine Dihydro Impurity CAS# NA M.F.: C17H15NO3 M.W.: 281.31 |
| |
QD141607 | Donepezil Hydroxy Keto Impurity CAS# 197010-20-1 M.F.: C24H29NO4 M.W.: 395.49 |
| |
QD141606 | Donepezil Dihydro Impurity CAS# 120012-04-6 M.F.: C24H31NO3 M.W.: 381.51 |
| |
QD141605 | Donepezil Desbenzyl Impurity CAS# 120013-39-0 M.F.: C17H23NO3.HCl M.W.: 289.38 36.46 |
| |
QD141603 | Donepezil Dehydro Deoxy Impurity CAS# 120013-45-8 M.F.: C24H29NO2 M.W.: 363.49 |
| |
QD141602 | Donepezil Benzyl Bromide CAS# 844694-85-5 M.F.: C31H36BrNO3 M.W.: 550.53 |
| |
QD141600 | Donepezil Hydrochloride CAS# 120011-70-3;884740-09-4(HCl monohydrate) M.F.: C24H29NO3.HCl M.W.: 379.50 36.46 |
| |
QD122411 | Duloxetine Impurity 11 CAS# 132335-44-5 M.F.: C9H15NOS M.W.: 185.29 |
| |
QD122410 | Duloxetine N-Desmethyl Metabolite CAS# 178273-35-3 M.F.: C17H17NOS M.W.: 283.39 |
| |
QD122409 | Duloxetine Impurity 9 CAS# 132335-46-7;132335-47-8(Oxalate) M.F.: C19H21NOS M.W.: 311.44 |
| |
QD122408 | Duloxetine USP RC H CAS# 199191-66-7 M.F.: C22H23NO4S M.W.: 397.49 |
| |
QD122405 | Duloxetine EP Impurity E CAS# 1033803-59-6 M.F.: C18H19NOS M.W.: 297.41 |
| |
QD122402 | Duloxetine EP Impurity B CAS# 116539-55-0 M.F.: C8H13NOS M.W.: 171.26 |
| |
QD122401 | Duloxetine EP Impurity A CAS# 116539-60-7;910138-96-4(HCl salt) M.F.: C18H19NOS M.W.: 297.41 |
| |
QD122400 | Duloxetine Hydrochloride CAS# 136434-34-9;116539-59-4(free base) M.F.: C18H20ClNOS M.W.: 333.88 |
| |
QD061802 | Aspirin Impurity C; Mesalazine EP Impurity H; Lamivudine EP Impurity C; Acetylsalicylic Acid EP Impurity C; Sulfasalazine EP Impurity H; Carbasalate calcium EP Impurity C; DL-Lysine acetylsalicylate EP Impurity A CAS# 69-72-7 M.F.: C7H6O3 M.W.: 138.12 |
| |
QD061801 | Deferasirox Benzamide Impurity CAS# 65-45-2 M.F.: C7H7NO2 M.W.: 137.14 |
| |
QD030410 | Diclofenac Desacetate Impurity CAS# 15307-93-4 M.F.: C12H9Cl2N M.W.: 238.11 |
| |
QD030409 | Diclofenac 4-Bromo Analog CAS# NA M.F.: C19H11BrClN02 M.W.: 340.6 |
| |
QD030406 | Diclofenac Carboxylic Acid CAS# 13625-57-5 M.F.: C13H9Cl2NO2 M.W.: 282.12 |
| |
QD030405 | Diclofenac EP Impurity E CAS# 59-48-3 M.F.: C8H7NO M.W.: 133.15 |
| |
QD030403 | Diclofenac EP Impurity C CAS# 27204-57-5 M.F.: C13H11Cl2NO M.W.: 268.14 |
| |
QD030402 | Diclofenac EP Impurity B CAS# 22121-58-0 M.F.: C13H9Cl2NO M.W.: 266.12 |
| |
QD030401 | Diclofenac EP Impurity A CAS# 15362-40-0 M.F.: C14H9Cl2NO M.W.: 278.13 |
| |
QC261200NA | Cefazolin Sodium CAS# 27164-46-1;25953-19-9(free base) M.F.: C14H13N8NaO4S3 M.W.: 476.49 |
| |
QC250100M | Cyamemazine Maleate CAS# NA M.F.: C19H21N3S C4H4O4 M.W.: 323.46 116.07 |
| |
QC242000NA | Cefoxitin Sodium CAS# 33564-30-6 M.F.: C18H16N3NaO7S2 M.W.: 449.43 |
| |
QC221200 | Clavulanate Potassium CAS# 61177-45-5;58001-44-8(free base) M.F.: C8H8KNO5 M.W.: 237.25 |
| |
QC201813 | Cetirizine EP Impurity B Ethyl Ester CAS# NA M.F.: C21H25ClN2O2 M.W.: 372.89 |
| |
QC201812 | Cetirizine 4-Chlorobenzophenone Impurity (USP) CAS# 134-85-0 M.F.: C13H9ClO M.W.: 216.66 |
| |
QC201811 | Cetirizine 4-Chlorobenzhydrol Impurity (USP); Meclizine USP RC A;Meclozine EP Impurity B CAS# 119-56-2 M.F.: C13H11ClO M.W.: 218.68 |
| |
QC201803 | Cetirizine EP Impurity C;USP 2-Chlorocetirizine CAS# 2702511-37-1;83881-59-8 (free base) M.F.: C21H25ClN2O3 2HCl M.W.: 388.89 72.92 |
| |
QC200600 | Ceftiofur Sodium CAS# 104010-37-9 M.F.: C19H16N5NaO7S3 M.W.: 545.54 |
| |
QC192042 | Candesartan Methyl Ester N1-Trityl Methoxy Analog CAS# 1246815-58-6 M.F.: C43H34N6O3 M.W.: 682.77 |
| |
QC192041 | Candesartan N2-Trityl Methoxy Analog CAS# NA M.F.: C42H32N6O3 M.W.: 668.74 |
| |
QC192039 | Candesartan N1-Trityl Methoxy Analog CAS# 1246820-94-9 M.F.: C42H32N6O3 M.W.: 668.74 |
| |
QC192038 | Candesartan N2-Trityl Impurity CAS# NA M.F.: C43H34N6O3 M.W.: 682.77 |
| |
QC192037 | Candesartan Cilexetil N2-Trityl Methoxy Analog CAS# NA M.F.: C51H46N6O6 M.W.: 838.95 |
| |
QC192036 | Candesartan Cilexetil Desethyl N2-Trityl Analog CAS# NA M.F.: C50H44N6O6 M.W.: 824.92 |
| |
QC192035 | Candesartan Cilexetil Desethyl N1-Trityl Analog CAS# 934495-65-5 M.F.: C50H44N6O6 M.W.: 824.92 |
| |
QC192034 | Candesartan Methyl Ester N2-Trityl Analog CAS# NA M.F.: C44H36N6O3 M.W.: 696.8 |
| |
QC192033 | Candesartan Cilexetil N2-Trityl Analog CAS# NA M.F.: C52H48N6O6 M.W.: 852.97 |
| |
QC192032 | Candesartan Cilexetil N1-Trityl Methoxy Analog CAS# 1246818-56-3 M.F.: C51H46N6O6 M.W.: 838.95 |
| |
QC192030 | Candesartan Ethyl Ester N2-Cilexetil Analog CAS# NA M.F.: C35H38N6O6 M.W.: 638.71 |
| |
QC192029 | Candesartan Benzimidazole Methoxy Impurity CAS# 1246817-06-0 M.F.: C10H10N2O3 M.W.: 206.2 |
| |
QC192028 | Candesartan Ethyl Ester N2-Trityl Analog CAS# NA M.F.: C45H38N6O3 M.W.: 710.82 |
| |
QC192027 | Candesartan Methyl Ester N1-Trityl Analog CAS# 150058-29-0 M.F.: C44H36N6O3 M.W.: 696.8 |
| |
QC192025 | Candesartan Cilexetil Methoxy Analog CAS# 1026042-12-5 M.F.: C32H33ClN6O6 M.W.: 633.09 |
| |
QC192023 | Candesartan Ethyl Ester N1-Cilexetil Analog CAS# NA M.F.: C35H38N6O6 M.W.: 638.71 |
| |
QC192022 | Candesartan Benzimidazole Ethoxy Impurity CAS# 150058-27-8 M.F.: C11H12N2O3 M.W.: 220.22 |
| |
QC192021 | Candesartan N2-Ethyl Impurity CAS# 1246819-02-2 M.F.: C26H24N6O3 M.W.: 468.51 |
| |
QC192020 | Candesartan N1-Ethyl Impurity CAS# NA M.F.: C26H24N6O3 M.W.: 468.51 |
| |
QC192019 | Candesartan Ethyl Ester Desethyl Analog CAS# NA M.F.: C24H20N6O3 M.W.: 440.45 |
| |
QC192018 | Candesartan Methyl Ester Desethyl Analog CAS# NA M.F.: C23H18N6O3 M.W.: 426.43 |
| |
QC192017 | Candesartan Ethyl Ester Desethyl N2-Cilexetil Analog CAS# NA M.F.: C33H34N6O6 M.W.: 610.66 |
| |
QC192016 | Candesartan Ethyl Ester Desethyl N1-Cilexetil Analog CAS# NA M.F.: C33H34N6O6 M.W.: 610.66 |
| |
QC192011 | Candesartan Bromo N1-Trityl Impurity CAS# NA M.F.: C33H25BrN4 M.W.: 557.48 |
| |
QC192010 | Candesartan Ethyl Ester N1-Trityl Analog CAS# 856414-35-2 M.F.: C45H38N6O3 M.W.: 710.82 |
| |
QC192009 | Candesartan Cilexetil EP Impurity I CAS# 139481-69-9 M.F.: C25H22N6O3 M.W.: 454.48 |
| |
QC192008 | Candesartan Cilexetil EP Impurity H CAS# 170791-09-0 M.F.: C52H48N6O6 M.W.: 852.97 |
| |
QC192007 | Candesartan Cilexetil EP Impurity G ; Candesartan CAS# 139481-59-7 M.F.: C24H20N6O3 M.W.: 440.45 |
| |
QC192006 | Candesartan Cilexetil EP Impurity F CAS# 914613-36-8 M.F.: C35H38N6O6 M.W.: 638.71 |
| |
QC192005 | Candesartan Cilexetil EP Impurity E CAS# 914613-35-7 M.F.: C35H38N6O6 M.W.: 638.71 |
| |
QC192004 | Candesartan Cilexetil EP Impurity D CAS# 1185256-03-4 M.F.: C33H34N6O6 M.W.: 610.66 |
| |
QC192003 | Candesartan Cilexetil EP Impurity C CAS# 1185255-99-5 M.F.: C33H34N6O6 M.W.: 610.66 |
| |
QC192002 | Candesartan Cilexetil EP Impurity B CAS# 869631-11-8 M.F.: C31H30N6O6 M.W.: 582.61 |
| |
QC192001 | Candesartan Cilexetil EP Impurity A CAS# 139481-58-6 M.F.: C26H24N6O3 M.W.: 468.51 |
| |
QC192000 | Candesartan Cilexetil CAS# 145040-37-5 M.F.: C33H34N6O6 M.W.: 610.66 |
| |
QC191602 | Cyclosporin B CAS# 63775-95-1 M.F.: C61H109N11O12 M.W.: 1188.58 |
| |
QC191200 | Cefsulodin Sodium CAS# 52152-93-9 M.F.: C22H19N4NaO8S2 M.W.: 554.53 |
| |
QC162000 | Camptothecin;Irinotecan EP Impurity D CAS# 7689-03-4 M.F.: C20H16N2O4 M.W.: 348.35 |
| |
QC161810 | Captopril Ethyl Ester CAS# NA M.F.: C11H19NO3S M.W.: 245.34 |
| |
QC161809 | Captopril EP Impurity J CAS# 64838-55-7 M.F.: C11H17NO4S M.W.: 259.32 |
| |
QC161808 | Captopril EP Impurity G CAS# 33325-40-5 M.F.: C6H10O3S M.W.: 162.21 |
| |
QC161807 | Captopril EP Impurity F CAS# 63250-36-2 M.F.: C9H15NO3S M.W.: 217.29 |
| |
QC161806 | Captopril EP Impurity E CAS# 23500-15-4 M.F.: C9H15NO3 M.W.: 185.22 |
| |
QC161805 | Captopril EP Impurity D CAS# 56970-78-6 M.F.: C4H7BrO2 M.W.: 167.00 |
| |
QC161804 | Captopril Acid Amine Salt CAS# NA M.F.: C18H23NO2S M.W.: 317.45 |
| |
QC161803 | Captopril EP Impurity C CAS# 26473-47-2 M.F.: C4H8O2S M.W.: 120.17 |
| |
QC161801 | Captopril EP Impurity A CAS# 64806-05-9 M.F.: C18H28N2O6S2 M.W.: 432.55 |
| |
QC161800 | Captopril CAS# 62571-86-2 M.F.: C9H15NO3S M.W.: 217.29 |
| |
QC160700BS | Clopidogrel Bisulfate CAS# 120202-66-6 M.F.: C16H16ClNO2S . H2SO4 M.W.: 321.81 |
| |
QC160604 | Ciprofloxacin EP Impurity D CAS# 133210-96-5(free base); 526204-10-4 M.F.: C17H18ClN3O3.HCl M.W.: 347.80 36.46 |
| |
QC141805 | Cinnarizine EP Impurity E CAS# 216581-01-0 M.F.: C30H30N2 M.W.: 418.57 |
| |
QC141804 | Cinnarizine EP Impurity D CAS# NA M.F.: C35H36N2 M.W.: 484.67 |
| |
QC141803 | Cinnarizine EP Impurity C CAS# 95062-18-3 M.F.: C35H37ClN2 M.W.: 521.13 |
| |
QC141802 | Cinnarizine EP Impurity B CAS# 750512-44-8 M.F.: C26H28N2 M.W.: 368.51 |
| |
QP151426 | 13,14-dihydro-16,16-difluoro Prostaglandin E1;15-hydroxy Lubiprostone CAS# 475992-30-4 M.F.: C20H34F2O5 M.W.: 392.5 |
| |
QC141801 | Cinnarizine EP Impurity A CAS# 841-77-0 M.F.: C17H20N2 M.W.: 252.35 |
| |
QC132002 | Cimetidine EP Impurity E;Cimetidine Sulfoxide CAS# 54237-72-8 M.F.: C10H16N6OS M.W.: 268.34 |
| |
QC130400NA | Cefamandole Sodium CAS# 30034-03-8 M.F.: C18H17N6NaO5S2 M.W.: 484.48 |
| |
QC130400N | Cefamandole Nafate CAS# 42540-40-9 M.F.: C19H17N6NaO6S2 M.W.: 512.49 |
| |
QC120303 | Celecoxib Carboxylic Acid CAS# 170571-01-4 M.F.: C17H12F3N3O4S M.W.: 411.36 |
| |
QC120302 | Celecoxib EP Impurity B CAS# 331943-04-5 M.F.: C17H14F3N3O2S M.W.: 381.37 |
| |
QC061205 | Cefalexin EP Impurity E; Cefadroxil EP Impurity H; Cefradine EP Impurity G CAS# 146794-70-9 M.F.: C13H18N2O4S M.W.: 298.36 |
| |
QC061204 | Cefalexin EP Impurity D; Cefadroxil EP Impurity G; Cefradine EP Impurity F CAS# 34876-35-2 M.F.: C5H6O2S M.W.: 130.16 |
| |
QC061203 | Cefalexin EP Impurity C CAS# 72528-40-6 M.F.: C24H24N4O5S M.W.: 480.54 |
| |
QC061202 | Cefalexin EP Impurity B; Cefadroxil EP Impurity B; Cefradine EP Impurity A; 7-ADCA CAS# 22252-43-3 M.F.: C8H10N2O3S M.W.: 214.24 |
| |
QC061201 | Cefalexin EP Impurity A; Cefaclor EP Impurity A CAS# 875-74-1 M.F.: C8H9NO2 M.W.: 151.16 |
| |
QC061200 | Cefalexin Monohydrate CAS# 23325-78-2;15686-71-2 (anhydrous) M.F.: C16H17N3O4S.H2O M.W.: 347.39 18.02 |
| |
QC060600 | Choline Fenofibrate CAS# 856676-23-8 M.F.: C22H28ClNO5 M.W.: 421.91 |
| |
QC030308 | Cinacalcet N-Oxide CAS# 1229224-94-5 M.F.: C22H22F3NO M.W.: 373.41 |
| |
QC030307 | Cinacalcet Impurity F CAS# 1271930-12-1 (base) M.F.: C22H29ClF3N M.W.: 399.92 |
| |
QC030306 | Cinacalcet Impurity E CAS# 253337-60-9 M.F.: C22H25N M.W.: 303.44 |
| |
QC030305 | Cinacalcet Impurity D CAS# 1271930-15-4(free base) M.F.: C32H31F6N.HCl M.W.: 543.60 36.46 |
| |
QC030304 | Cinacalcet Impurity C CAS# NA M.F.: C22H21ClF3N M.W.: 391.86 |
| |
QC030303 | Cinacalcet Impurity B CAS# NA M.F.: C19H20ClN M.W.: 297.82 |
| |
QC030301 | Cinacalcet S-Isomer CAS# 694495-47-1;1217809-88-5(HCl salt) M.F.: C22H22F3N M.W.: 357.41 |
| |
QB221400 | Brivanib Alaninate CAS# 649735-63-7 M.F.: C22H24FN5O4 M.W.: 441.46 |
| |
QB191803 | Benserazide EP Impurity C CAS# NA M.F.: C10H13N3O5 M.W.: 255.23 |
| |
QB191802 | Benserazide EP Impurity B CAS# 2472968-83-3 M.F.: C17H21N3O8 M.W.: 395.36 |
| |
QB191801 | Benserazide EP Impurity A CAS# 64616-76-8;55819-71-1(HCl salt) M.F.: C3H9N3O2 M.W.: 119.12 |
| |
QB191618 | Bisoprolol Carboxylic Acid Impurity CAS# 72570-70-8 M.F.: C13H19NO4 M.W.: 253.29 |
| |
QB191617 | Bisoprolol Epoxide Impurity CAS# 66722-57-4 M.F.: C15H22O4 M.W.: 266.33 |
| |
QB191616 | Bisoprolol Impurity 16 CAS# 623-05-2 M.F.: C7H8O2 M.W.: 124.14 |
| |
QB191615 | Bisoprolol EP Impurity S CAS# 123-08-0 M.F.: C7H6O2 M.W.: 122.12 |
| |
QB191611 | Bisoprolol Impurity 11 CAS# 177034-57-0 M.F.: C12H18O3 M.W.: 210.27 |
| |
QB191608 | Bisoprolol Impurity 8 CAS# NA M.F.: C15H24O5 M.W.: 284.35 |
| |
QB191601 | Bisoprolol EP Impurity A CAS# 62572-93-4 M.F.: C13H21NO3 M.W.: 239.31 |
| |
QB191410 | Bosentan Sulfoxide CAS# NA M.F.: C27H29N5O5S M.W.: 535.61 |
| |
QB191409 | Bosentan Sulfide CAS# NA M.F.: C27H29N5O4S M.W.: 519.62 |
| |
QB191408 | Bosentan O-Desmethyl Impurity CAS# 253688-61-8 M.F.: C26H27N5O6S M.W.: 537.59 |
| |
QB191407 | Bosentan Hydroxymethyl O-Desmethyl Impurity CAS# 253688-62-9 M.F.: C26H27N5O7S M.W.: 553.59 |
| |
QB191406 | Bosentan Hydroxymethyl Impurity CAS# 253688-60-7 M.F.: C27H29N5O7S M.W.: 567.61 |
| |
QB191405 | Bosentan USP RC E CAS# 6292-59-7 M.F.: C10H15NO2S M.W.: 213.3 |
| |
QB191404 | Bosentan USP RC D CAS# 150728-13-5 M.F.: C15H10Cl2N4O2 M.W.: 349.17 |
| |
QB191403 | Bosentan USP RC C CAS# 1097263-60-9 M.F.: C52H52N10O10S2 M.W.: 1041.16 |
| |
QB191402 | Bosentan USP RC B CAS# 174227-14-6 M.F.: C25H25N5O5S M.W.: 507.56 |
| |
QB191401 | Bosentan USP Related Compound A CAS# 150727-06-3 M.F.: C25H24ClN5O4S M.W.: 526.01 |
| |
QB161814 | Buspirone N-Oxide (Oxalate) CAS# 220747-81-9(free base) M.F.: C21H31N5O3.C2H2O4 M.W.: 401.51 90.03 |
| |
QB161813 | Buspirone 6-Hydroxy Metabolite CAS# 125481-61-0 M.F.: C21H31N5O3 M.W.: 401.5 |
| |
QB161812 | Buspirone 5-Hydroxy Metabolite CAS# 105496-33-1 M.F.: C21H31N5O3 M.W.: 401.5 |
| |
QB161810 | Buspirone EP Impurity J CAS# 2726492-72-2 M.F.: C34H52N6O5 M.W.: 624.81 |
| |
QB161809 | Buspirone EP Impurity I CAS# 2725354-99-2 M.F.: C21H30ClN5O2 M.W.: 419.95 |
| |
QB161808 | Buspirone EP Impurity H CAS# 2708578-34-9 M.F.: C33H50N8O4 M.W.: 622.81 |
| |
QB161807 | Buspirone EP Impurity G CAS# 84746-24-7 M.F.: C12H14N6 M.W.: 242.28 |
| |
QB161806 | Buspirone EP Impurity F CAS# 2512210-24-9 M.F.: C33H51N9O3 M.W.: 621.82 |
| |
QB161805 | Buspirone EP Impurity E CAS# 257877-43-3;257877-46-6 (HCl salt) M.F.: C21H33N5O3 M.W.: 403.52 |
| |
QB161804 | Buspirone EP Impurity D CAS# 2724726-67-2 M.F.: C24H38N8O M.W.: 454.61 |
| |
QB161803 | Buspirone EP Impurity C CAS# 257877-45-5 M.F.: C20H30N8 M.W.: 382.51 |
| |
QB161802 | Buspirone EP Impurity B CAS# 81461-73-6 M.F.: C12H19BrN4 M.W.: 299.21 |
| |
QB161801 | Buspirone EP Impurity A CAS# 20980-22-7;78069-54-2(HCl salt) M.F.: C8H12N4 M.W.: 164.21 |
| |
QB161800 | Buspirone HCl CAS# 33386-08-2;36505-84-7(free base) M.F.: C21H32ClN5O2 M.W.: 421.96 |
| |
QB161616 | Bupropion ThioMorpholine Acid CAS# 1246812-57-6 M.F.: C12H14ClNO3S M.W.: 287.76 |
| |
QB161614 | Bupropion Morpholinol Impurity (HCl Salt) CAS# 106083-71-0 M.F.: C13H19Cl2NO2 M.W.: 292.2 |
| |
QB161613 | Bupropion Morpholinol Impurity CAS# 357399-43-0 M.F.: C13H18ClNO2 M.W.: 255.74 |
| |
QB161611 | Bupropion 3',5'-Dichloro Impurity CAS# 1193779-48-4;1346603-00-6(HCl salt) M.F.: C13H17Cl2NO M.W.: 274.19 |
| |
QB161610 | Bupropion 3',4'-Dichloro Impurity CAS# 1346598-72-8;1193779-34-8(free base) M.F.: C13H17Cl2NO.HCl M.W.: 274.19 36.46 |
| |
QB161609 | Bupropion 2-Bromo Impurity CAS# 34911-51-8 M.F.: C9H8BrClO M.W.: 247.52 |
| |
QB161608 | Bupropion Des-t-Butylamino Impurity CAS# 34841-35-5 M.F.: C9H9ClO M.W.: 168.62 |
| |
QB161607 | Bupropion 2-Chloro Analog CAS# 1049718-57-1 M.F.: C13H19Cl2NO M.W.: 276.2 |
| |
QB161606 | Bupropion USP Related Compound F CAS# 857233-13-7 M.F.: C9H9ClO2 M.W.: 184.62 |
| |
QB161605 | Bupropion USP Related Compound E CAS# 10557-17-2 M.F.: C9H7ClO2 M.W.: 182.6 |
| |
QB161604 | Bupropion USP Related Compound D (HCl Salt) CAS# 63199-74-6 M.F.: C13H20ClNO M.W.: 241.76 |
| |
QB161603 | Bupropion USP Related Compound C CAS# 152943-33-4 M.F.: C9H9ClO2 M.W.: 184.62 |
| |
QB161602 | Bupropion USP Related Compound B (HCl Salt) CAS# 1049718-43-5;1049974-35-7(free base) M.F.: C13H19BrClNO M.W.: 320.65 |
| |
QB161601 | Bupropion USP Related Compound A CAS# 1049718-72-0 M.F.: C13H19Cl2NO M.W.: 276.2 |
| |
QB161600 | Bupropion Hydrochloride CAS# 31677-93-7;34911-55-2(free base) M.F.: C13H18ClNO.HCl M.W.: 239.74 36.46 |
| |
QB031209 | Bicalutamide S-Isomer CAS# 113299-38-0 M.F.: C18H14F4N2O4S M.W.: 430.061 |
| |
QB031202 | Bicalutamide 2-Fluoro Isomer CAS# NA M.F.: C18H14F4N2O4S M.W.: 430.061 |
| |
QA221800 | Alverine Citrate CAS# 5560-59-8 M.F.: C26H35NO7 M.W.: 473.57 |
| |
QA221301 | Avermectin B1a Dihydro Analog CAS# 70288-86-7 M.F.: C48H74O14 M.W.: 875.09 |
| |
QA201401 | Atenolol EP Impurity A CAS# 17194-82-0 M.F.: C8H9NO2 M.W.: 151.16 |
| |
QA181616 | Aripiprazole Chlorobutoxyquinoline Impurity (USP) CAS# 120004-79-7 M.F.: C13H16ClNO2 M.W.: 253.72 |
| |
QA181615 | Aripiprazole Hydroxybutyl Impurity CAS# 870765-38-1 M.F.: C14H21Cl3N2O M.W.: 339.69 |
| |
QA181614 | Aripiprazole Desethylene Impurity CAS# 1216394-63-6 M.F.: C21H25Cl2N3O2 M.W.: 422.35 |
| |
QA181613 | Aripiprazole EP Impurity G CAS# 1797986-18-5 M.F.: C48H56Cl4N6O4 M.W.: 922.81 |
| |
QA181612 | Aripiprazole N,N-Dioxide CAS# 573691-13-1 M.F.: C23H27Cl2N3O4 M.W.: 480.38 |
| |
QA181609 | Aripiprazole Bromo Impurity CAS# 129722-34-5 M.F.: C13H16BrNO2 M.W.: 298.18 |
| |
QA181606 | Aripiprazole USP RC H CAS# 1796928-63-6 M.F.: C27H35Cl2N3O3 M.W.: 520.49 |
| |
QA181605 | Aripiprazole EP Impurity E CAS# 129722-25-4 M.F.: C23H25Cl2N3O2 M.W.: 446.37 |
| |
QA181604 | Aripiprazole EP Impurity F CAS# 573691-09-5 M.F.: C23H27Cl2N3O3 M.W.: 464.38 |
| |
QA181603 | Aripiprazole EP Impurity B HCl CAS# 119532-26-2;41202-77-1(free base) M.F.: C10H12Cl2N2.HCl M.W.: 231.12 36.46 |
| |
QA132401 | Amoxicillin EP Impurity A ; Ampicillin EP Impurity A; Oxacillin sodium monohydrate EP Impurity A CAS# 551-16-6 M.F.: C8H12N2O3S M.W.: 216.26 |
| |
QA121631 | Allopurinol Nitrile Impurity CAS# 16617-46-2 M.F.: C4H4N4 M.W.: 108.1 |
| |
QA121603 | Allopurinol EP Impurity C CAS# 1346604-13-4 M.F.: C6H6N6O M.W.: 178.15 |
| |
QT200301 | Tetrahydrofolic Acid CAS# 135-16-0 M.F.: C19H23N7O6 M.W.: 445.4 |
| |
QA180319 | Adrenic Acid (Solution in ethanol) CAS# 28874-58-0 M.F.: C22H36O2 M.W.: 332.52 |
| |
QA122206 | Alvimopan Impurity F CAS# [NA] M.F.: C24H31NO3 M.W.: 381.51 |
| |
QA122204 | Alvimopan Impurity D CAS# [NA] M.F.: C24H31NO3 M.W.: 381.51 |
| |
QA122201 | Alvimopan Impurity A CAS# [NA] M.F.: C13H19NO M.W.: 205.30 |
| |
QA161816 | Aprepitant Impurity P CAS# 1242175-34-3 M.F.: C23H21F7N4O3 M.W.: 534.43 |
| |
QA161814 | Aprepitant Impurity N CAS# 1242175-40-1 M.F.: C23H21F7N4O3 M.W.: 534.43 |
| |
QA161812 | Aprepitant Impurity L CAS# 172822-28-5 M.F.: C23H21F7N4O3 M.W.: 534.43 |
| |
QA161811 | Aprepitant Impurity K CAS# 1185502-97-9 M.F.: C23H21F7N4O3 M.W.: 534.43 |
| |
QA161809 | Aprepitant Impurity I CAS# [NA] M.F.: C23H21F7N4O3 M.W.: 534.43 |
| |
QA161803 | Aprepitant Impurity C CAS# 1185503-48-3 (free base) M.F.: C20H19ClF7NO2 M.W.: 473.81 |
| |
QE192010 | Escitalopram Impurity 10 CAS# NA M.F.: C20H23FN2O2 M.W.: 342.41 |
| |
QP190313 | Posaconazole Impurity M CAS# 2243785-99-9 M.F.: C37H42F2N8O4 M.W.: 700.78 |
| |
QF022440 | Febuxostat Impurity Z14 CAS# [NA] M.F.: C12H15NO4 M.W.: 237.25 |
| |
QF022429 | Febuxostat Impurity Z3 CAS# [NA] M.F.: C14H14N2O4S M.W.: 306.34 |
| |
QF022427 | Febuxostat Impurity Z1 CAS# [NA] M.F.: C14H15NO5S M.W.: 309.34 |
| |
QF022426 | Febuxostat Impurity Z CAS# [NA] M.F.: C16H19NO5S M.W.: 337.39 |
| |
QF022425 | Febuxostat Impurity Y CAS# 161798-02-3 M.F.: C14H12N2O3S M.W.: 288.32 |
| |
QF022420 | Febuxostat Impurity T CAS# 1657014-33-9 M.F.: C16H16N2O3S M.W.: 316.37 |
| |
QF022417 | Febuxostat Impurity Q CAS# [NA] M.F.: C12H9NO5S M.W.: 279.27 |
| |
QF022416 | Febuxostat Impurity P CAS# [NA] M.F.: C8H8N2OS2 M.W.: 212.29 |
| |
QF022414 | Febuxostat Impurity N CAS# [NA] M.F.: C22H24N2O5S2 M.W.: 460.57 |
| |
QF022413 | Febuxostat Impurity M CAS# 1335202-60-2 M.F.: C15H16N2OS M.W.: 272.37 |
| |
QF022412 | Febuxostat Impurity L CAS# [NA] M.F.: C18H22N2O4S M.W.: 362.44 |
| |
QF022410 | Febuxostat Impurity J CAS# 160844-75-7 M.F.: C18H20N2O3S M.W.: 344.43 |
| |
QF022406 | Febuxostat Impurity F CAS# 144060-97-9 M.F.: C17H21NO3S M.W.: 319.42 |
| |
QF022405 | Febuxostat Impurity E CAS# 1239233-86-3 M.F.: C16H18N2O4S M.W.: 334.39 |
| |
QE261207 | Enzalutamide Impurity G CAS# [NA] M.F.: C12H16N2O3 M.W.: 236.27 |
| |
QE261203 | Enzalutamide Impurity C CAS# [NA] M.F.: C8H6BrFO2 M.W.: 233.03 |
| |
QE261201 | Enzalutamide Impurity A CAS# [NA] M.F.: C7H4BrFO2 M.W.: 219.01 |
| |
QB121410 | Blonanserin Impurity J CAS# [NA] M.F.: C17H19FN2 M.W.: 270.34 |
| |
QB121406 | Blonanserin Impurity F CAS# [NA] M.F.: C7H16N2 M.W.: 128.22 |
| |
QB121405 | Blonanserin Impurity E CAS# [NA] M.F.: C17H17ClFNO M.W.: 305.77 |
| |
QB121402 | Blonanserin Impurity B CAS# 1648791-23-4 M.F.: C29H43N5 M.W.: 461.69 |
| |
QC122209 | Clevidipine Impurity I CAS# 253597-20-5 M.F.: C15H15Cl2NO2 M.W.: 312.19 |
| |
QD160708 | Dapagliflozin Impurity H CAS# NA M.F.: C21H27ClO7 M.W.: 426.89 |
| |
QD160707 | Dapagliflozin Impurity G CAS# NA M.F.: C42H48Cl2O12 M.W.: 815.73 |
| |
QC201206 | Cetilistat Impurity F CAS# [NA] M.F.: C11H11NO3 M.W.: 205.21 |
| |
QC201205 | Cetilistat Impurity E CAS# [NA] M.F.: C8H7NO2 M.W.: 149.15 |
| |
QC201201 | Cetilistat Impurity A CAS# 2835-98-5 M.F.: C7H9NO M.W.: 123.15 |
| |
QT161809 | Topiroxostat Impurity I CAS# 2307-69-9 M.F.: C10H14O3S M.W.: 214.28 |
| |
QT161807 | Topiroxostat Impurity G CAS# 80-40-0 M.F.: C9H12O3S M.W.: 200.25 |
| |
QT161805 | Topiroxostat Impurity E CAS# 4329-78-6 M.F.: C12H9N5 M.W.: 223.23 |
| |
QT161804 | Topiroxostat Impurity D CAS# [NA] M.F.: C12H8N4O M.W.: 224.22 |
| |
QP242008 | Pixantrone maleate Impurity H CAS# [NA] M.F.: C13H5F2NO2 M.W.: 245.18 |
| |
QP242007 | Pixantrone maleate Impurity G CAS# [NA] M.F.: C13H7F2NO3 M.W.: 263.20 |
| |
QP242006 | Pixantrone maleate Impurity F CAS# [NA] M.F.: C15H13N3O3 M.W.: 283.28 |
| |
QP242005 | Pixantrone maleate Impurity E CAS# [NA] M.F.: C15H14N4O2 M.W.: 282.30 |
| |
QP242004 | Pixantrone maleate Impurity D CAS# [NA] M.F.: C15H11N3O3 M.W.: 281.27 |
| |
QP242003 | Pixantrone maleate Impurity C CAS# [NA] M.F.: C33H32N8O4 M.W.: 604.66 |
| |
QP242002 | Pixantrone maleate Impurity B CAS# [NA] M.F.: C17H17N5O2 M.W.: 323.35 |
| |
QP242001 | Pixantrone maleate Impurity A CAS# [NA] M.F.: C15H12FN3O2 M.W.: 285.27 |
| |
QT132603 | Temozolomide EP Impurity B CAS# 113942-30-6 M.F.: C6H5N5O3 M.W.: 195.14 |
| |
QD192004 | Dasatinib Impurity D CAS# 910297-51-7 M.F.: C20H22ClN7OS M.W.: 443.95 |
| |
QD192002 | Dasatinib Impurity B CAS# [NA] M.F.: C22H24ClN7O3S M.W.: 501.99 |
| |
QD192001 | Dasatinib Impurity A CAS# 910297-52-8 M.F.: C22H26ClN7O3S M.W.: 504.00 |
| |
QU121605 | Ulipristal acetate Impurity E CAS# [NA] M.F.: C30H37NO4 M.W.: 475.62 |
| |
QU121604 | Ulipristal acetate Impurity D CAS# [NA] M.F.: C28H33NO4 M.W.: 447.57 |
| |
QU121603 | Ulipristal acetate Impurity C CAS# [NA] M.F.: C30H37NO4 M.W.: 475.62 |
| |
QU121602 | Ulipristal acetate Impurity B CAS# NA M.F.: C29H35NO4 M.W.: 461.59 |
| |
QU121601 | Ulipristal acetate Impurity A CAS# NA M.F.: C23H31O5 M.W.: 387.49 |
| |
QA260304 | Azacitidine Impurity D CAS# 645-92-1 M.F.: C3H5N5O M.W.: 127.10 |
| |
QT161803 | Topiroxostat Impurity C CAS# [NA] M.F.: C13H9N5O2 M.W.: 267.24 |
| |
QT161802 | Topiroxostat Impurity B CAS# 1992028-94-0 M.F.: C13H10N6O M.W.: 266.26 |
| |
QT161801 | Topiroxostat Impurity A CAS# [NA] M.F.: C13H8N6O M.W.: 264.24 |
| |
QF140606 | Fenofibric acid Impurity F; Fenofibrate EP Impurity F CAS# 154356-96-4 M.F.: C16H15ClO2 M.W.: 274.74 |
| |
QF140605 | Fenofibric acid Impurity E; Fenofibrate EP Impurity C CAS# 217636-47-0 M.F.: C17H15ClO3 M.W.: 302.75 |
| |
QF140604 | Fenofibric acid Impurity D CAS# 1797121-54-0 M.F.: C21H21ClO6 M.W.: 404.84 |
| |
QF140603 | Fenofibric acid Impurity C; Fenofibrate EP Impurity E CAS# 42019-08-9 M.F.: C19H19ClO4 M.W.: 346.80 |
| |
QF140602 | Fenofibric acid;Fenofibrate EP Impurity B CAS# 42017-89-0;258834-37-6(Na salt) M.F.: C17H15ClO4 M.W.: 318.75 |
| |
QF140601 | Fenofibric acid Impurity A; Fenofibrate EP Impurity D CAS# 42019-07-8 M.F.: C18H17ClO4 M.W.: 332.78 |
| |
QT060315 | Tofacitinib Impurity O CAS# 1092578-46-5;2174011-53-9(Citrate) M.F.: C16H20N6O M.W.: 312.37 |
| |
QT060309 | Tofacitinib Impurity I CAS# [NA] M.F.: C13H19N5 M.W.: 245.32 |
| |
QT060305 | Tofacitinib Impurity E CAS# [NA] M.F.: C27H31N5O2S M.W.: 489.63 |
| |
QT060302 | Tofacitinib Impurity B CAS# [NA] M.F.: C27H31N5O2S M.W.: 489.63 |
| |
QB182605 | Brinzolamide Impurity E CAS# [NA] M.F.: C13H20N2O7S3 M.W.: 412.50 |
| |
QB182604 | Brinzolamide Impurity D CAS# [NA] M.F.: C10H16N2O6S3 M.W.: 356.44 |
| |
QB182603 | Brinzolamide Impurity C CAS# 171273-35-1 M.F.: C10H14N2O5S3 M.W.: 338.42 |
| |
QB182602 | Brinzolamide Impurity B CAS# [NA] M.F.: C11H19N3O5S3 M.W.: 369.48 |
| |
QB182601 | Brinzolamide Impurity A CAS# 154127-19-2 M.F.: C12H21N3O5S3 M.W.: 383.51 |
| |
QA261909 | Azilsartan Impurity I CAS# 2171316-29-1 M.F.: C23H19N3O4 M.W.: 401.41 |
| |
QA261908 | Azilsartan Impurity H CAS# 1499167-72-4 M.F.: C23H20N4O4 M.W.: 416.43 |
| |
QA261907 | Azilsartan Impurity G CAS# 147404-76-0 M.F.: C25H23N3O4 M.W.: 429.47 |
| |
QA261905 | Azilsartan Impurity E CAS# 2244031-86-3 M.F.: C22H17N3O4 M.W.: 387.39 |
| |
QA261903 | Azilsartan Impurity C CAS# NA M.F.: C22H18N4O4 M.W.: 402.40 |
| |
QA261901 | Azilsartan Impurity A CAS# 1696392-11-6 M.F.: C24H21N3O4 M.W.: 415.44 |
| |
QL140706 | Linagliptin Impurity 6 CAS# [NA] M.F.: C25H23F3N8O3 M.W.: 540.50 |
| |
QL140705 | Linagliptin Impurity 5 CAS# [NA] M.F.: C24H24N8O3 M.W.: 472.50 |
| |
QL140704 | Linagliptin Impurity 4 CAS# [NA] M.F.: C18H14N6O3 M.W.: 362.34 |
| |
QL140703 | Linagliptin Impurity 3 CAS# NA M.F.: C15H20N4 M.W.: 256.35 |
| |
QL140702 | Linagliptin Impurity 2 CAS# [NA] M.F.: C28H32N8O4 M.W.: 544.60 |
| |
QP181910 | Prasugrel Impurity J CAS# 1359829-52-9 M.F.: C11H10BrFO M.W.: 257.10 |
| |
QP181909 | Prasugrel Impurity I CAS# 1359829-72-3 M.F.: C11H10BrFO M.W.: 257.10 |
| |
QP181908 | Prasugrel Impurity H CAS# 34650-68-5 M.F.: C11H11BrO M.W.: 239.11 |
| |
QP181907 | Prasugrel Hydrochloride EP Impurity G CAS# 1391054-37-7 M.F.: C11H9FO2 M.W.: 192.19 |
| |
QP181906 | Prasugrel Impurity F CAS# [NA] M.F.: C20H21BrFNO3S M.W.: 454.35 |
| |
QP181904 | Prasugrel Hydrochloride EP Impurity C CAS# 1391194-50-5 M.F.: C20H20FNO3S M.W.: 373.44 |
| |
QP181903 | Prasugrel Hydrochloride EP Impurity B CAS# 1391194-39-0 M.F.: C20H20FNO3S M.W.: 373.44 |
| |
QP181902 | Prasugrel Hydrochloride EP Impurity A CAS# 1391194-45-8;1391053-53-4(HCl salt) M.F.: C20H21NO3S M.W.: 355.45 |
| |
QL142207 | Lenvatinib Impurity G CAS# 417714-14-8 M.F.: C21H20N4O4 M.W.: 392.41 |
| |
QL142204 | Lenvatinib Impurity D CAS# 417717-04-5 M.F.: C20H17ClN4O4 M.W.: 412.83 |
| |
QL142202 | Lenvatinib Impurity B CAS# 417721-36-9 M.F.: C11H9ClN2O2 M.W.: 236.65 |
| |
QL142201 | Lenvatinib Impurity A CAS# 796848-79-8 M.F.: C10H11ClN2O2 M.W.: 226.66 |
| |
QD162404 | Dapoxetine Impurity D CAS# 2242008-38-2 (HCl salt) M.F.: C30H31NO2 M.W.: 437.57 |
| |
QD162402 | Dapoxetine Impurity B CAS# 119357-18-5(free base) M.F.: C20H21NO.HCl M.W.: 291.39 36.46 |
| |
QC122206 | Clevidipine Impurity F CAS# 175688-79-6 M.F.: C21H19Cl2N3O4 M.W.: 448.30 |
| |
QA120707 | Alogliptin Impurity G CAS# NA M.F.: C18H21N5O2 M.W.: 339.39 |
| |
QA120706 | Alogliptin Impurity F CAS# 2749281-73-8 M.F.: C25H25N5O3 M.W.: 443.50 |
| |
QA120705 | Alogliptin Impurity E CAS# [NA] M.F.: C23H25N7O4 M.W.: 463.49 |
| |
QE262006 | Ezetimibe Impurity F CAS# 1478664-02-6 M.F.: C24H21F2NO3 M.W.: 409.43 |
| |
QE262005 | Ezetimibe Impurity E CAS# 1593543-00-0 M.F.: C24H21F2NO3 M.W.: 409.43 |
| |
QE262004 | Ezetimibe Impurity D CAS# 1478664-18-4 M.F.: C24H21F2NO3 M.W.: 409.43 |
| |
QE262003 | Ezetimibe Impurity C CAS# 1376614-99-1 M.F.: C24H21F2NO3 M.W.: 409.43 |
| |
QT140601 | Tenofovir disoproxil Impurity A CAS# 851456-00-3 M.F.: C15H25N6O5P M.W.: 400.37 |
| |
QR182403 | Brexpiprazole Impurity C CAS# 2059954-32-2 M.F.: C17H21Cl2NO2 M.W.: 342.26 |
| |
QR182402 | Brexpiprazole Impurity B CAS# 2116542-19-7 M.F.: C22H20N2O4 M.W.: 376.41 |
| |
QR182421 | Brexpiprazole Impurity U CAS# 2094559-58-5 M.F.: C38H40N4O4S M.W.: 648.81 |
| |
QR182420 | Brexpiprazole Impurity T CAS# 1420987-86-5 M.F.: C20H18N2S2 M.W.: 350.50 |
| |
QR182419 | Brexpiprazole Impurity S CAS# [NA] M.F.: C25H29N3O2S M.W.: 435.58 |
| |
QR182418 | Brexpiprazole Impurity R CAS# 102-92-1 M.F.: C9H7ClO M.W.: 166.60 |
| |
QR182417 | Brexpiprazole Impurity Q CAS# [NA] M.F.: C9H5BrO2S M.W.: 257.10 |
| |
QR182415 | Brexpiprazole Impurity O CAS# [NA] M.F.: C33H33N3O2S2 M.W.: 567.76 |
| |
QR182414 | Brexpiprazole Impurity N CAS# 1420987-85-4 M.F.: C20H20N2S2 M.W.: 352.52 |
| |
QR182412 | Brexpiprazole Impurity L CAS# [NA] M.F.: C26H28N2O5 M.W.: 448.51 |
| |
QR182411 | Brexpiprazole Impurity K CAS# 146121-18-8 M.F.: C12H12ClNO2 M.W.: 237.68 |
| |
QR182409 | Brexpiprazole Impurity I CAS# 1886188-97-1 M.F.: C13H15NO3 M.W.: 233.26 |
| |
QR182408 | Brexpiprazole Impurity H CAS# 913614-15-0 M.F.: C16H22N2OS M.W.: 290.42 |
| |
QI132008 | Imatinib EP Impurity B CAS# 581076-65-5 M.F.: C21H28N6O M.W.: 380.49 |
| |
QI132006 | Imatinib EP Impurity C CAS# 404844-02-6 M.F.: C28H29N7O M.W.: 479.58 |
| |
QI132004 | Imatinib EP Impurity J CAS# 571186-91-9 M.F.: C29H31N7O2 M.W.: 509.60 |
| |
QI132003 | Imatinib Impurity 3 CAS# 938082-57-6 M.F.: C29H31N7O2 M.W.: 509.60 |
| |
QI132002 | Imatinib Impurity 2 CAS# 571186-93-1 M.F.: C29H31N7O3 M.W.: 525.60 |
| |
QI132001 | Imatinib Impurity 1 CAS# 571186-92-0 M.F.: C29H31N7O2 M.W.: 509.60 |
| |
QT120828 | Trelagliptin Impurity Z2 CAS# [NA] M.F.: C17H22FN5O M.W.: 331.39 |
| |
QT120827 | Trelagliptin Impurity Z1 CAS# [NA] M.F.: C17H21N5O2 M.W.: 327.38 |
| |
QT120825 | Trelagliptin Impurity Y CAS# [NA] M.F.: C15H14FN3O3 M.W.: 303.29 |
| |
QT120824 | Trelagliptin Impurity X CAS# [NA] M.F.: C14H12FN3O3 M.W.: 289.26 |
| |
QT120822 | Trelagliptin Impurity V CAS# [NA] M.F.: C10H9ClN4O4 M.W.: 284.66 |
| |
QT120821 | Trelagliptin Impurity U CAS# [NA] M.F.: C18H24FN5O2 M.W.: 361.41 |
| |
QT120816 | Trelagliptin Impurity P CAS# [NA] M.F.: C13H9ClFN3O2 M.W.: 293.68 |
| |
QT120815 | Trelagliptin Impurity 15 CAS# [NA] M.F.: C18H20FN5O2 M.W.: 357.38 |
| |
QT120808 | Trelagliptin Impurity H CAS# [NA] M.F.: C23H24FN7O4 M.W.: 481.48 |
| |
QT120807 | Trelagliptin Impurity G CAS# [NA] M.F.: C18H13ClFN5O4 M.W.: 417.78 |
| |
QC182579 | Canagliflozin Impurity I CAS# [NA] M.F.: C32H33FO9S M.W.: 612.66 |
| |
QC182577 | Canagliflozin Impurity G CAS# [NA] M.F.: C10H11FS M.W.: 182.26 |
| |
QC182574 | Canagliflozin Impurity D CAS# [NA] M.F.: C24H26O5S M.W.: 426.53 |
| |
QK201803 | Ketorolac EP Impurity I CAS# 113502-55-9 M.F.: C14H13NO M.W.: 211.26 |
| |
QK201801 | Ketorolac EP Impurity A CAS# 154476-25-2 M.F.: C14H13NO2 M.W.: 227.26 |
| |
QI161804 | Ipriflavone Impurity D CAS# NA M.F.: C17H18O3 M.W.: 270.32 |
| |
QI161803 | Ipriflavone Impurity C CAS# NA M.F.: C17H14O3 M.W.: 266.29 |
| |
QI161802 | Ipriflavone Impurity B CAS# 13057-72-2 M.F.: C15H10O3 M.W.: 238.24 |
| |
QI161801 | Ipriflavone Impurity A CAS# NA M.F.: C14H12O3 M.W.: 228.24 |
| |
QP141205 | Phenylephrine EP Impurity E CAS# 71786-67-9 M.F.: C16H17NO2.HCl M.W.: 255.31 36.46 |
| |
QP141204 | Phenylephrine EP Impurity D CAS# 1367567-95-0(free base) M.F.: C16H19NO2.HCl M.W.: 257.33 36.46 |
| |
QE044320 | Etoricoxib Impurity T CAS# NA M.F.: C25H20ClN3O3S M.W.: 477.96 |
| |
QK161808 | Kyprolis Impurity H CAS# [NA] M.F.: C40H57N5O7 M.W.: 719.91 |
| |
QK161806 | Kyprolis Impurity F CAS# [NA] M.F.: C26H46N4O6 M.W.: 510.67 |
| |
QK161804 | Kyprolis Impurity D CAS# [NA] M.F.: C9H17NO2 M.W.: 171.24 |
| |
QK161803 | Kyprolis Impurity C CAS# [NA] M.F.: C9H17NO2 M.W.: 171.24 |
| |
QK161802 | Kyprolis Impurity B CAS# [NA] M.F.: C9H17NO2 M.W.: 171.24 |
| |
QK161801 | Kyprolis Impurity A CAS# [NA] M.F.: C34H46N4O6 M.W.: 606.75 |
| |
QP020315 | Palbociclib Impurity O CAS# [NA] M.F.: C42H61N9O6 M.W.: 787.99 |
| |
QP020313 | Palbociclib Impurity M CAS# [NA] M.F.: C23H38N6O4 M.W.: 462.59 |
| |
QP020311 | Palbociclib Impurity K CAS# [NA] M.F.: C24H29N7O2 M.W.: 447.53 |
| |
QP020310 | Palbociclib Impurity J CAS# [NA] M.F.: C33H45N7O4 M.W.: 603.75 |
| |
QP020309 | Palbociclib Impurity I CAS# [NA] M.F.: C27H34BrN7O3 M.W.: 584.51 |
| |
QP020304 | Palbociclib Impurity D CAS# [NA] M.F.: C14H20BrN3O2 M.W.: 342.23 |
| |
QP020303 | Palbociclib Impurity C CAS# 153747-97-8 M.F.: C14H20BrN3O2 M.W.: 342.23 |
| |
QP020302 | Palbociclib Impurity B CAS# 1072-97-5 M.F.: C5H5BrN2 M.W.: 173.01 |
| |
QP020301 | Palbociclib Impurity A CAS# 39856-50-3 M.F.: C5H3BrN2O2 M.W.: 202.99 |
| |
QO022005 | Obeticholic Acid Impurity E CAS# 915038-25-4 M.F.: C26H42O4 M.W.: 418.61 |
| |
QO022004 | Obeticholic Acid Impurity D CAS# NA M.F.: C26H42O4 M.W.: 418.61 |
| |
QO022003 | Obeticholic Acid Impurity C CAS# 1908444-28-9 M.F.: C52H86O7 M.W.: 823.24 |
| |
QO022002 | Obeticholic Acid Impurity B CAS# [NA] M.F.: C26H42O4 M.W.: 418.61 |
| |
QO022001 | Obeticholic Acid Impurity A CAS# 865244-30-0 M.F.: C26H44O4 M.W.: 420.63 |
| |
QE200304 | Entecavir Impurity 4 CAS# 188399-46-4 M.F.: C12H15N5O3 M.W.: 277.28 |
| |
QE200302 | Entecavir Impurity 2 CAS# 1367369-76-3 M.F.: C12H15N5O3 M.W.: 277.28 |
| |
QA220305 | Avibactam Impurity E CAS# [NA] M.F.: C7H9N3Na2O9S2 M.W.: 389.27 |
| |
QP180308 | Piperacillin Sodium EP Impurity H; Flucloxacillin sodium EP Impurity C; Cloxacillin Sodium EP Impurity C; Bacampicillin hydrochloride EP Impurity A CAS# 551-16-6 M.F.: C8H12N2O3S M.W.: 216.26 |
| |
QP180307 | Piperacillin Sodium EP Impurity G CAS# 63422-71-9 M.F.: C15H17N3O5 M.W.: 319.32 |
| |
QP180306 | Piperacillin EP Impurity F; Piperacillin Sodium EP Impurity F CAS# [NA] M.F.: C25H31N5O9S M.W.: 577.62 |
| |
QP161805 | Piperacillin EP Impurity E ; Piperacillin Sodium EP Impurity E CAS# 59702-31-7 M.F.: C6H10N2O2 M.W.: 142.16 |
| |
QH240300 | Hexanoic acid;Caprylic acid EP Impurity A CAS# 142-62-1 M.F.: C6H12O2 M.W.: 116.16 |
| |
QH160315 | Heptanoic acid;Caprylic acid EP Impurity B CAS# 111-14-8 M.F.: C7H14O2 M.W.: 130.18 |
| |
QA250919 | Amobarbital sodium CAS# 64-43-7 M.F.: C11H17N2NaO3 M.W.: 248.25 |
| |
QT031480 | D-delta-Tocotrienol CAS# 25612-59-3 M.F.: C27H40O2 M.W.: 396.61 |
| |
QT031470 | D-gamma-Tocotrienol CAS# 14101-61-2 M.F.: C28H42O2 M.W.: 410.63 |
| |
QT031460 | D-beta-Tocotrienol CAS# 490-23-3 M.F.: C28H42O2 M.W.: 410.63 |
| |
QT031450 | D-alpha-Tocotrienol CAS# 58864-81-6 M.F.: C29H44O2 M.W.: 424.67 |
| |
QT031880 | RRR-α-Tocopherol EP Impurity A; RRR-δ-tocopherol CAS# 119-13-1 M.F.: C27H46O2 M.W.: 402.65 |
| |
QT031870 | D-gamma-Tocopherol; RRR-α-Tocopherol EP Impurity C CAS# 54-28-4 M.F.: C28H48O2 M.W.: 416.68 |
| |
QT031860 | D-beta-Tocopherol; RRR-α-Tocopherol EP Impurity B CAS# 16698-35-4 M.F.: C28H48O2 M.W.: 416.68 |
| |
QT201460 | 1-Tetradecanol CAS# 112-72-1 M.F.: C14H30O M.W.: 214.39 |
| |
QM242000 | 22-Oxacalcitriol CAS# 103909-75-7 M.F.: C26H42O4 M.W.: 418.61 |
| |
QC081332 | Calcitriol EP Impurity B CAS# 66791-71-7 M.F.: C27H44O3 M.W.: 416.64 |
| |
QH323420 | 1-Hydroxy Vitamin D2;Doxercalciferol CAS# 54573-75-0 M.F.: C28H44O2 M.W.: 412.65 |
| |
QP151330 | Provitamin D3; Cholecalciferol EP Impurity B CAS# 434-16-2 M.F.: C27H44O M.W.: 384.64 |
| |
QD323370 | 1,24-Dihydroxy Vitamin D3;Tacalcitol CAS# 57333-96-7;93129-94-3(monohydrate) M.F.: C27H44O3 M.W.: 416.63 |
| |
QD768010 | 24,25-Dihydroxy Vitamin D2 CAS# 58050-55-8 M.F.: C28H44O3 M.W.: 428.65 |
| |
QC081330 | 1,25-Dihydroxy Vitamin D3;Calcitriol CAS# 32222-06-3 M.F.: C27H44O3 M.W.: 416.64 |
| |
QC081320 | 1,25-Dihydroxy Vitamin D2 CAS# 60133-18-8 M.F.: C28H44O3 M.W.: 428.65 |
| |
QC041330 | 25-Hydroxy Vitamin D3 CAS# 19356-17-3;63283-36-3(monohydrate) M.F.: C27H44O2 M.W.: 400.64 |
| |
QC041320 | 25-Hydroxy Vitamin D2 CAS# 21343-40-8 M.F.: C28H44O2 M.W.: 412.65 |
| |
QP885200 | 12-oxo Phytodienoic Acid CAS# 85551-10-6 M.F.: C18H28O3 M.W.: 292.41 |
| |
QT041303 | Trifluridine/tipiracil (TAS-102) Impurity C CAS# NA M.F.: C6H7ClN2O3 M.W.: 190.58 |
| |
QT041301 | Trifluridine/tipiracil (TAS-102) Impurity A CAS# NA M.F.: C9H10ClN3O3 M.W.: 243.65 |
| |
QT090301 | Thioctic Acid EP Impurity A CAS# 1204245-29-3 M.F.: C8H14O2S3 M.W.: 238.39 |
| |
QF120365 | Folic Acid-13C11 CAS# 59-30-3 (unlabeled) M.F.: C813C11H19N7O6 M.W.: 452.32 |
| |
QA048218 | Aspartic acid condensate CAS# 60079-22-3 M.F.: C8H12N2O7 M.W.: 248.19 |
| |
|