REQUEST A QUOTE  CART(0)
Products for Quality Control
Products
Home > Products
Serotonin Glucuronide
QCC Cat No.: QS051803
Chemical Name: Serotonin Glucuronide
Synonyms: (2S,3S,4S,5R,6S)-6-((3-(2-aminoethyl)-1H-indol-5-yl)oxy)-3,4,5-trihydroxytetrahydro-2H-pyran-2-carboxylic acid
CAS No.: NA
Molecular Formula: C16H20N2O7
Molecular Weight: 352.34
================================================
Standard Reference Material For "Serotonin Glucuronide"
Warning:The form of the product salt may be different from the official website,please consult your local agent for details.
RELATED PRODUCTS
QCC CAT# COMPOUND ORDER
  • QP092108
    Primaquine Diphosphate Impurity 8
    CAS# 2732404-25-8
    M.F.: C15H21N3O
    M.W.: 259.35
  • QC062158
    Ceftazidime Impurity 58
    CAS# NA
    M.F.: C27H32N6O7S2
    M.W.: 616.71
  • QE1316252
    Empagliflozin Impurity 252
    CAS# NA
    M.F.: C14H9ClFIO
    M.W.: 374.58
  • QN012800
    Nadide phosphate disodium
    CAS# 24292-60-2
    M.F.: C21H26N7Na2O17P3
    M.W.: 787.37
  • QA1641113
    Avanafil Impurity 113
    CAS# 41965-95-1
    M.F.: C8H10ClNO.HCl
    M.W.: 171.62 36.46
  • QC202473
    Cefotaxime Impurity 73
    CAS# NA
    M.F.: C28H30N10O11S4
    M.W.: 810.85
  • QD122073
    Dolutegravir Impurity 73
    CAS# 1335210-23-5
    M.F.: C13H17NO8
    M.W.: 315.28
  • QE203308
    Etonogestrel EP Impurity H
    CAS# NA
    M.F.: C22H26O2
    M.W.: 322.45
  • QE203306
    Etonogestrel EP Impurity E
    CAS# NA
    M.F.: C22H28O2
    M.W.: 324.46
  • QE203302
    Etonogestrel EP Impurity A
    CAS# 215252-94-1
    M.F.: C22H28O3
    M.W.: 340.46
  • QC202471
    Cefotaxime Impurity 71
    CAS# NA
    M.F.: C31H34N10O13S4
    M.W.: 882.91
  • QP052213
    Pentoxyverine hydrogen citrate Impurity 13
    CAS# 1421930-88-2
    M.F.: C14H18O3
    M.W.: 234.30
  • QB011575
    Baloxavir marboxil Impurity 75
    CAS# 2609708-21-4
    M.F.: C15H12F2O2S
    M.W.: 294.32
  • QB011574
    Baloxavir marboxil Impurity 74
    CAS# 1152672-18-8
    M.F.: C14H10F2O2S
    M.W.: 280.29
  • QD011304
    Daridorexant Impurity 4
    CAS# 103336-06-7
    M.F.: C11H19NO4
    M.W.: 229.28
  • QD011302
    Daridorexant Impurity 2
    CAS# NA
    M.F.: C18H26ClN3O3
    M.W.: 367.87
  • QA1312105
    Amlodipine Nitroso Impurity 3
    CAS# NA
    M.F.: C24H28ClN3O10
    M.W.: 553.95
  • QR457072
    Rocuronium bromide Impurity 72
    CAS# NA
    M.F.: C23H37NO2
    M.W.: 359.55
  • QR457071
    Rocuronium bromide Impurity 71
    CAS# NA
    M.F.: C19H28O3
    M.W.: 304.43
  • QA040148
    Adapalene Impurity 48
    CAS# 5773-80-8
    M.F.: C11H7BrO2
    M.W.: 251.08
  • QV051418
    Venetoclax Impurity 18
    CAS# 2573767-94-7
    M.F.: C71H73ClN12O14S2
    M.W.: 1418.01
  • QC061918
    Ceftaroline Fosamil Impurity 18
    CAS# NA
    M.F.: C21H19N8O8PS4
    M.W.: 670.64
  • QT011516
    Tauroursodeoxycholic Acid Impurity 16
    CAS# NA
    M.F.: C29H51NO6S
    M.W.: 541.79
  • QT011515
    Tauroursodeoxycholic Acid Impurity 15
    CAS# NA
    M.F.: C28H49NO6S
    M.W.: 527.76
  • QT011514
    Tauroursodeoxycholic Acid Impurity 14
    CAS# NA
    M.F.: C27H47NO6S
    M.W.: 513.73
  • QU190467
    Ursodeoxycholic Acid Impurity 67
    CAS# 2205011-81-8
    M.F.: C27H46O4
    M.W.: 434.66
  • QU190466
    Ursodeoxycholic Acid Ethyl Ester
    CAS# 69519-36-4
    M.F.: C26H44O4
    M.W.: 420.63
  • QF061352
    Fosfomycin Trometamol Impurity 52
    CAS# 40924-65-0
    M.F.: C9H9O3P
    M.W.: 196.14
  • QF061351
    Fosfomycin Trometamol Impurity 51
    CAS# 5954-65-4
    M.F.: C7H15O3P
    M.W.: 178.17
  • QF061350
    Fosfomycin Trometamol Impurity 50
    CAS# 856998-40-8
    M.F.: C3H5O3P
    M.W.: 120.04
  • QF061349
    Fosfomycin Trometamol Impurity 49
    CAS# 17166-36-8
    M.F.: C3H3Cl2OP
    M.W.: 156.93
  • QF061348
    Fosfomycin Trometamol Impurity 48
    CAS# NA
    M.F.: C3H3Cl2OP
    M.W.: 156.93
  • QP1320105
    Pemetrexed Impurity 105
    CAS# 1320346-37-9
    M.F.: C12H12Br2O3
    M.W.: 364.03
  • QF121213
    Flucloxacillin sodium Impurity 13
    CAS# NA
    M.F.: C21H21ClFN3O7S
    M.W.: 513.92
  • QU190465
    Ursodeoxycholic Acid Impurity 65
    CAS# 16265-24-0
    M.F.: C24H38O5
    M.W.: 406.56
  • QB053111
    Benvitimod Impurity 11
    CAS# 443982-76-1
    M.F.: C16H27O5P
    M.W.: 330.36
  • QV092300
    Vitamin U
    CAS# 1115-84-0
    M.F.: C6H14ClNO2S
    M.W.: 199.69
  • QA161267
    Apalutamide Impurity 67
    CAS# NA
    M.F.: C27H14F7N7O2S
    M.W.: 633.50
  • QF151407
    Fondaparinux Sodium Impurity 7
    CAS# NA
    M.F.: C30H41N2Na9O46S7
    M.W.: 1596.95
  • QN202123
    Netupitant Impurity 23
    CAS# 289686-70-0
    M.F.: C12H10F6O2
    M.W.: 300.20
  • QR2102167
    Rivaroxaban Nitroso Impurity 11
    CAS# NA
    M.F.: C21H20N4O6
    M.W.: 424.41
  • QC132683
    Cefmetazole sodium Impurity 83
    CAS# NA
    M.F.: C28H31N13O10S6
    M.W.: 902.00
  • QC132682
    Cefmetazole sodium Impurity 82
    CAS# NA
    M.F.: C30H34N14O10S6
    M.W.: 943.05
  • QR091161
    Rimegepant Impurity 61
    CAS# NA
    M.F.: C28H29FN6O3
    M.W.: 516.58
  • QR091155
    Rimegepant Impurity 55
    CAS# NA
    M.F.: C16H15F2NO2
    M.W.: 291.30
  • QR091151
    Rimegepant Impurity 51
    CAS# 1190363-47-3
    M.F.: C25H35F2NO2Si
    M.W.: 447.64
  • QR091150
    Rimegepant Impurity 50
    CAS# NA
    M.F.: C25H33F2NO2Si
    M.W.: 445.63
  • QR091143
    Rimegepant Impurity 43
    CAS# NA
    M.F.: C28H53NO2Si2
    M.W.: 491.91
  • QC192057
    Candesartan Cilexetil Nitroso Impurity 1
    CAS# NA
    M.F.: C33H33N7O7
    M.W.: 639.67
  • QN051524
    Neostigmine bromide Impurity 24
    CAS# 463-72-9
    M.F.: CH2ClNO
    M.W.: 79.48
  • QN151889
    Noradrenaline (Norepinephrine) Impurity 89
    CAS# NA
    M.F.: C8H11NO5
    M.W.: 201.18
  • QM131937
    Mometasone Furoate Impurity 37
    CAS# NA
    M.F.: C32H33ClO9
    M.W.: 597.06
  • QM131936
    Mometasone Furoate Impurity 36
    CAS# NA
    M.F.: C27H30Cl2O6
    M.W.: 521.43
  • QM131935
    Mometasone Furoate Impurity 35
    CAS# NA
    M.F.: C27H28Cl2O5
    M.W.: 503.42
  • QC017300
    Calcitonin (porcine)
    CAS# 12321-44-7
    M.F.: C159H232N46O45S3
    M.W.: 3604.06
  • QU190464
    Ursodeoxycholic Acid Impurity 64
    CAS# 63266-92-2
    M.F.: C24H38O4
    M.W.: 390.56
  • QB011573
    Baloxavir marboxil Impurity 73
    CAS# NA
    M.F.: C25H21F2N3O5S
    M.W.: 513.52
  • QI193803
    Isepamicin Sulfate Impurity 3
    CAS# 66674-29-1
    M.F.: C22H43N5O12
    M.W.: 569.61
  • QI193802
    Isepamicin Sulfate Impurity 2
    CAS# NA
    M.F.: C22H43N5O12
    M.W.: 569.61
  • QI193801
    Isepamicin Sulfate Impurity 1
    CAS# NA
    M.F.: C15H30N4O9
    M.W.: 410.42
  • QZ121636
    Zolpidem tartrate Impurity 36
    CAS# NA
    M.F.: C19H21N3O
    M.W.: 307.40
  • QZ121635
    Zolpidem tartrate Impurity 35
    CAS# 82626-71-9
    M.F.: C19H21N3O
    M.W.: 307.40
  • QI193800
    Isepamicin Sulfate
    CAS# 67814-76-0
    M.F.: C22H43N5O12.xH2O4S
    M.W.: 569.61 98.07x
  • QG0402100
    Gadobutrol Impurity 100
    CAS# 170983-22-9
    M.F.: C9H18N4O
    M.W.: 198.27
  • QA132466
    Amoxicillin Impurity 66
    CAS# NA
    M.F.: C28H28N4O8S
    M.W.: 580.61
  • QG011405
    Ganoderic Acid Y
    CAS# 86377-52-8
    M.F.: C30H46O3
    M.W.: 454.70
  • QL1412182
    Lenalidomide Impurity 182
    CAS# 7607-72-9
    M.F.: C13H12N2O5
    M.W.: 276.25
  • QV051131
    Vericiguat Impurity 31
    CAS# NA
    M.F.: C19H16F2N8O3
    M.W.: 442.39
  • QC042047
    Cefditoren pivoxil Impurity 47
    CAS# NA
    M.F.: C25H30N6O8S3
    M.W.: 638.73
  • QV3077140
    Vitamin K1 Impurity 140
    CAS# NA
    M.F.: C22H16O2
    M.W.: 312.37
  • QC042046
    Cefditoren pivoxil Impurity 46
    CAS# NA
    M.F.: C25H30N6O8S3
    M.W.: 638.73
  • QB011572
    Baloxavir marboxil Impurity 72
    CAS# 1332855-89-6
    M.F.: C14H12O5
    M.W.: 260.25
  • QB011571
    Baloxavir marboxil Impurity 71
    CAS# 119736-16-2
    M.F.: C13H10O5
    M.W.: 246.22
  • QG211209
    Sodium Gualenate Impurity 9
    CAS# 215229-23-5
    M.F.: C5H8N2O2
    M.W.: 128.13
  • QC651226
    Cloxacillin Sodium Impurity 26
    CAS# NA
    M.F.: C31H29Cl2N5O7S
    M.W.: 686.56
  • QC651225
    Cloxacillin Sodium Impurity 25
    CAS# NA
    M.F.: C32H29Cl2N5O9S
    M.W.: 730.57
  • QM141421
    Menatetrenone Impurity 21
    CAS# 13798-18-0
    M.F.: C31H42O2
    M.W.: 446.68
  • QC651224
    Cloxacillin Sodium Impurity 24
    CAS# NA
    M.F.: C21H24ClN3O6S
    M.W.: 481.95
  • QC651223
    Cloxacillin Sodium Impurity 23
    CAS# NA
    M.F.: C20H22ClN3O6S
    M.W.: 467.92
  • QC651222
    Cloxacillin Sodium Impurity 22
    CAS# NA
    M.F.: C19H18ClN3O6S
    M.W.: 451.88
  • QR050747
    Regadenoson Impurity 47
    CAS# 72635-67-7
    M.F.: C10H12ClN5O4
    M.W.: 301.69
  • QM031643
    Mycophenolate Mofetil Impurity 43
    CAS# 948857-01-1
    M.F.: C21H28O8
    M.W.: 408.45
  • QA202911
    Ataluren Impurity 11
    CAS# 2786607-23-4
    M.F.: C16H12N2O3
    M.W.: 280.28
  • QA030334
    Acetylcysteine Impurity 34
    CAS# 1232154-60-7
    M.F.: C9H16N4O3
    M.W.: 228.25
  • QC651221
    Cloxacillin Sodium Impurity 21
    CAS# NA
    M.F.: C21H22ClN3O7S
    M.W.: 495.93
  • QC651220
    Cloxacillin Sodium Impurity 20
    CAS# NA
    M.F.: C27H30ClN5O8S2
    M.W.: 652.13
  • QG121836
    Glycyrrhizic Acid Impurity 36
    CAS# NA
    M.F.: C42H62O16
    M.W.: 822.94
  • QS161821
    Sulpiride Impurity 21
    CAS# NA
    M.F.: C7H14N2
    M.W.: 126.20
  • QD0207112
    N-Nitroso Dabigatran Etexilate-13C6
    CAS# NA
    M.F.: C2813C6H40N8O6
    M.W.: 662.70
  • QD1607182
    Dapagliflozin Impurity 182
    CAS# NA
    M.F.: C42H48Cl2O12
    M.W.: 815.73
  • QZ210101
    Zuclomiphene-d4 Citrate
    CAS# 2714316-71-7
    M.F.: C26H24D4ClNO.C6H8O7
    M.W.: 409.99 192.12
  • QP122437
    Plerixafor Impurity 37
    CAS# 123530-19-8
    M.F.: C24H36N4O4S2
    M.W.: 508.70
  • QC017200
    Calteridol Calcium
    CAS# 121915-83-1
    M.F.: 2(C17H29N4O7).3Ca
    M.W.: 2*401.44 3*40.08
  • QG011512
    Gadoteridol Impurity 12
    CAS# 229312-33-8
    M.F.: C13H22N4O5
    M.W.: 314.34
  • QL091689
    Lipoic Acid Impurity 89
    CAS# NA
    M.F.: C10H17ClO2
    M.W.: 204.69
  • QC221219
    Clavulanate Potassium Impurity 19
    CAS# NA
    M.F.: C15H19NO6
    M.W.: 309.32
  • QC221218
    Clavulanate Potassium Impurity 18
    CAS# NA
    M.F.: C15H19NO6
    M.W.: 309.32
  • QM092222
    Mivacurium chloride Impurity 22
    CAS# 104758-47-6
    M.F.: C22H29NO5
    M.W.: 387.48
  • QM092221
    Mivacurium chloride Impurity 21
    CAS# 2205840-54-4
    M.F.: C21H27NO5
    M.W.: 373.45
  • QM092220
    Mivacurium chloride Impurity 20
    CAS# 188956-91-4
    M.F.: C21H27NO5
    M.W.: 373.45
  • QO132094
    Olmesartan Medoxomil Impurity 94
    CAS# 1227626-51-8
    M.F.: C48H42N6O5
    M.W.: 782.90
  • QG122732
    Glycopyrronium Bromide Impurity 32
    CAS# NA
    M.F.: C18H23NO2
    M.W.: 285.39
  • QF122928
    Fluocinolone acetonide Impurity 28
    CAS# 1744-65-6
    M.F.: C22H28F2O4
    M.W.: 394.46
  • QC061917
    Ceftaroline Fosamil Impurity 17
    CAS# 1286218-63-0
    M.F.: C22H23N8O9PS4
    M.W.: 702.69
  • QZ121634
    Zolpidem tartrate Impurity 34
    CAS# NA
    M.F.: C21H20N4
    M.W.: 328.42
  • QB180811
    Dexbrompheniramine maleate
    CAS# 2391-03-9
    M.F.: C16H19BrN2.C4H4O4
    M.W.: C4H4O4 116.07
  • QP093700
    Piromidic acid
    CAS# 19562-30-2
    M.F.: C14H16N4O3
    M.W.: 288.31
  • QC127201
    Clidinium Bromide-d5
    CAS# NA
    M.F.: C22H21D5BrNO3
    M.W.: 437.39
  • QC127200
    Clidinium Bromide
    CAS# 3485-62-9
    M.F.: C22H26BrNO3
    M.W.: 432.36
  • QC251711
    Cyproterone acetate Impurity 11
    CAS# 2098-65-9
    M.F.: C22H28O3
    M.W.: 340.46
  • QM052310
    Methylphenidate hydrochloride Nitroso Impurity 1
    CAS# NA
    M.F.: C14H18N2O3
    M.W.: 262.31
  • QG011101
    Gallic Acid Impurity 1
    CAS# 1782069-25-3
    M.F.: C19H26O15
    M.W.: 494.40
  • QT260441
    Trazodone hydrochloride Impurity 41
    CAS# 80714-38-1
    M.F.: C6H8N4O
    M.W.: 152.16
  • QT260440
    Trazodone hydrochloride Impurity 40
    CAS# 19666-40-1
    M.F.: C9H10ClN3O
    M.W.: 211.65
  • QC202672
    Ceftizoxime Impurity 72
    CAS# NA
    M.F.: C12H15N5O5S2
    M.W.: 373.40
  • QD251400
    Dynorphin A 1-10
    CAS# 79994-24-4
    M.F.: C57H91N19O12
    M.W.: 1234.48
  • QG122731
    Glycopyrronium Bromide Impurity 31
    CAS# 64471-45-0
    M.F.: C13H16O3
    M.W.: 220.27
  • QP081311
    Phentolamine Mesylate Impurity 11
    CAS# 57182-48-6
    M.F.: C13H11NO2
    M.W.: 213.24
  • QP081310
    Phentolamine Mesylate Nitroso Impurity 1
    CAS# NA
    M.F.: C17H18N4O2
    M.W.: 310.36
  • QS013311
    Salcaprozate Sodium Impurity 11
    CAS# NA
    M.F.: C19H25NO5
    M.W.: 347.41
  • QS013310
    Salcaprozate Sodium Impurity 10
    CAS# NA
    M.F.: C27H43NO6
    M.W.: 477.64
  • QG122550
    Glycopyrrolate Bromide Nitroso Impurity 1
    CAS# NA
    M.F.: C17H22N2O4
    M.W.: 318.37
  • QO132093
    Olmesartan Medoxomil Impurity 93
    CAS# NA
    M.F.: C29H30N6O7
    M.W.: 574.59
  • QD152144
    Dotinurad Impurity 44
    CAS# NA
    M.F.: C14H8Cl2O4
    M.W.: 311.11
  • QS013309
    Salcaprozate Sodium Impurity 9
    CAS# NA
    M.F.: C16H23NO4
    M.W.: 293.36
  • QB050335
    Beclometasone Dipropionate Impurity 35
    CAS# NA
    M.F.: C25H32O5
    M.W.: 412.53
  • QB050334
    Beclometasone Dipropionate Impurity 34
    CAS# NA
    M.F.: C25H33ClO6
    M.W.: 464.98
  • QB050333
    Beclometasone Dipropionate Impurity 33
    CAS# NA
    M.F.: C25H33ClO6
    M.W.: 464.98
  • QB050332
    Beclometasone Dipropionate Impurity 32
    CAS# NA
    M.F.: C25H32O5
    M.W.: 412.53
  • QB050331
    Beclometasone Dipropionate Impurity 31
    CAS# NA
    M.F.: C22H28Cl2O4
    M.W.: 427.36
  • QB050329
    Beclometasone Dipropionate Impurity 29
    CAS# NA
    M.F.: C26H31NO6
    M.W.: 453.54
  • QB050328
    Beclometasone Dipropionate Impurity 28
    CAS# NA
    M.F.: C22H28O4
    M.W.: 356.46
  • QB050327
    Beclometasone Dipropionate Impurity 27
    CAS# NA
    M.F.: C22H27ClO4
    M.W.: 390.90
  • QI142533
    Indocyanine Green Impurity 33
    CAS# NA
    M.F.: C15H18N2
    M.W.: 226.32
  • QI142532
    Indocyanine Green Impurity 32
    CAS# NA
    M.F.: C15H18N2
    M.W.: 226.32
  • QO121528
    Olodaterol Impurity 28
    CAS# NA
    M.F.: C31H35N3O9
    M.W.: 593.63
  • QB050326
    Beclometasone Dipropionate Impurity 26
    CAS# NA
    M.F.: C25H31ClO5
    M.W.: 446.97
  • QB050325
    Beclomethasone 21-Acetate
    CAS# 4735-64-2
    M.F.: C24H31ClO6
    M.W.: 450.96
  • QB050324
    Beclometasone Dipropionate Impurity 24
    CAS# NA
    M.F.: C22H29ClO4
    M.W.: 392.92
  • QP081309
    N-Nitroso Phentolamine Mesylate EP Impurity B
    CAS# NA
    M.F.: C4H6ClN3O
    M.W.: 147.56
  • QP081308
    N-Nitroso Phentolamine Mesylate EP Impurity C
    CAS# 497930-24-2
    M.F.: C13H12N2O2
    M.W.: 228.25
  • QD150312
    Docusate sodium Impurity 12
    CAS# NA
    M.F.: C13H23NaO7S
    M.W.: 346.37
  • QD150311
    Docusate sodium Impurity 11
    CAS# NA
    M.F.: C13H23NaO7S
    M.W.: 346.37
  • QD150310
    Docusate sodium Impurity 10
    CAS# 78016-72-5
    M.F.: C15H24O3S
    M.W.: 284.41
  • QO200911
    Otilonium Bromide Impurity 11
    CAS# 5455-95-8
    M.F.: C7H18BrNO
    M.W.: 212.13
  • QI193304
    Isosulfan Blue Impurity 4
    CAS# NA
    M.F.: C17H19NO8S2
    M.W.: 429.46
  • QI193303
    Isosulfan Blue Impurity 3
    CAS# 2828260-22-4
    M.F.: C17H19NO7S2
    M.W.: 413.46
  • QT041290
    Tadalafil Nitroso Impurity 3
    CAS# NA
    M.F.: C22H18ClN3O6
    M.W.: 455.85
  • QE191372
    Esmolol Nitroso Impurity 3
    CAS# NA
    M.F.: C9H21N3O2
    M.W.: 203.29
  • QE191370
    Esmolol Nitroso Impurity 1
    CAS# NA
    M.F.: C26H34N2O9
    M.W.: 518.56
  • QM201431
    DL-Methionine methylsulfonium chloride
    CAS# 3493-12-7
    M.F.: C6H14ClNO2S
    M.W.: 199.69
  • QF061347
    Fosfomycin Trometamol Impurity 47
    CAS# NA
    M.F.: C9H21O12P3
    M.W.: 414.18
  • QF061346
    Fosfomycin Trometamol Impurity 46
    CAS# 50577-86-1
    M.F.: C3H7O4P
    M.W.: 138.06
  • QP181931
    Prasugrel Impurity 31
    CAS# 2407926-20-7
    M.F.: C7H9NO2S
    M.W.: 171.21
  • QT021616
    Tebipenem Pivoxil Impurity 16
    CAS# 1595319-82-6
    M.F.: C16H23N3O5S2
    M.W.: 401.50
  • QI142531
    Indocyanine Green Impurity 31
    CAS# 13959-24-5
    M.F.: C17H16N2
    M.W.: 248.33 36.46
  • QT090707
    Tiaprofenic acid-d3
    CAS# NA
    M.F.: C14H9D3O3S
    M.W.: 263.33
  • QS0602109
    Sofosbuvir Nucleoside Derivative-13C,d3
    CAS# 1256490-42-2
    M.F.: C913CH10D3FN2O5
    M.W.: 264.23
  • QR201434
    Ritonavir Impurity 34
    CAS# 176655-55-3
    M.F.: C32H45N5O3S
    M.W.: 579.80
  • QM200531
    Methylene Blue Impurity 31
    CAS# 43035-11-6
    M.F.: C8H12N2O3S2
    M.W.: 248.32
  • QJ212200
    Juvenile hormone II
    CAS# 34218-61-6
    M.F.: C17H28O3
    M.W.: 280.41
  • QT031899
    Tocopherol Impurity 99
    CAS# 37570-32-4
    M.F.: C31H52O3
    M.W.: 472.75
  • QP122436
    Plerixafor Impurity 36
    CAS# NA
    M.F.: C36H60N8
    M.W.: 604.93
  • QD012805
    Dantrolene Impurity 5
    CAS# NA
    M.F.: C15H14N4O6
    M.W.: 346.30
  • QP051356
    Perampanel Impurity 56
    CAS# NA
    M.F.: C32H22N4O2
    M.W.: 494.55
  • QT011513
    Tauroursodeoxycholic Acid Impurity 13
    CAS# 521-06-2;101212-48-0(Na salt)
    M.F.: C26H45NO4S
    M.W.: 467.71
  • QP180490
    Perindopril Impurity 90
    CAS# 2307823-09-0
    M.F.: C10H17NO4
    M.W.: 215.25
  • QN011837
    Naratriptan Impurity 37
    CAS# 1346746-73-3
    M.F.: C20H32N4O4S2
    M.W.: 456.62
  • QB120500
    Bleomycin Sulfate
    CAS# 9041-93-4
    M.F.: NA
    M.W.: NA
  • QD030493
    Diclofenac Acyl-beta-D-glucuronide Allyl Ester
    CAS# 698358-10-0
    M.F.: C23H23Cl2NO8
    M.W.: 512.34
  • QT093100
    Tienilic acid
    CAS# 40180-04-9
    M.F.: C13H8Cl2O4S
    M.W.: 331.16
  • QB050447
    Bedaquiline Fumarate Nitroso Impurity 1
    CAS# NA
    M.F.: C31H28BrN3O3
    M.W.: 570.49
  • QB152604
    Borofalan (10B) Impurity 4
    CAS# NA
    M.F.: C14H2010BNO6
    M.W.: 308.33
  • QB152603
    Borofalan (10B) Impurity 3
    CAS# NA
    M.F.: C13H2010BNO4
    M.W.: 264.32
  • QB152602
    Borofalan (10B) Impurity 2
    CAS# NA
    M.F.: C11H1610BNO4
    M.W.: 236.26
  • QL153000
    Lomitapide Mesylate
    CAS# 202914-84-9;182431-12-5(free base)
    M.F.: C39H37F6N3O2.xCH4O3S
    M.W.: 693.73 96.10x
  • QE142100
    Enoxaparin Sodium
    CAS# 679809-58-6
    M.F.: NA
    M.W.: NA
  • QF125402
    Fluorescent brightener 71
    CAS# 16090-02-1
    M.F.: C40H38N12Na2O8S2
    M.W.: 924.92
  • QK202022
    Ketotifen Impurity 22
    CAS# NA
    M.F.: C18H15NO6S
    M.W.: 373.38
  • QB050446
    Bedaquiline Fumarate Impurity 46
    CAS# NA
    M.F.: C15H17NO2
    M.W.: 243.31
  • QB050445
    Bedaquiline Fumarate Impurity 45
    CAS# 1594029-81-8
    M.F.: C13H13NO
    M.W.: 199.25
  • QB050444
    Bedaquiline Fumarate Impurity 44
    CAS# NA
    M.F.: C17H14BrNO2
    M.W.: 344.21
  • QB050443
    Bedaquiline Fumarate Impurity 43
    CAS# NA
    M.F.: C17H12BrNO2
    M.W.: 342.19
  • QB050442
    Bedaquiline Fumarate Impurity 42
    CAS# 918518-76-0
    M.F.: C18H17NO2
    M.W.: 279.34
  • QB050441
    Bedaquiline Fumarate Impurity 41
    CAS# NA
    M.F.: C36H39N3O2
    M.W.: 545.73
  • QB050440
    Bedaquiline Fumarate Impurity 40
    CAS# NA
    M.F.: C28H20BrNO2
    M.W.: 482.38
  • QB050439
    Bedaquiline Fumarate Impurity 39
    CAS# NA
    M.F.: C30H27BrN2O2
    M.W.: 527.46
  • QT142438
    Tranexamic Acid Impurity 38
    CAS# 1243389-54-9
    M.F.: C8H10N2O2
    M.W.: 166.18
  • QT142437
    Tranexamic Acid Impurity 37
    CAS# 74020-82-9
    M.F.: C8H8O4
    M.W.: 168.15
  • QV3077139
    Vitamin K1 Impurity 139
    CAS# 2682052-39-5
    M.F.: C36H52O2
    M.W.: 516.81
  • QA152413
    Amphotericin B Impurity 13
    CAS# NA
    M.F.: C49H77NO18
    M.W.: 968.14
  • QA152412
    Amphotericin B Impurity 12
    CAS# 1314099-20-1
    M.F.: C48H73NO18
    M.W.: 952.10
  • QR091141
    Rimegepant Impurity 41
    CAS# 1289023-89-7
    M.F.: C16H13F2NO2
    M.W.: 289.28
  • QT031898
    all-rac-alpha-Tocopherol Impurity 98
    CAS# NA
    M.F.: C29H50O3
    M.W.: 446.72
  • QT142436
    Tranexamic Acid Impurity 36
    CAS# NA
    M.F.: C11H21NO3
    M.W.: 215.29
  • QT142435
    Tranexamic Acid Impurity 35
    CAS# NA
    M.F.: C11H21NO3
    M.W.: 215.29
  • QB011570
    Baloxavir marboxil Impurity 70
    CAS# NA
    M.F.: C22H35N3O4
    M.W.: 405.54
  • QB011569
    Baloxavir marboxil Impurity 69
    CAS# NA
    M.F.: C23H29N3O4
    M.W.: 411.50
  • QB011568
    Baloxavir marboxil Impurity 68
    CAS# 2762066-96-4
    M.F.: C16H21N3O4
    M.W.: 319.36
  • QC132681
    Cefmetazole sodium Impurity 81
    CAS# NA
    M.F.: C16H19N7O5S3
    M.W.: 485.55
  • QC132680
    Cefmetazole sodium Impurity 80
    CAS# NA
    M.F.: C12H16N6O4S2
    M.W.: 372.42
  • QP160208
    Prednisolone Sodium Phosphate Impurity 8
    CAS# NA
    M.F.: C21H27O7P
    M.W.: 422.41
  • QP1903219
    Posaconazole Nitroso Impurity 5
    CAS# NA
    M.F.: C35H39F2N9O5
    M.W.: 703.75
  • QP090345
    Sodium Picosulfate Impurity 45
    CAS# NA
    M.F.: C12H14O13
    M.W.: 366.23
  • QP090344
    Sodium Picosulfate Impurity 44
    CAS# NA
    M.F.: C12H14O13
    M.W.: 366.23
  • QC061882
    Cefuroxime sodium Impurity 82
    CAS# 2922677-22-1
    M.F.: C8H10N2O4S
    M.W.: 230.24
  • QC121720
    Chlorhexidine Impurity 20
    CAS# 62247-48-7
    M.F.: C22H28Cl2N8O2
    M.W.: 507.42
  • QI142529
    Indocyanine Green Impurity 29
    CAS# NA
    M.F.: C86H94N4O12S4
    M.W.: 1503.95
  • QF124900
    Flurogestone Acetate
    CAS# 2529-45-5
    M.F.: C23H31FO5
    M.W.: 406.49
  • QI142528
    Indocyanine Green Impurity 28
    CAS# NA
    M.F.: C24H27NO4S
    M.W.: 425.54
  • QI142527
    Indocyanine Green Impurity 27
    CAS# NA
    M.F.: C24H27NO4S
    M.W.: 425.54
  • QI142526
    Indocyanine Green Impurity 26
    CAS# NA
    M.F.: C30H32N2O3S
    M.W.: C30H32N2O3S
  • QI142525
    Indocyanine Green Impurity 25
    CAS# 1563-87-7
    M.F.: C10H11NO2
    M.W.: 177.20
  • QG125100
    Sodium Glycerophosphate
    CAS# 1555-56-2+819-83-0
    M.F.: C3H7Na2O6P
    M.W.: 216.04
  • QM200530
    Controlled Substance
    (Methylene Blue Impurity 30)

    CAS# 581-64-6
    M.F.: C12H10ClN3S
    M.W.: 263.74
  • QM200529
    Methylene Blue Impurity 29
    CAS# 3773-36-2
    M.F.: C12H8N2OS
    M.W.: 228.27
  • QM200528
    Methylene Blue Impurity 28
    CAS# 34185-23-4
    M.F.: C13H10N2OS
    M.W.: 242.30
  • QM200527
    Methylene Blue Impurity 27
    CAS# NA
    M.F.: C16H20ClN3S
    M.W.: 321.87
  • QM200526
    Methylene Blue Impurity 26
    CAS# NA
    M.F.: C16H19N3O3S2
    M.W.: 365.47
  • QM200525
    Methylene Blue Impurity 25
    CAS# NA
    M.F.: C12H10N2O4S2
    M.W.: 310.34
  • QM200524
    Methylene Blue Impurity 24
    CAS# NA
    M.F.: C12H11N3O3S2
    M.W.: 309.36
  • QM200523
    Methylene Blue Impurity 23
    CAS# NA
    M.F.: C14H15N3O3S2
    M.W.: 337.41
  • QM200522
    Methylene Blue Impurity 22
    CAS# NA
    M.F.: C13H13N3O3S2
    M.W.: 323.39
  • QM200521
    Methylene Blue Impurity 21
    CAS# NA
    M.F.: C15H17N3O3S2
    M.W.: 351.44
  • QM200520
    Methylene Blue Impurity 20
    CAS# NA
    M.F.: C14H15N3O3S2
    M.W.: 337.41
  • QM200519
    Methylene Blue Impurity 19
    CAS# 126656-05-1
    M.F.: C8H12N2O3S2
    M.W.: 248.32
  • QM200518
    Methylene Blue Impurity 18
    CAS# NA
    M.F.: C7H10N2O3S2
    M.W.: 234.29
  • QM200517
    Methylene Blue Impurity 17
    CAS# 659-49-4
    M.F.: C6H6N2O
    M.W.: 122.13
  • QN051161
    Nemonoxacin Impurity 61
    CAS# NA
    M.F.: C24H29N3O8
    M.W.: 487.51
  • QU190463
    Ursodeoxycholic Acid Impurity 63
    CAS# NA
    M.F.: C29H46O7
    M.W.: 506.68
  • QU190462
    Ursodeoxycholic Acid Impurity 62
    CAS# 21066-20-6
    M.F.: C29H44O7
    M.W.: 504.66
  • QB011567
    Baloxavir marboxil Impurity 67
    CAS# 1985607-65-5
    M.F.: C20H24N2O6
    M.W.: 388.42
  • QA132631
    Amorolfine Impurity 31
    CAS# NA
    M.F.: C16H25NO
    M.W.: 247.38
  • QM182505
    Maropitant Citrate Impurity 5
    CAS# 2243127-12-8
    M.F.: C32H40N2O
    M.W.: 468.69
  • QT260439
    Trazodone hydrochloride Impurity 39
    CAS# NA
    M.F.: C38H53Cl3N8
    M.W.: 728.25
  • QT013406
    Controlled Substance
    (Tapentadol hydrochloride Impurity 6)

    CAS# NA
    M.F.: C14H23NO
    M.W.: 221.34
  • QT013402
    Controlled Substance
    (Tapentadol hydrochloride EP Impurity B)

    CAS# NA
    M.F.: C14H23NO
    M.W.: 221.34
  • QT013400
    Controlled Substance
    (Tapentadol hydrochloride)

    CAS# 175591-09-0
    M.F.: C14H23NO.HCl
    M.W.: 221.34 36.46
  • QD030491
    Diclofenac sodium Impurity 91
    CAS# NA
    M.F.: C14H9Cl2NO3
    M.W.: 310.13
  • QI142524
    Indocyanine Green Impurity 24
    CAS# 2581870-51-9
    M.F.: C16H17N
    M.W.: 223.32
  • QI142523
    Indocyanine Green Impurity 23
    CAS# 2550577-41-6
    M.F.: C15H15N
    M.W.: 209.29
  • QI142522
    Indocyanine Green Impurity 22
    CAS# 2589435-65-2
    M.F.: C15H15N
    M.W.: 209.29
  • QI142521
    Indocyanine Green Impurity 21
    CAS# 55970-05-3
    M.F.: C14H13N
    M.W.: 195.27
  • QI142520
    Indocyanine Green Impurity 20
    CAS# 57582-31-7
    M.F.: C13H11N
    M.W.: 181.24
  • QI142519
    Indocyanine Green Impurity 19
    CAS# 74470-85-2
    M.F.: C15H15N
    M.W.: 209.29
  • QD030490
    Diclofenac sodium Impurity 90
    CAS# 928343-25-3
    M.F.: C14H9Cl2NO3
    M.W.: 310.13
  • QA200607
    Atrasentan Impurity 7
    CAS# NA
    M.F.: C29H38N2O6
    M.W.: 510.63
  • QE200402
    Etrasimod Impurity 2
    CAS# 115591-64-5
    M.F.: C9H6ClF3O2
    M.W.: 238.59
  • QP181534
    Propranolol Impurity 34
    CAS# 76275-54-2;76275-62-2(HCl salt)
    M.F.: C16H21NO3
    M.W.: 275.35
  • QF150902
    Calcium Folinate Impurity 2
    CAS# NA
    M.F.: C38H40N14O11
    M.W.: 868.83
  • QP082900
    Calcium Phenylpyruvate
    CAS# 54865-40-6
    M.F.: C18H14CaO6
    M.W.: 366.38
  • QV011239
    Valproic Acid Impurity 39
    CAS# 87113-24-4
    M.F.: C9H17NO3
    M.W.: 187.24
  • QV011238
    Valproic Acid Impurity 38
    CAS# 5693-12-9
    M.F.: C10H18O4
    M.W.: 202.25
  • QV011237
    Valproic Acid Impurity 37
    CAS# 78466-62-3
    M.F.: C10H18O4
    M.W.: 202.25
  • QV011236
    Valproic Acid Impurity 36
    CAS# 4440-07-7
    M.F.: C8H14O4
    M.W.: 174.20
  • QV011235
    Valproic Acid Impurity 35
    CAS# 4371-03-3
    M.F.: C7H12O4
    M.W.: 160.17
  • QV011234
    Valproic Acid Impurity 34
    CAS# 4441-94-5
    M.F.: C9H16O4
    M.W.: 188.22
  • QM050611
    Mefenamic Acid-d4
    CAS# 1216745-79-7
    M.F.: C15H11D4NO2
    M.W.: 245.31
  • QL181990
    Lurasidone Impurity 90
    CAS# NA
    M.F.: C28H36N4O3S
    M.W.: 508.68
  • QP092730
    Pinaverium Bromide Impurity 30
    CAS# NA
    M.F.: C35H51Br2NO6
    M.W.: 741.60
  • QF051101
    Fenpiverinium-d3 Bromide
    CAS# NA
    M.F.: C22H26D3BrN2O
    M.W.: 420.41
  • QF051100
    Fenpiverinium Bromide
    CAS# 125-60-0
    M.F.: C22H29BrN2O
    M.W.: 417.39
  • QF061345
    Fosfomycin Trometamol Impurity 45
    CAS# NA
    M.F.: C6H16O9P2
    M.W.: 294.13
  • QS091107
    Shikimic Acid Impurity 7
    CAS# 40983-58-2
    M.F.: C8H12O5
    M.W.: 188.18
  • QB055104
    Benzoxonium chloride Impurity 4
    CAS# NA
    M.F.: C29H46ClNO2
    M.W.: 476.14
  • QB055103
    Benzoxonium chloride Impurity 3
    CAS# 62332-76-7
    M.F.: C21H37NO.HCl
    M.W.: 319.53 36.46
  • QB055102
    Benzoxonium chloride Impurity 2
    CAS# 51103-01-6;1541-67-9(free base)
    M.F.: C16H35NO2.HCl
    M.W.: 273.46 36.46
  • QB055101
    Benzoxonium chloride Impurity 1
    CAS# 55910-01-5
    M.F.: C25H46ClNO2
    M.W.: 428.10
  • QB055100
    Benzoxonium chloride
    CAS# 19379-90-9
    M.F.: C23H42ClNO2
    M.W.: 400.04
  • QI142700
    Insulin Aspart
    CAS# 116094-23-6
    M.F.: C256H381N65O79S6
    M.W.: 5825.54
  • QC031650
    Cefcapene pivoxil Impurity 50
    CAS# NA
    M.F.: C46H58N10O16S4
    M.W.: 1135.26
  • QC031649
    Cefcapene pivoxil Impurity 49
    CAS# NA
    M.F.: C23H29N5O9S2
    M.W.: 583.63
  • QC031648
    Cefcapene pivoxil Impurity 48
    CAS# NA
    M.F.: C27H36N4O8S2
    M.W.: 608.73
  • QM092219
    Mivacurium chloride Impurity 19
    CAS# NA
    M.F.: C25H35NO9S
    M.W.: 525.61
  • QN151887
    Noradrenaline (Norepinephrine) Impurity 87
    CAS# NA
    M.F.: C9H13NO6S
    M.W.: 263.26
  • QC120470
    Clindamycin Phosphate Impurity 70
    CAS# NA
    M.F.: C18H35N2O9PS
    M.W.: 486.52
  • QN151886
    Noradrenaline (Norepinephrine) Impurity 86
    CAS# NA
    M.F.: C16H16N2O5
    M.W.: 316.31
  • QN151885
    Noradrenaline (Norepinephrine) Impurity 85
    CAS# NA
    M.F.: C8H10N2O2
    M.W.: 166.18
  • QE192702
    Estetrol Impurity 2
    CAS# 690996-26-0
    M.F.: C25H28O2
    M.W.: 360.50
  • QM201861
    Metaraminol Impurity 61
    CAS# NA
    M.F.: C11H13NO4
    M.W.: 223.23
  • QP160207
    Prednisolone Sodium Phosphate Impurity 7
    CAS# 95615-71-7
    M.F.: C21H29O8P
    M.W.: 440.43
  • QP160206
    Prednisolone Sodium Phosphate Impurity 6
    CAS# NA
    M.F.: C21H27O7P
    M.W.: 422.41
  • QP160205
    Prednisolone Sodium Phosphate Impurity 5
    CAS# NA
    M.F.: C21H30O11P2
    M.W.: 520.41
  • QC071210
    D-Carglumic Acid
    CAS# 26117-15-7
    M.F.: C6H10N2O5
    M.W.: 190.16
  • QD030489
    Diclofenac sodium Impurity 89
    CAS# 131023-43-3
    M.F.: C14H11NO2
    M.W.: 225.25
  • QF061344
    Fosfomycin Trometamol Impurity 44
    CAS# 132125-60-1;1160525-87-0(xNH4+ salt)
    M.F.: C3H9O5P
    M.W.: 156.07
  • QP011411
    Calcium Pantothenate Impurity 11
    CAS# NA
    M.F.: C11H23N2O8PS
    M.W.: 374.34
  • QP011410
    Calcium Pantothenate Impurity 10
    CAS# NA
    M.F.: C12H23N2O10PS
    M.W.: 418.35
  • QP011409
    Calcium Pantothenate Impurity 9
    CAS# 5875-50-3
    M.F.: C9H18NO8P
    M.W.: 299.22
  • QC155903
    Coenzyme A Impurity 3
    CAS# NA
    M.F.: C23H40N7O17P3S2
    M.W.: 843.65
  • QC155902
    Coenzyme A Impurity 2
    CAS# NA
    M.F.: C21H35N6O17P3S
    M.W.: 768.52
  • QC155901
    Coenzyme A Impurity 1
    CAS# NA
    M.F.: C24H41N8O18P3S2
    M.W.: 886.67
  • QF120382
    5-Formimino Tetrahydrofolate
    CAS# 2311-81-1
    M.F.: C20H24N8O6
    M.W.: 472.46
  • QU190461
    Chenodeoxycholic acid Impurity 61
    CAS# NA
    M.F.: C48H78O7
    M.W.: 767.15
  • QU190460
    Ursodeoxycholic Acid Impurity 60
    CAS# 24637-45-4
    M.F.: C24H38O4
    M.W.: 390.56
  • QU190459
    Ursodeoxycholic Acid Impurity 59
    CAS# 1249-75-8
    M.F.: C25H42O3
    M.W.: 390.61
  • QU190458
    Ursodeoxycholic Acid Impurity 58
    CAS# 67733-54-4
    M.F.: C24H38O4
    M.W.: 390.56
  • QU190457
    Ursodeoxycholic Acid Impurity 57
    CAS# 77060-26-5
    M.F.: C24H38O4
    M.W.: 390.56
  • QB052530
    Benzylpenicillin sodium Impurity 30
    CAS# NA
    M.F.: C23H23N3O7S
    M.W.: 485.51
  • QD241376
    Dexamethasone sodium phosphate Impurity 76
    CAS# NA
    M.F.: C22H30FO8P
    M.W.: 472.45
  • QP052212
    Pentoxyverine hydrogen citrate Impurity 12
    CAS# 79611-69-1
    M.F.: C8H18ClNO
    M.W.: 179.69
  • QP052211
    Pentoxyverine hydrogen citrate Impurity 11
    CAS# 4535-95-9
    M.F.: C14H18O2
    M.W.: 218.30
  • QB052529
    Benzylpenicillin sodium Impurity 29
    CAS# NA
    M.F.: C23H23N3O7S
    M.W.: 485.51
  • QB052528
    Benzylpenicillin sodium Impurity 28
    CAS# NA
    M.F.: C23H23N3O7S
    M.W.: 485.51
  • QL091688
    Lipoic Acid Impurity 88
    CAS# NA
    M.F.: C8H14O3S2
    M.W.: 222.32
  • QT211206
    Tulathromycin A Impurity 6
    CAS# 217500-34-0
    M.F.: C41H79N3O12
    M.W.: 806.09
  • QT211205
    Tulathromycin A Impurity 5
    CAS# 217500-75-9
    M.F.: C38H70N2O12
    M.W.: 746.98
  • QD240107
    Doxapram hydrochloride Impurity 7
    CAS# NA
    M.F.: C24H32N2O3
    M.W.: 396.53
  • QD240106
    Doxapram hydrochloride Impurity 6
    CAS# 14327-53-8
    M.F.: C20H23NO2
    M.W.: 309.41
  • QD240105
    Doxapram hydrochloride Impurity 5
    CAS# 42595-90-4
    M.F.: C22H26N2O2
    M.W.: 350.46
  • QA190219
    L-Ascorbic Acid-13C6
    CAS# 1354064-87-1
    M.F.: 13C6H8O6
    M.W.: 182.08
  • QC065308
    trans-Chlorogenic acid
    CAS# 202650-88-2
    M.F.: C16H18O9
    M.W.: 354.31
  • QT080303
    Thiocolchicoside Hydrate EP Impurity C
    CAS# 87424-25-7
    M.F.: C21H23NO5S
    M.W.: 401.48
  • QW011830
    Warfarin sodium Impurity 30
    CAS# 21315-28-6
    M.F.: C11H10O3
    M.W.: 190.20
  • QL202437
    Thyroxamine
    CAS# 3571-49-1;788824-71-5(HCl salt)
    M.F.: C14H11I4NO2
    M.W.: 732.86
  • QM050116
    Metamizole sodium Impurity 16
    CAS# 810-16-2
    M.F.: C25H30N6O2
    M.W.: 446.56
  • QN093500
    Nigericin sodium
    CAS# 28643-80-3
    M.F.: C40H67NaO11
    M.W.: 746.95
  • QC551825
    Clenbuterol Impurity 25
    CAS# NA
    M.F.: C18H28Cl2N2O6
    M.W.: 439.33
  • QE180115
    Vitamin D2-d2;
    Ergocalciferol-d2

    CAS# NA
    M.F.: C28H42D2O
    M.W.: 398.67
  • QI193302
    Isosulfan Blue Impurity 2
    CAS# NA
    M.F.: C25H27N2NaO6S2
    M.W.: 538.61
  • QC121209
    Isovitamin D3
    CAS# 42607-12-5
    M.F.: C27H44O
    M.W.: 384.65
  • QA132623
    Amorolfine Impurity 23
    CAS# 865374-17-0
    M.F.: C11H15Br
    M.W.: 227.15
  • QR457070
    Rocuronium bromide Impurity 70
    CAS# NA
    M.F.: C27H46N2O3
    M.W.: 446.68
  • QR457069
    Rocuronium bromide Impurity 69
    CAS# NA
    M.F.: C27H46N2O3
    M.W.: 446.68
  • QR457068
    Rocuronium bromide Impurity 68
    CAS# 963-75-7
    M.F.: C19H28O
    M.W.: 272.43
  • QM251509
    myo-Inositol Impurity 9
    CAS# NA
    M.F.: C6H13O9P
    M.W.: 260.13
  • QE191844
    Estradiol 17-Hexanoate
    CAS# 71764-18-6
    M.F.: C24H34O3
    M.W.: 370.53
  • QE120411
    Eldecalcitol Impurity 11
    CAS# NA
    M.F.: C54H106O5Si4
    M.W.: 947.78
  • QE120409
    Eldecalcitol Impurity 9
    CAS# NA
    M.F.: C30H50O5
    M.W.: 490.73
  • QC061623
    Cefpodoxime Proxetil Impurity 23
    CAS# 65243-09-6
    M.F.: C7H9N3O3S
    M.W.: 215.23
  • QG125105
    Sodium Glycerophosphate Impurity 5
    CAS# 5746-57-6
    M.F.: C3H9O6P
    M.W.: 172.07
  • QG125104
    Sodium Glycerophosphate Impurity 4
    CAS# NA
    M.F.: C6H17O14P3
    M.W.: 406.11
  • QG125103
    Sodium Glycerophosphate Impurity 3
    CAS# 2075-06-1
    M.F.: C3H10O9P2
    M.W.: 252.05
  • QG125101
    Sodium Glycerophosphate Impurity 1
    CAS# NA
    M.F.: C6H15O8P
    M.W.: 246.15
  • QG125102
    Sodium Glycerophosphate Impurity 2
    CAS# 42320-97-8
    M.F.: C3H7O5P
    M.W.: 154.06
  • QH052013
    Hetrombopag Impurity 13
    CAS# NA
    M.F.: C11H7ClO4
    M.W.: 238.62
  • QP081217
    Glycerol Phenylbutyrate
    CAS# 611168-24-2
    M.F.: C33H38O6
    M.W.: 530.66
  • QE220321
    Evocalcet Impurity 21
    CAS# NA
    M.F.: C23H24N2O
    M.W.: 344.46
  • QC031647
    Cefcapene pivoxil Impurity 47
    CAS# NA
    M.F.: C22H31N5O7S2
    M.W.: 541.64
  • QL252200
    DL-Lysine Acetylsalicylate
    CAS# 62952-06-1
    M.F.: C6H14N2O2.C9H8O4
    M.W.: 146.19 180.16
  • QF120381
    Folic Acid Impurity 81
    CAS# 6810-75-9
    M.F.: C20H21N7O6
    M.W.: 455.43
  • QF120380
    Folic Acid Nitroso Impurity 3
    CAS# NA
    M.F.: C20H24N8O7
    M.W.: 488.46
  • QF120379
    Folic Acid Nitroso Impurity 2
    CAS# NA
    M.F.: C20H24N8O7
    M.W.: 488.46
  • QV3077138
    Vitamin K1 Impurity 138
    CAS# NA
    M.F.: C20H38
    M.W.: 278.52
  • QP092729
    Pinaverium Bromide Impurity 29
    CAS# NA
    M.F.: C26H42BrNO4
    M.W.: 512.53
  • QC042045
    Cefditoren pivoxil Impurity 45
    CAS# 138514-31-5
    M.F.: C29H27N3O5S2
    M.W.: 561.67
  • QL0114105
    Landiolol Impurity 105
    CAS# NA
    M.F.: C22H33Cl2N3O6
    M.W.: 506.42
  • QO022049
    Obeticholic Acid Impurity 49
    CAS# 459789-97-0
    M.F.: C28H46O4
    M.W.: 446.67
  • QT080310
    Thiocolchicoside Hydrate EP Impurity J
    CAS# 1359973-79-7
    M.F.: C27H33NO11S
    M.W.: 579.62
  • QT080307
    Thiocolchicoside Hydrate EP Impurity G
    CAS# 177991-81-0
    M.F.: C25H31NO9S
    M.W.: 521.58
  • QD151900
    Calcium Dobesilate monohydrate
    CAS# 117552-78-0;20123-80-2(1/2Ca salt);21799-87-1(K salt);88-46-0(free base);10021-55-3(Na salt)
    M.F.: C12H10CaO10S2.H2O
    M.W.: 418.40 18.02
  • QF061343
    Fosfomycin Trometamol Nitroso Impurity 1
    CAS# NA
    M.F.: C5H12N2O4
    M.W.: 164.16
  • QA020751
    Abemaciclib Impurity 51
    CAS# NA
    M.F.: C39H51ClN12
    M.W.: 723.37
  • QR457067
    Rocuronium bromide Impurity 67
    CAS# NA
    M.F.: C30H47BrN2O3
    M.W.: 563.62
  • QR457066
    Rocuronium bromide Impurity 66
    CAS# NA
    M.F.: C31H50N2O5
    M.W.: 530.75
  • QR457065
    Rocuronium bromide Impurity 65
    CAS# 119302-19-1
    M.F.: C23H37NO2
    M.W.: 359.55
  • QR457064
    Rocuronium bromide Impurity 64
    CAS# NA
    M.F.: C21H30O4
    M.W.: 346.47
  • QR457063
    Rocuronium bromide Impurity 63
    CAS# 50588-42-6
    M.F.: C21H30O2
    M.W.: 314.47
  • QD151918
    Calcium Dobesilate Impurity 18
    CAS# 6409-58-1
    M.F.: C6H6O5S
    M.W.: 190.17
  • QD151917
    Calcium Dobesilate Impurity 17
    CAS# 17724-07-1
    M.F.: C6H6O5S
    M.W.: 190.17
  • QD151916
    Calcium Dobesilate Impurity 16
    CAS# 4444-23-9
    M.F.: C6H6O8S2
    M.W.: 270.23
  • QT184701
    Trilaciclib Impurity 1
    CAS# 2170746-99-1
    M.F.: C20H26N4O3S
    M.W.: 402.51
  • QI193301
    Isosulfan Blue Impurity 1
    CAS# NA
    M.F.: C27H31ClN2O3S
    M.W.: 499.07
  • QP186600
    Prostacyclin (Epoprostenol)
    CAS# 35121-78-9
    M.F.: C20H32O5
    M.W.: 352.47
  • QP186601
    Prostacyclin (Epoprostenol) Impurity 1
    CAS# 91284-06-9
    M.F.: C20H32O5
    M.W.: 352.47
  • QO242710
    Oxybuprocaine hydrochloride Impurity 10
    CAS# 2102512-17-2
    M.F.: C13H17NO5
    M.W.: 267.28
  • QN202117
    Netupitant Impurity 17
    CAS# 825638-02-6
    M.F.: C18H20N4
    M.W.: 292.39
  • QF051807
    Ferulic acid-d3
    CAS# NA
    M.F.: C10H7D3O4
    M.W.: 197.20
  • QF051806
    trans-Ferulic acid-d3
    CAS# NA
    M.F.: C10H7D3O4
    M.W.: 197.20
  • QM050115
    Metamizole sodium Impurity 15
    CAS# NA
    M.F.: C12H11N3O2
    M.W.: 229.24
  • QP052210
    Pentoxyverine hydrogen citrate Impurity 10
    CAS# NA
    M.F.: C26H30O4
    M.W.: 406.52
  • QA020733
    Abemaciclib Impurity 33
    CAS# NA
    M.F.: C16H22N6
    M.W.: 298.39
  • QA020723
    Abemaciclib Impurity 23
    CAS# 1231930-42-9
    M.F.: C15H13ClF2N4
    M.W.: 322.74
  • QP091337
    Pimavanserin Impurity 37
    CAS# 415946-43-9
    M.F.: C13H19FN2
    M.W.: 222.31
  • QP081216
    Glycerol Phenylbutyrate Impurity 16
    CAS# NA
    M.F.: C24H30O5
    M.W.: 398.50
  • QP081215
    Glycerol Phenylbutyrate Impurity 15
    CAS# 127324-78-1
    M.F.: C22H26O4
    M.W.: 354.45
  • QP081214
    Glycerol Phenylbutyrate Impurity 14
    CAS# 2380371-01-5
    M.F.: C23H28O4
    M.W.: 368.47
  • QP081213
    Glycerol Phenylbutyrate Impurity 13
    CAS# 358349-85-6
    M.F.: C13H18O2
    M.W.: 206.29
  • QC080313
    Cholic Acid Impurity 13
    CAS# 86678-85-5
    M.F.: C26H45NO4
    M.W.: 435.65
  • QC080312
    Cholic Acid Impurity 12
    CAS# 47676-48-2
    M.F.: C26H44O5
    M.W.: 436.63
  • QP1824116
    Parecoxib Sodium Impurity 116
    CAS# NA
    M.F.: C19H18N2O4S
    M.W.: 370.42
  • QP181531
    Propranolol Impurity 31
    CAS# 143487-95-0
    M.F.: C16H21NO2
    M.W.: 259.35
  • QG122730
    Glycopyrronium Bromide Impurity 30
    CAS# 937179-78-7
    M.F.: C18H25NO3
    M.W.: 303.40
  • QV3077137
    Vitamin K1 Impurity 137
    CAS# NA
    M.F.: C31H46O3
    M.W.: 466.71
  • QG121834
    Glycyrrhizic Acid Impurity 34
    CAS# NA
    M.F.: C44H66O16
    M.W.: 851.00
  • QG121833
    Glycyrrhizic Acid Impurity 33
    CAS# 114006-81-4
    M.F.: C44H66O16
    M.W.: 851.00
  • QG121831
    Glycyrrhizic Acid Impurity 31
    CAS# NA
    M.F.: C42H62O17
    M.W.: 838.94
  • QG121829
    Glycyrrhizic Acid Impurity 29
    CAS# NA
    M.F.: C42H62O17
    M.W.: 838.94
  • QG121828
    Macedonoside A
    CAS# 256441-31-3
    M.F.: C42H62O17
    M.W.: 838.94
  • QG121827
    Glycyrrhizic Acid Impurity 27
    CAS# 119479-05-9
    M.F.: C42H62O16
    M.W.: 822.94
  • QG121826
    Glycyrrhizic Acid Impurity 26
    CAS# 67951-04-6
    M.F.: C30H48O4
    M.W.: 472.71
  • QG121825
    Glycyrrhizic Acid Impurity 25
    CAS# 34096-83-8
    M.F.: C36H54O10
    M.W.: 646.82
  • QR150100
    Roburic acid
    CAS# 6812-81-3
    M.F.: C30H48O2
    M.W.: 440.71
  • QZ121633
    Zolpidem tartrate EP Impurity E
    CAS# NA
    M.F.: C13H15NO2
    M.W.: 217.27
  • QZ121632
    Zolpidem tartrate EP Impurity B
    CAS# NA
    M.F.: C19H20BrN3O
    M.W.: 386.29
  • QI150604
    Iobitridol Impurity 4
    CAS# NA
    M.F.: C19H26I3N3O9
    M.W.: 821.14
  • QL0114103
    Landiolol Impurity 103
    CAS# NA
    M.F.: C44H66N6O13
    M.W.: 887.04
  • QD150309
    Docusate sodium Impurity 9
    CAS# NA
    M.F.: C12H20O4
    M.W.: 228.29
  • QB054906
    Bevantolol Impurity 6
    CAS# 1883510-17-5
    M.F.: C10H13NO
    M.W.: 163.22
  • QN151884
    Noradrenaline (Norepinephrine) Nitroso Impurity 1
    CAS# NA
    M.F.: C12H18N2O4
    M.W.: 254.29
  • QP250202
    Pyrvinium Pamoate Impurity 2
    CAS# NA
    M.F.: C26H28IN3O
    M.W.: 525.43
  • QJ012000
    Jatrorrhizine Hydrochloride
    CAS# 960383-96-4
    M.F.: C20H20ClNO4
    M.W.: 373.83
  • QG012404
    Gabexate Mesylate Impurity 4
    CAS# 2978626-53-6
    M.F.: C15H21N3O4
    M.W.: 307.35
  • QG012403
    Gabexate Mesylate Impurity 3
    CAS# 742027-02-7
    M.F.: C15H21NO4
    M.W.: 279.34
  • QG012402
    Gabexate Mesylate Impurity 2
    CAS# NA
    M.F.: C13H26N4O4S
    M.W.: 334.44
  • QG012401
    Gabexate Mesylate Impurity 1
    CAS# NA
    M.F.: C7H15N3O2S
    M.W.: 205.28
  • QP132089
    Pemetrexed Impurity 89
    CAS# 117390-08-6
    M.F.: C11H12O3
    M.W.: 192.21
  • QI141100
    Inophyllum B
    CAS# 41135-06-2
    M.F.: C25H24O5
    M.W.: 404.46
  • QE220312
    Evocalcet Impurity 12
    CAS# NA
    M.F.: C12H16N2O2.2HCl
    M.W.: 220.27 72.92
  • QC031646
    Cefcapene pivoxil Impurity 46
    CAS# 63626-54-0
    M.F.: C10H12N2O5S
    M.W.: 272.28
  • QA152411
    Amphotericin B Impurity 11
    CAS# NA
    M.F.: C53H83NO22
    M.W.: 1086.23
  • QF0905137
    Finerenone Impurity 137
    CAS# NA
    M.F.: C15H13N3O2
    M.W.: 267.29
  • QB011566
    Baloxavir marboxil Impurity 66
    CAS# NA
    M.F.: C27H23F2N3O7S
    M.W.: 571.55
  • QB011565
    Baloxavir marboxil Impurity 65
    CAS# NA
    M.F.: C9H6Br2F2O2
    M.W.: 343.95
  • QD030488
    Diclofenac sodium Impurity 88
    CAS# NA
    M.F.: C16H11Cl2NO
    M.W.: 304.17
  • QP032040
    Procaterol Impurity 40
    CAS# 56489-06-6
    M.F.: C4H6Br2O
    M.W.: 229.90
  • QF122927
    Fluocinolone acetonide Impurity 27
    CAS# 62013-83-6
    M.F.: C25H32F2O7
    M.W.: 482.52
  • QF122926
    Fluocinolone acetonide Impurity 26
    CAS# 67438-37-3
    M.F.: C26H32F2O7
    M.W.: 494.53
  • QP1824115
    Parecoxib Sodium Impurity 115
    CAS# 2304623-38-7
    M.F.: C19H18N2O4S
    M.W.: 370.42
  • QI040176
    Indacaterol Nitroso Impurity 2
    CAS# NA
    M.F.: C24H27N3O4
    M.W.: 421.5
  • QB210307
    Bucladesine sodium Impurity 7
    CAS# NA
    M.F.: C22H30N5O9P
    M.W.: 539.48
  • QB210306
    Bucladesine sodium Impurity 6
    CAS# NA
    M.F.: C22H30N5O9P
    M.W.: 539.48
  • QB210305
    Bucladesine sodium Impurity 5
    CAS# NA
    M.F.: C22H32N5O10P
    M.W.: 557.50
  • QB210304
    Bucladesine sodium Impurity 4
    CAS# NA
    M.F.: C18H24N5O8P
    M.W.: 469.39
  • QB210303
    Bucladesine sodium Impurity 3
    CAS# NA
    M.F.: C25H32N7O8P
    M.W.: 589.55
  • QG020914
    Novagib
    CAS# 8030-53-3
    M.F.: C19H24O5.C19H22O5
    M.W.: 332.40 330.38
  • QH150926
    Hyoscine Butylbromide Impurity 26
    CAS# NA
    M.F.: C12H22BrNO2
    M.W.: 292.22
  • QH150925
    Hyoscine Butylbromide Impurity 25
    CAS# NA
    M.F.: C12H22BrNO2
    M.W.: 292.22
  • QT201629
    Tiotropium bromide Impurity 29
    CAS# 28540-31-0
    M.F.: C11H10O3S2
    M.W.: 254.32
  • QO132092
    Olmesartan Medoxomil Impurity 92
    CAS# 1454571-97-1
    M.F.: C53H54N12O9
    M.W.: 1003.09
  • QM125901
    Malachite Green Chloride-d5
    CAS# NA
    M.F.: C23H20D5ClN2
    M.W.: 369.95
  • QM125900
    Malachite Green Chloride
    CAS# 569-64-2
    M.F.: C23H25ClN2
    M.W.: 364.92
  • QC202503
    Cetylpyridinium chloride Impurity 3
    CAS# 132446-03-8
    M.F.: C22H40ClN
    M.W.: 354.02
  • QA161251
    Apalutamide Impurity 51
    CAS# NA
    M.F.: C16H8F6N6O
    M.W.: 414.27
  • QV051841
    Norverapamil-d7 HCl;
    Verapamil EP Impurity J-d7 HCl

    CAS# 1216413-74-9
    M.F.: C26H29D7N2O4.HCl
    M.W.: 447.63 36.46
  • QC041321
    25-Hydroxy Vitamin D2-d3
    CAS# 1217467-39-4
    M.F.: C28H41D3O2
    M.W.: 415.68
  • QH042512
    Hydrocortisone acetate Impurity 12
    CAS# 50733-56-7
    M.F.: C23H32O7
    M.W.: 420.50
  • QM010325
    Macitentan Impurity 25
    CAS# 38353-06-9
    M.F.: C4H3BrN2O
    M.W.: 174.99
  • QV3077136
    Vitamin K1 Impurity 136
    CAS# NA
    M.F.: C31H46O3
    M.W.: 466.71
  • QC012317
    Carteolol Impurity 17
    CAS# NA
    M.F.: C9H11NO2
    M.W.: 165.19
  • QT011512
    Tauroursodeoxycholic Acid Impurity 12
    CAS# NA
    M.F.: C26H45NO6S
    M.W.: 499.71
  • QT011511
    Tauroursodeoxycholic Acid Impurity 11
    CAS# NA
    M.F.: C29H50O4
    M.W.: 462.72
  • QT011510
    Tauroursodeoxycholic Acid Impurity 10
    CAS# NA
    M.F.: C26H45NO6S
    M.W.: 499.71
  • QP093302
    Pipecuronium Bromide Impurity 2
    CAS# 74133-45-2
    M.F.: C31H58Br2N4O2
    M.W.: 678.64
  • QP093301
    Pipecuronium Bromide Impurity 1
    CAS# 74395-81-6
    M.F.: C33H60Br2N4O3
    M.W.: 720.68
  • QC132679
    Cefmetazole sodium Impurity 79
    CAS# NA
    M.F.: C6H7NO3S2
    M.W.: 205.25
  • QC132678
    Cefmetazole sodium Impurity 78
    CAS# NA
    M.F.: C30H29N7O6S4
    M.W.: 711.85
  • QC132677
    Cefmetazole sodium Impurity 77
    CAS# NA
    M.F.: C28H29N7O6S3
    M.W.: 655.76
  • QM131934
    Mometasone Furoate-d3
    CAS# NA
    M.F.: C27H27D3Cl2O6
    M.W.: 524.45
  • QN151883
    Noradrenaline (Norepinephrine) Impurity 83
    CAS# NA
    M.F.: C24H21NO9
    M.W.: 467.43
  • QN151882
    Noradrenaline (Norepinephrine) Impurity 82
    CAS# NA
    M.F.: C16H15NO6
    M.W.: 317.30
  • QR212204
    Rutoside trihydrate Impurity 4
    CAS# 2429978-69-6
    M.F.: C27H30O17
    M.W.: 626.52
  • QC061881
    Cefuroxime Axetil Impurity 81
    CAS# NA
    M.F.: C20H24N4O11S
    M.W.: 528.49
  • QE2002102
    Eltrombopag Impurity 102
    CAS# NA
    M.F.: C27H26N4O4
    M.W.: 470.53
  • QB011564
    Baloxavir marboxil Impurity 64
    CAS# NA
    M.F.: C41H31F4N3O7S2
    M.W.: 817.83
  • QB011563
    Baloxavir marboxil Impurity 63
    CAS# NA
    M.F.: C41H31F4N3O7S2
    M.W.: 817.83
  • QR457062
    Rocuronium bromide Impurity 62
    CAS# 82467-84-3
    M.F.: C19H28O
    M.W.: 272.43
  • QT131219
    Timolol Maleate Impurity 19
    CAS# NA
    M.F.: C13H24N4O2S2
    M.W.: 332.48
  • QT131218
    Timolol Maleate Impurity 18
    CAS# NA
    M.F.: C16H26N4O4S
    M.W.: 370.47
  • QH120505
    Halobetasol Propionate Impurity 5
    CAS# 924726-89-6
    M.F.: C25H32F2O6
    M.W.: 466.52
  • QH120504
    Halobetasol Propionate Impurity 4
    CAS# 541502-98-1
    M.F.: C25H32F2O6
    M.W.: 466.52
  • QB052527
    Benzylpenicillin sodium Impurity 27
    CAS# NA
    M.F.: C17H20N2O6S
    M.W.: 380.42
  • QA130514
    Aminolevulinic Acid Impurity 14
    CAS# NA
    M.F.: C10H14N2O4
    M.W.: 226.23
  • QA130512
    Aminolevulinic Acid Impurity 12
    CAS# 77479-03-9
    M.F.: C10H14N2O4
    M.W.: 226.23
  • QA130511
    Aminolevulinic Acid Impurity 11
    CAS# NA
    M.F.: C10H14N2O4
    M.W.: 226.23
  • QA130513
    Aminolevulinic Acid Impurity 13;
    Porphobilinogen

    CAS# 487-90-1
    M.F.: C10H14N2O4
    M.W.: 226.23
  • QA130510
    Aminolevulinic Acid Impurity 10
    CAS# NA
    M.F.: C5H8ClNO2
    M.W.: 149.57
  • QD030487
    Diclofenac sodium Impurity 87
    CAS# NA
    M.F.: C18H19Cl2NO3
    M.W.: 368.25
  • QD030486
    Diclofenac sodium Impurity 86
    CAS# NA
    M.F.: C18H19Cl2NO3
    M.W.: 368.25
  • QF211405
    Flunixin meglumine Impurity 5
    CAS# 75369-61-8
    M.F.: C14H11F3N2O3
    M.W.: 312.25
  • QA201634
    Nortropine
    CAS# 538-09-0
    M.F.: C7H13NO
    M.W.: 127.19
  • QB053408
    Benzydamine Hydrochloride Impurity 8
    CAS# 47448-66-8
    M.F.: C21H27N3O
    M.W.: 337.47
  • QT021615
    Tebipenem Pivoxil Impurity 15
    CAS# NA
    M.F.: C44H62N6O12S4
    M.W.: 995.25
  • QO242709
    Oxybuprocaine hydrochloride Impurity 9
    CAS# 109545-27-9;2727060-44-6(2HCl salt)
    M.F.: C17H28N2O4
    M.W.: 324.42
  • QO242708
    Oxybuprocaine hydrochloride Impurity 8
    CAS# NA
    M.F.: C23H42ClN3O3
    M.W.: 444.06
  • QO242707
    Oxybuprocaine hydrochloride Impurity 7
    CAS# NA
    M.F.: C23H41N3O3
    M.W.: 407.60
  • QT021614
    Tebipenem Pivoxil Impurity 14
    CAS# NA
    M.F.: C44H62N6O12S4
    M.W.: 995.25
  • QD0207111
    Dabigatran Etexilate Impurity 111
    CAS# 1620205-04-0
    M.F.: C17H16ClN3O5
    M.W.: 377.78
  • QO240126
    Oxacillin sodium Impurity 26
    CAS# 36231-30-8
    M.F.: C19H19N3O6S
    M.W.: 417.44
  • QB011562
    Baloxavir marboxil Impurity 62
    CAS# NA
    M.F.: C30H32FN3O4S
    M.W.: 549.66
  • QB011561
    Baloxavir marboxil Impurity 61
    CAS# NA
    M.F.: C27H24FN3O7S
    M.W.: 553.56
  • QB011560
    Baloxavir marboxil Impurity 60
    CAS# NA
    M.F.: C24H20FN3O4S
    M.W.: 465.50
  • QP160649
    Propofol Impurity 49
    CAS# NA
    M.F.: C12H16O6S
    M.W.: 288.31
  • QT131217
    Timolol Maleate Impurity 17
    CAS# 75014-26-5
    M.F.: C11H22N4O3S
    M.W.: 290.38
  • QP092728
    Pinaverium Bromide Impurity 28
    CAS# 2453176-34-4
    M.F.: C11H15BrO3
    M.W.: 275.14
  • QP092727
    Pinaverium Bromide Impurity 27
    CAS# 124618-99-1
    M.F.: C10H13BrO3
    M.W.: 261.12
  • QP092726
    Pinaverium Bromide Impurity 26
    CAS# 5392-10-9
    M.F.: C9H9BrO3
    M.W.: 245.07
  • QP092725
    Pinaverium Bromide Impurity 25
    CAS# NA
    M.F.: C17H31NO2
    M.W.: 281.44
  • QP092724
    Pinaverium Bromide Impurity 24
    CAS# 151825-19-3
    M.F.: C11H20O
    M.W.: 168.28
  • QP092723
    Pinaverium Bromide Impurity 23
    CAS# 151825-17-1
    M.F.: C11H20O
    M.W.: 168.28
  • QO022048
    Obeticholic Acid Impurity 48
    CAS# 2089120-64-7
    M.F.: C26H45O7P
    M.W.: 500.61
  • QT260438
    N-Nitroso Trazodone hydrochloride EP Impurity L
    CAS# 2219339-13-4
    M.F.: C10H12ClN3O
    M.W.: 225.68
  • QR090620
    Rifamycin Impurity 20
    CAS# 16783-97-4
    M.F.: C36H45NO12
    M.W.: 683.75
  • QB052526
    Benzathine benzylpenicillin
    CAS# 1538-09-6
    M.F.: C16H18N2O4S.1/2C16H20N2
    M.W.: 334.39 1/2*240.35
  • QC061880
    Cefuroxime sodium Impurity 80
    CAS# NA
    M.F.: C31H29N7O14S2
    M.W.: 787.73
  • QV051840
    Verapamil Impurity 40
    CAS# NA
    M.F.: C16H25Cl2NO2
    M.W.: 334.28
  • QF120378
    Folic Acid Impurity 78
    CAS# 71963-69-4
    M.F.: C19H23N7O6
    M.W.: 445.44
  • QT013403
    Tapentadol hydrochloride EP Impurity C
    CAS# NA
    M.F.: C14H21NO
    M.W.: 219.33
  • QP092722
    Pinaverium Bromide Impurity 22
    CAS# NA
    M.F.: C17H31NO2
    M.W.: 281.44
  • QC202502
    Cetylpyridinium chloride Impurity 2
    CAS# 3165-81-9
    M.F.: C23H42ClN
    M.W.: 368.05
  • QP250201
    Pyrvinium Pamoate Impurity 1
    CAS# 1391013-31-2
    M.F.: C25H25N3
    M.W.: 367.50
  • QO032821
    Octreotide Impurity 21
    CAS# NA
    M.F.: C53H70N10O14S2
    M.W.: 1135.32
  • QC162648
    Cefprozil Impurity 48
    CAS# NA
    M.F.: C26H26N2O5S
    M.W.: 478.56
  • QL011488
    Landiolol Impurity 88
    CAS# NA
    M.F.: C12H14O4
    M.W.: 222.24
  • QL011483
    Landiolol Impurity 83
    CAS# NA
    M.F.: C16H23N3O4
    M.W.: 321.38
  • QD030485
    Diclofenac sodium Impurity 85
    CAS# NA
    M.F.: C28H20Cl4N2O4
    M.W.: 590.28
  • QD030484
    Diclofenac sodium Impurity 84
    CAS# NA
    M.F.: C15H13Cl2NO2
    M.W.: 310.17
  • QD030483
    Diclofenac sodium Nitroso Impurity 1
    CAS# NA
    M.F.: C12H8Cl2N2O
    M.W.: 267.11
  • QC013126
    Carbazochrome Impurity 26
    CAS# NA
    M.F.: C10H14N4O8S2
    M.W.: 382.36
  • QO243100
    Oxantel pamoate
    CAS# 68813-55-8
    M.F.: C13H16N2O.C23H16O6
    M.W.: 216.28 388.38
  • QD192046
    Dasatinib Impurity 46
    CAS# NA
    M.F.: C12H14ClNO2
    M.W.: 239.70
  • QG052802
    Geranyl acetate
    CAS# 105-87-3
    M.F.: C12H20O2
    M.W.: 196.29
  • QD098700
    Diphemanil Methylsulfate
    CAS# 62-97-5
    M.F.: C21H27NO4S
    M.W.: 389.51
  • QA690301
    (+)-Abscisic Acid Glucose Ester-d6
    CAS# NA
    M.F.: C21H25D5O9
    M.W.: 431.49
  • QO132091
    N-Nitroso Olmesartan Medoxomil
    CAS# NA
    M.F.: C29H29N7O7
    M.W.: 587.59
  • QD150308
    Docusate sodium Impurity 8
    CAS# 7423-42-9
    M.F.: C12H20O4
    M.W.: 228.29
  • QB011559
    Baloxavir marboxil Impurity 59
    CAS# NA
    M.F.: C24H19F2N3O4S
    M.W.: 483.49
  • QB011558
    Baloxavir marboxil Impurity 58
    CAS# NA
    M.F.: C24H19F2N3O4S
    M.W.: 483.49
  • QB011557
    Baloxavir marboxil Impurity 57
    CAS# NA
    M.F.: C21H16F2O3S2
    M.W.: 418.47
  • QB011556
    Baloxavir marboxil Impurity 56
    CAS# NA
    M.F.: C15H12F2O3S2
    M.W.: 342.37
  • QB011555
    Baloxavir marboxil Impurity 55
    CAS# NA
    M.F.: C30H31F2N3O4S
    M.W.: 567.65
  • QB011554
    Baloxavir marboxil Impurity 54
    CAS# NA
    M.F.: C30H31F2N3O4S
    M.W.: 567.65
  • QB011553
    Baloxavir marboxil Impurity 53
    CAS# NA
    M.F.: C14H10F2O3S
    M.W.: 296.29
  • QB011552
    Baloxavir marboxil Impurity 52
    CAS# NA
    M.F.: C14H10F2O2S
    M.W.: 280.29
  • QB011551
    Baloxavir marboxil Impurity 51
    CAS# NA
    M.F.: C10H11N3O4
    M.W.: 237.22
  • QB011550
    Baloxavir marboxil Impurity 50
    CAS# 1745-46-6
    M.F.: C14H12OS
    M.W.: 228.31
  • QB011549
    Baloxavir marboxil Impurity 49
    CAS# 1820001-80-6
    M.F.: C14H11FOS
    M.W.: 246.30
  • QD091009
    Dicloxacillin sodium Impurity 9
    CAS# NA
    M.F.: C21H21Cl2N3O7S
    M.W.: 530.37
  • QB031813
    Bromocriptine mesilate Impurity 13
    CAS# NA
    M.F.: C33H42BrN5O5S
    M.W.: 700.69
  • QD091008
    Dicloxacillin sodium Impurity 8
    CAS# 934986-84-2
    M.F.: C21H21Cl2N3O7S
    M.W.: 530.37
  • QD091007
    Dicloxacillin sodium Impurity 7
    CAS# 883225-99-8
    M.F.: C13H10Cl2N2O4
    M.W.: 329.13
  • QI151623
    Ioversol Impurity 5
    CAS# NA
    M.F.: C13H14I3N3O6
    M.W.: 688.98
  • QB011548
    Baloxavir marboxil Impurity 48
    CAS# 2826217-70-1
    M.F.: C24H19F2N3O4S
    M.W.: 483.49
  • QB011547
    Baloxavir marboxil Impurity 47
    CAS# 2136287-88-0;2437603-06-8(mesylate)
    M.F.: C30H31F2N3O4S
    M.W.: 567.65
  • QF120807
    Flecainide acetate Nitroso Impurity 2
    CAS# NA
    M.F.: C17H19F6N3O4
    M.W.: 443.35
  • QT142434
    Tranexamic Acid Impurity 34
    CAS# NA
    M.F.: C10H17NO3
    M.W.: 199.25
  • QC1825125
    Canagliflozin Impurity 125
    CAS# NA
    M.F.: C12H14O8
    M.W.: 286.24
  • QR091133
    Rimegepant Impurity 33
    CAS# 1452167-10-0
    M.F.: C25H32FNO3Si
    M.W.: 441.62
  • QR091129
    Rimegepant Impurity 29
    CAS# 1397526-11-2
    M.F.: C25H33F2NO2Si
    M.W.: 445.63
  • QB052525
    Benzylpenicillin sodium Impurity 25
    CAS# NA
    M.F.: C32H38N4O9S2
    M.W.: 686.80
  • QT080305
    Thiocolchicoside Hydrate EP Impurity E
    CAS# 219547-29-2
    M.F.: C26H31NO10S
    M.W.: 549.59
  • QT010628
    Tafluprost Impurity 28
    CAS# 2065-23-8
    M.F.: C9H10O3
    M.W.: 166.18
  • QT092616
    Tizanidine Impurity 16
    CAS# 767-64-6
    M.F.: C6H5N3S
    M.W.: 151.19
  • QC061879
    Cefuroxime Axetil Impurity 79
    CAS# 65866-86-6
    M.F.: C7H7NO4
    M.W.: 169.14
  • QT090310
    Thioctic Acid Impurity 10
    CAS# 97023-76-2
    M.F.: C13H16O2
    M.W.: 204.27
  • QT090309
    Thioctic Acid Impurity 9
    CAS# NA
    M.F.: C13H16O2
    M.W.: 204.27
  • QC155700
    Corosolic acid
    CAS# 4547-24-4
    M.F.: C30H48O4
    M.W.: 472.71
  • QC132676
    Cefmetazole sodium Impurity 76
    CAS# NA
    M.F.: C28H27N7O5S3
    M.W.: 637.75
  • QD030482
    Diclofenac sodium Impurity 82
    CAS# 1470584-30-5
    M.F.: C11H12Cl2O2
    M.W.: 247.12
  • QI142602
    Insulin icodec B-FVNQHLCGSHLVEALHLVCGERGFHYTPK
    CAS# NA
    M.F.: NA
    M.W.: NA
  • QI142601
    Insulin icodec A-GIVEQCCTSICSLEQLENYCN
    CAS# NA
    M.F.: NA
    M.W.: NA
  • QB053308
    Belumosudil Impurity 8
    CAS# NA
    M.F.: C36H41N7O5
    M.W.: 651.77
  • QG121824
    Glycyrrhizic acid methyl ester
    CAS# 104191-95-9
    M.F.: C43H64O16
    M.W.: 836.97
  • QA181901
    Aristolochic acid
    CAS# 313-67-7
    M.F.: C17H11NO7
    M.W.: 341.28
  • QP090343
    Sodium Picosulfate Impurity 43
    CAS# NA
    M.F.: C18H13NNa2O12S3
    M.W.: 577.46
  • QP090342
    Sodium Picosulfate Impurity 42
    CAS# NA
    M.F.: C18H15NO6S
    M.W.: 373.38
  • QP090341
    Sodium Picosulfate Impurity 41
    CAS# NA
    M.F.: C19H15NNa2O11S3
    M.W.: 575.48
  • QP090340
    Sodium Picosulfate Impurity 40
    CAS# NA
    M.F.: C19H17NO5S
    M.W.: 371.41
  • QB051340
    Bempedoic acid Impurity 40
    CAS# 2127387-65-7
    M.F.: C19H34O4
    M.W.: 326.48
  • QB051339
    Bempedoic acid Impurity 39
    CAS# NA
    M.F.: C19H38O4
    M.W.: 330.51
  • QB051338
    Bempedoic acid Impurity 38
    CAS# NA
    M.F.: C10H20O3
    M.W.: 188.27
  • QB051337
    Bempedoic acid Impurity 37
    CAS# 14250-73-8
    M.F.: C9H18O2
    M.W.: 158.24
  • QB051336
    Bempedoic acid Impurity 36
    CAS# NA
    M.F.: C21H36O10
    M.W.: 448.51
  • QP160204
    Prednisolone Sodium Phosphate USP Impurity F
    CAS# NA
    M.F.: C21H27O7P
    M.W.: 422.41
  • QP160203
    Prednisolone Sodium Phosphate Impurity 3
    CAS# NA
    M.F.: C21H29O8P
    M.W.: 440.43
  • QP160202
    Prednisolone Sodium Phosphate Impurity 2
    CAS# NA
    M.F.: C21H29O8P
    M.W.: 440.43
  • QP160201
    Prednisolone Sodium Phosphate Impurity 1
    CAS# NA
    M.F.: C21H29O8P
    M.W.: 440.43
  • QP160200
    Prednisolone Sodium Phosphate
    CAS# 125-02-0
    M.F.: C21H27Na2O8P
    M.W.: 484.39
  • QM041516
    Medroxyprogesterone Acetate Impurity 16
    CAS# NA
    M.F.: C25H36O4
    M.W.: 400.56
  • QM041515
    Medroxyprogesterone Acetate Impurity 15
    CAS# 136803-81-1
    M.F.: C25H32O4
    M.W.: 396.53
  • QM041514
    Medroxyprogesterone Acetate Impurity 14
    CAS# 2128317-86-0
    M.F.: C31H41NO4
    M.W.: 491.67
  • QO240125
    Oxacillin sodium Impurity 25
    CAS# NA
    M.F.: C19H18ClN3O5S
    M.W.: 435.88
  • QH041834
    Cholesterol 5beta,6beta-Epoxide
    CAS# 4025-59-6
    M.F.: C27H46O2
    M.W.: 402.66
  • QH041833
    Cholesterol 5alpha,6alpha-Epoxide
    CAS# 1250-95-9
    M.F.: C27H46O2
    M.W.: 402.66
  • QO022047
    Obeticholic Acid Impurity 47
    CAS# 1654780-32-1
    M.F.: C27H44O4
    M.W.: 432.65
  • QT142433
    Tranexamic Acid Impurity 33
    CAS# NA
    M.F.: C10H17NO3
    M.W.: 199.25
  • QT142432
    Tranexamic Acid Impurity 32
    CAS# 10473-24-2
    M.F.: C10H17NO3
    M.W.: 199.25
  • QT260437
    Trazodone hydrochloride Impurity 37
    CAS# NA
    M.F.: C16H25ClN2O
    M.W.: 296.84
  • QT260436
    Trazodone hydrochloride Impurity 36
    CAS# 157072-20-3
    M.F.: C19H22ClN5O
    M.W.: 371.87
  • QC061621
    Cefpodoxime Proxetil EP Impurity A-d3 Sodium Salt
    CAS# NA
    M.F.: C15H13D3N5NaO6S2
    M.W.: 452.45
  • QE042888
    Edoxaban Impurity 88
    CAS# 141354-54-3
    M.F.: C9H9BrN2O3
    M.W.: 273.09
  • QD052604
    Dexchlorpheniramine maleate Impurity 4
    CAS# NA
    M.F.: C16H19ClN2O2
    M.W.: 306.79
  • QB151300
    Bongkrekic acid
    CAS# 11076-19-0
    M.F.: C28H38O7
    M.W.: 486.61
  • QE070600
    E7766 diammonium salt
    CAS# 2242635-03-4
    M.F.: C24H32F2N12O8P2S2
    M.W.: 780.66
  • QP092721
    Pinaverium Bromide Impurity 21
    CAS# NA
    M.F.: C17H31NO2
    M.W.: 281.44
  • QP081212
    Glycerol Phenylbutyrate Impurity 12
    CAS# NA
    M.F.: C33H36O7
    M.W.: 544.64
  • QP081211
    Glycerol Phenylbutyrate Impurity 11
    CAS# NA
    M.F.: C33H36O7
    M.W.: 544.64
  • QB011545
    Baloxavir marboxil Impurity 45
    CAS# NA
    M.F.: C25H21F2N3O6S2
    M.W.: 561.57
  • QB011544
    Baloxavir marboxil Impurity 44
    CAS# NA
    M.F.: C27H22ClF2N3O7S
    M.W.: 605.99
  • QP081210
    Glycerol Phenylbutyrate Impurity 10
    CAS# NA
    M.F.: C46H54O9
    M.W.: 750.93
  • QP081209
    Glycerol Phenylbutyrate Impurity 9
    CAS# NA
    M.F.: C46H54O9
    M.W.: 750.93
  • QP081208
    Glycerol Phenylbutyrate Impurity 8
    CAS# NA
    M.F.: C33H36O7
    M.W.: 544.64
  • QP081207
    Glycerol Phenylbutyrate Impurity 7
    CAS# NA
    M.F.: C13H18O4
    M.W.: 238.28
  • QP081206
    Glycerol Phenylbutyrate Impurity 6
    CAS# 1292210-87-7
    M.F.: C13H18O4
    M.W.: 238.28
  • QP081205
    Glycerol Phenylbutyrate Impurity 5
    CAS# 864811-35-8
    M.F.: C23H28O5
    M.W.: 384.47
  • QP081204
    Glycerol Phenylbutyrate Impurity 4
    CAS# 1443417-10-4
    M.F.: C23H28O5
    M.W.: 384.47
  • QP010701
    Paederosidic acid methyl ester
    CAS# 122413-01-8
    M.F.: C19H26O12S
    M.W.: 478.47
  • QT142430
    N-Nitroso Tranexamic Acid EP Impurity A
    CAS# NA
    M.F.: C16H26N2O5
    M.W.: 326.39
  • QM050114
    Metamizole sodium Impurity 14
    CAS# NA
    M.F.: C13H17N3O7S2
    M.W.: 391.41
  • QO240124
    Oxacillin sodium Impurity 24
    CAS# NA
    M.F.: C19H20N4O4S
    M.W.: 400.45
  • QD150100
    Domoic acid
    CAS# 14277-97-5
    M.F.: C15H21NO6
    M.W.: 311.33
  • QB051335
    Bempedoic acid Impurity 35
    CAS# 2511500-14-2
    M.F.: C21H40O5
    M.W.: 372.55
  • QC061878
    Cefuroxime Axetil Impurity 78
    CAS# NA
    M.F.: C19H21N3O8S
    M.W.: 451.45
  • QC061877
    Cefuroxime Axetil Impurity 77
    CAS# NA
    M.F.: C21H23N3O10S
    M.W.: 509.49
  • QF181653
    Faropenem Impurity 53
    CAS# NA
    M.F.: C24H30N2O10S2
    M.W.: 570.63
  • QO022046
    Obeticholic Acid Impurity 46
    CAS# 1516887-32-3
    M.F.: C27H42O4
    M.W.: 430.63
  • QO022045
    Obeticholic Acid Impurity 45
    CAS# NA
    M.F.: C28H48O4Si
    M.W.: 476.77
  • QO022044
    Obeticholic Acid Impurity 44
    CAS# 77341-09-4
    M.F.: C28H48O4Si
    M.W.: 476.77
  • QO022043
    Obeticholic Acid Impurity 43
    CAS# NA
    M.F.: C30H54O4Si2
    M.W.: 534.93
  • QO022042
    Obeticholic Acid Impurity 42
    CAS# 14773-00-3
    M.F.: C25H40O4
    M.W.: 404.59
  • QO022041
    Obeticholic Acid Impurity 41
    CAS# 7753-72-2
    M.F.: C25H38O4
    M.W.: 402.58
  • QP185402
    Prulifloxacin hydrochloride Impurity 2
    CAS# NA
    M.F.: C37H36F2N6O9S2
    M.W.: 810.84
  • QP185401
    Prulifloxacin hydrochloride Impurity 1
    CAS# NA
    M.F.: C16H16FN3O3S
    M.W.: 349.38
  • QS050709
    Selegiline hydrochloride Impurity 9
    CAS# NA
    M.F.: C13H18ClN
    M.W.: 223.74
  • QS050708
    Selegiline hydrochloride Impurity 8
    CAS# NA
    M.F.: C11H17N.HCl
    M.W.: 163.26 36.46
  • QB054800
    Betulinic acid
    CAS# 472-15-1
    M.F.: C30H48O3
    M.W.: 456.71
  • QP1824114
    Parecoxib Sodium Impurity 114
    CAS# NA
    M.F.: C19H18N2O5S
    M.W.: 386.42
  • QP080513
    Phenytoin Sodium Impurity 13
    CAS# NA
    M.F.: C17H14Cl2N2O2
    M.W.: 349.21
  • QR0512104
    Relugolix Impurity 104
    CAS# NA
    M.F.: C29H27F2N7O5S
    M.W.: 623.64
  • QA190218
    L-Isoascorbic acid
    CAS# 26094-91-7
    M.F.: C6H8O6
    M.W.: 176.12
  • QC042044
    Cefditoren pivoxil Impurity 44
    CAS# NA
    M.F.: C26H30N6O8S3
    M.W.: 650.74
  • QA190217
    D-Ascorbic acid
    CAS# 10504-35-5
    M.F.: C6H8O6
    M.W.: 176.12
  • QP052209
    Pentoxyverine hydrogen citrate Impurity 9
    CAS# 5296-89-9
    M.F.: C12H15NO
    M.W.: 189.26
  • QP052208
    Pentoxyverine hydrogen citrate Impurity 8
    CAS# 103-80-0
    M.F.: C8H7ClO
    M.W.: 154.59
  • QP052207
    Pentoxyverine hydrogen citrate Impurity 7
    CAS# 103-81-1
    M.F.: C8H9NO
    M.W.: 135.17
  • QM041853
    Minodronic Acid Impurity 53
    CAS# 21801-86-5
    M.F.: C9H9N3O
    M.W.: 175.19
  • QM041852
    Minodronic Acid Impurity 52
    CAS# 2717-95-5
    M.F.: C10H13N3
    M.W.: 175.24
  • QB210302
    Bucladesine sodium Impurity 2
    CAS# 70253-67-7
    M.F.: C14H17N5NaO7P
    M.W.: 421.28
  • QB210301
    Bucladesine sodium Impurity 1
    CAS# 55443-13-5
    M.F.: C14H17N5NaO7P
    M.W.: 421.28
  • QF151406
    Fondaparinux Sodium Impurity 6
    CAS# 348625-84-3
    M.F.: C13H21NO19S3
    M.W.: 591.48
  • QG122729
    Glycopyrronium Bromide Impurity 29
    CAS# 64471-43-8
    M.F.: C13H16O3
    M.W.: 220.27
  • QD030480
    Diclofenac sodium Impurity 80
    CAS# NA
    M.F.: C13H11Cl2NO2
    M.W.: 284.14
  • QD030481
    Diclofenac sodium Impurity 81
    CAS# NA
    M.F.: C14H7Cl2NO3
    M.W.: 308.11
  • QD030479
    Diclofenac sodium Impurity 79
    CAS# NA
    M.F.: C22H18Cl2N2O4
    M.W.: 445.30
  • QB091302
    Bismuth subcitrate-d8
    CAS# NA
    M.F.: C12H2D8BiK3O14
    M.W.: 712.52
  • QP090339
    Sodium Picosulfate Impurity 39
    CAS# 1122-72-1
    M.F.: C7H7NO
    M.W.: 121.14
  • QD0207110
    Dabigatran Etexilate Impurity 110
    CAS# NA
    M.F.: C21H22N6O2
    M.W.: 390.45
  • QP090338
    Sodium Picosulfate Impurity 38
    CAS# 599-64-4
    M.F.: C15H16O
    M.W.: 212.29
  • QP090337
    Sodium Picosulfate Impurity 37
    CAS# 586-98-1
    M.F.: C6H7NO
    M.W.: 109.13
  • QA181903
    Aristolochic acid C
    CAS# 4849-90-5
    M.F.: C16H9NO7
    M.W.: 327.25
  • QF120377
    Folic Acid Impurity 77
    CAS# NA
    M.F.: C38H40N14O11
    M.W.: 868.83
  • QI142518
    Indocyanine Green Impurity 18
    CAS# 906772-02-9
    M.F.: C18H21NO4S
    M.W.: 347.43
  • QM093100
    Midecamycin Acetate
    CAS# 55881-07-7
    M.F.: C45H71NO17
    M.W.: 898.05
  • QE151701
    Etoposide Phosphate Impurity 1
    CAS# NA
    M.F.: C27H31O16P
    M.W.: 642.50
  • QE151700
    Etoposide Phosphate
    CAS# 117091-64-2
    M.F.: C29H33O16P
    M.W.: 668.54
  • QP010301
    Dehydropachymic acid
    CAS# 77012-31-8
    M.F.: C33H50O6
    M.W.: 542.76
  • QL140338
    Lincomycin Hydrochloride Impurity 38
    CAS# NA
    M.F.: C17H32N2O7
    M.W.: 376.45
  • QL140337
    Lincomycin Hydrochloride Impurity 37
    CAS# NA
    M.F.: C18H34N2O6S
    M.W.: 406.54
  • QC-P181579
    Piscidic acid
    CAS# 469-65-8
    M.F.: C11H12O7
    M.W.: 256.21
  • QP052206
    Pentoxyverine hydrogen citrate Impurity 6
    CAS# 17380-62-0
    M.F.: C12H13ClO
    M.W.: 208.69
  • QT130618
    Tamoxifen Citrate Impurity 18
    CAS# NA
    M.F.: C18H20
    M.W.: 236.36
  • QT031893
    DL-α-Tocopherol acetate
    CAS# 52225-20-4
    M.F.: C31H52O3
    M.W.: 472.75
  • QV3077135
    Vitamin K1 Impurity 135
    CAS# NA
    M.F.: C31H46O4
    M.W.: 482.71
  • QT011509
    Tauroursodeoxycholic Acid Impurity 9
    CAS# NA
    M.F.: C29H51NO6S
    M.W.: 541.79
  • QT011508
    Tauroursodeoxycholic Acid Impurity 8
    CAS# NA
    M.F.: C29H51NO6S
    M.W.: 541.79
  • QT011507
    Tauroursodeoxycholic Acid Impurity 7
    CAS# NA
    M.F.: C29H50N2O10S2
    M.W.: 650.84
  • QT011506
    Tauroursodeoxycholic Acid Impurity 6
    CAS# NA
    M.F.: C29H50N2O10S2
    M.W.: 650.84
  • QT011505
    Tauroursodeoxycholic Acid Impurity 5
    CAS# NA
    M.F.: C27H46O4
    M.W.: 434.66
  • QT011503
    Tauroursodeoxycholic Acid Impurity 3
    CAS# NA
    M.F.: C26H45NO7S
    M.W.: 515.71
  • QA220194
    Avatrombopag Nitroso Impurity 2
    CAS# NA
    M.F.: C8H14N2O3
    M.W.: 186.21
  • QD171225
    Dequalinium chloride Impurity 25
    CAS# NA
    M.F.: C30H39Cl2N3O
    M.W.: 528.56
  • QD171224
    Dequalinium chloride Impurity 24
    CAS# NA
    M.F.: C20H31ClN2O
    M.W.: 350.93
  • QD171223
    Dequalinium chloride Impurity 23
    CAS# NA
    M.F.: C20H17N3
    M.W.: 299.38
  • QD171222
    Dequalinium chloride Impurity 22
    CAS# 27063-27-0
    M.F.: C10H10N2
    M.W.: 158.20
  • QD171221
    Dequalinium chloride Impurity 21
    CAS# NA
    M.F.: C18H18N2O
    M.W.: 278.36
  • QD171220
    Dequalinium chloride Impurity 20
    CAS# NA
    M.F.: C18H16N2O
    M.W.: 276.34
  • QD171219
    Dequalinium chloride Impurity 19
    CAS# NA
    M.F.: C28H26N4O
    M.W.: 434.54
  • QD171218
    Dequalinium chloride Impurity 18
    CAS# 634-47-9
    M.F.: C10H8ClN
    M.W.: 177.63
  • QD171217
    Dequalinium chloride Impurity 17
    CAS# 112-47-0
    M.F.: C10H22O2
    M.W.: 174.28
  • QD171216
    Dequalinium chloride Impurity 16
    CAS# 2162-98-3
    M.F.: C10H20Cl2
    M.W.: 211.17
  • QD171215
    Dequalinium chloride Impurity 15
    CAS# 607-66-9
    M.F.: C10H9NO
    M.W.: 159.19
  • QD171214
    Dequalinium chloride Impurity 14
    CAS# NA
    M.F.: C12H15NO2
    M.W.: 205.26
  • QT022056
    Terbutaline Impurity 56
    CAS# 27628-06-4
    M.F.: C22H20O3
    M.W.: 332.40
  • QB201362
    Betamethasone Acetate Impurity 62
    CAS# 18769-18-1
    M.F.: C24H32O6
    M.W.: 416.51
  • QB180810
    Brompheniramine maleate Impurity 10
    CAS# 18453-10-6
    M.F.: C15H17BrN2
    M.W.: 305.22
  • QC180301
    Carbodenafil Impurity 1
    CAS# 2196244-90-1
    M.F.: C25H34N6OS2
    M.W.: 498.71
  • QN010617
    Nafamostat Impurity 17
    CAS# NA
    M.F.: C10H12N2O2S
    M.W.: 224.28
  • QP092720
    Pinaverium Bromide Impurity 20
    CAS# NA
    M.F.: C26H43Br2NO5
    M.W.: 609.44
  • QP092719
    Pinaverium Bromide Impurity 19
    CAS# NA
    M.F.: C27H44BrNO5
    M.W.: 542.56
  • QS150410
    Alendronic Acid Impurity 10
    CAS# NA
    M.F.: C16H33NO17P2
    M.W.: 573.38
  • QG122124
    Glucuronic acid 3-sulfate
    CAS# 110231-93-1
    M.F.: C6H10O10S
    M.W.: 274.20
  • QG122123
    Glucuronic acid 2-sulfate
    CAS# 98517-62-5
    M.F.: C6H10O10S
    M.W.: 274.20
  • QB030512
    10-Deacetyl-10-Triethylsiloxybaccatin III
    CAS# 207680-15-7
    M.F.: C35H50O10Si
    M.W.: 658.86
  • QB030511
    7-Triethylsilyl-10-Deacetylbaccatin III
    CAS# 115437-18-8
    M.F.: C35H50O10Si
    M.W.: 658.86
  • QB030510
    13-Oxobaccatin III
    CAS# 32981-89-8
    M.F.: C31H36O11
    M.W.: 584.62
  • QU130509
    Umeclidinium bromide Impurity 9
    CAS# 2253743-40-5
    M.F.: C35H38BrNO2
    M.W.: 584.60
  • QU130508
    Umeclidinium bromide Impurity 8
    CAS# 2253743-38-1
    M.F.: C35H38BrNO2
    M.W.: 584.60
  • QU130507
    Umeclidinium bromide Impurity 7
    CAS# 2253743-36-9
    M.F.: C35H38BrNO2
    M.W.: 584.6
  • QT211501
    Taurochenodeoxycholic Acid-2,2,4,4-d4 Sodium Salt
    CAS# 2410279-85-3
    M.F.: C26H40D4NNaO6S
    M.W.: 525.71
  • QF122925
    Fluocinolone acetonide Impurity 25
    CAS# NA
    M.F.: C24H32F2O9S
    M.W.: 534.57
  • QL140336
    Lincomycin Hydrochloride Nitroso Impurity 1
    CAS# NA
    M.F.: C17H31N3O7S
    M.W.: 421.51
  • QS180649
    Sorafenib tosylate Impurity 49
    CAS# 284461-74-1
    M.F.: C20H14ClF3N4O3
    M.W.: 450.80
  • QV3077134
    Vitamin K1 Impurity 134
    CAS# NA
    M.F.: C31H46O2
    M.W.: 450.71
  • QH042511
    Hydrocortisone acetate Impurity 11
    CAS# 50733-54-5
    M.F.: C23H31BrO6
    M.W.: 483.40
  • QB200112
    6-Bromo-betamethasone-17,21-dipropionate
    CAS# 1186048-34-9
    M.F.: C28H36BrFO7
    M.W.: 583.49
  • QC651211
    Cloxacillin Sodium Impurity 11
    CAS# NA
    M.F.: C27H30ClN5O8S2
    M.W.: 652.13
  • QC651210
    Cloxacillin Sodium Impurity 10
    CAS# NA
    M.F.: C38H38Cl2N6O11S2
    M.W.: 889.77
  • QW011829
    Warfarin sodium Impurity 29
    CAS# NA
    M.F.: C18H20O2
    M.W.: 268.36
  • QW011828
    Warfarin sodium Impurity 28
    CAS# NA
    M.F.: C17H16O3
    M.W.: 268.31
  • QW011827
    Warfarin sodium Impurity 27
    CAS# NA
    M.F.: C17H16O3
    M.W.: 268.31
  • QC061916
    Ceftaroline Fosamil Impurity P
    CAS# 54639-48-4
    M.F.: C28H24N2O5S
    M.W.: 500.57
  • QC651209
    Cloxacillin Sodium Impurity 9
    CAS# NA
    M.F.: C13H11ClN2O4
    M.W.: 294.69
  • QC651208
    Cloxacillin Sodium Impurity 8
    CAS# NA
    M.F.: C27H30ClN5O8S2
    M.W.: 652.13
  • QM131933
    Mometasone Furoate Impurity 33
    CAS# 151265-36-0
    M.F.: C22H27ClO3
    M.W.: 374.91
  • QC061875
    Cefuroxime sodium Impurity 75
    CAS# NA
    M.F.: C15H15N3O6S
    M.W.: 365.36
  • QW011826
    Warfarin sodium Impurity 26
    CAS# NA
    M.F.: C35H24O6
    M.W.: 540.57
  • QW011825
    Warfarin sodium Impurity 25
    CAS# NA
    M.F.: C26H20O4
    M.W.: 396.44
  • QW011824
    Warfarin sodium Impurity 24
    CAS# NA
    M.F.: C35H26O7
    M.W.: 558.59
  • QT211204
    Tulathromycin A Impurity 4
    CAS# NA
    M.F.: C29H56N2O9
    M.W.: 576.77
  • QR457061
    Rocuronium bromide Impurity 61
    CAS# NA
    M.F.: C27H44N2O2
    M.W.: 428.66
  • QR457060
    Rocuronium bromide Impurity 60
    CAS# NA
    M.F.: C24H41NO3
    M.W.: 391.60
  • QR457059
    Rocuronium bromide Impurity 59
    CAS# NA
    M.F.: C23H35NO
    M.W.: 341.54
  • QR457058
    Rocuronium bromide Impurity 58
    CAS# NA
    M.F.: C23H35NO2
    M.W.: 357.54
  • QR457057
    Rocuronium bromide Impurity 57
    CAS# NA
    M.F.: C23H35NO2
    M.W.: 357.54
  • QR457056
    Rocuronium bromide Impurity 56
    CAS# NA
    M.F.: C23H37NO2
    M.W.: 359.55
  • QR457055
    Rocuronium bromide Impurity 55
    CAS# NA
    M.F.: C23H37NO2
    M.W.: 359.55
  • QH042510
    Hydrocortisone acetate Impurity 10
    CAS# 33744-76-2
    M.F.: C24H32O7
    M.W.: 432.51
  • QH042509
    Hydrocortisone acetate Impurity 9
    CAS# 115098-60-7
    M.F.: C23H28O5
    M.W.: 384.47
  • QG121823
    Glycyrrhizic Acid Impurity 23
    CAS# NA
    M.F.: C48H74O16
    M.W.: 907.10
  • QG121822
    Glycyrrhizic Acid Impurity 22
    CAS# NA
    M.F.: C46H70O16
    M.W.: 879.05
  • QG121821
    Glycyrrhizic Acid Impurity 21
    CAS# NA
    M.F.: C46H70O16
    M.W.: 879.05
  • QG121820
    Glycyrrhizic Acid Impurity 20
    CAS# NA
    M.F.: C44H66O16
    M.W.: 851.00
  • QG121819
    Glycyrrhizic Acid Impurity 19
    CAS# NA
    M.F.: C44H66O16
    M.W.: 851.00
  • QG121818
    Glycyrrhizic Acid Impurity 18
    CAS# NA
    M.F.: C44H66O16
    M.W.: 851.00
  • QV200110
    5,6-Epoxy Vitamin A Palmitate
    CAS# 3012-64-4
    M.F.: C36H60O3
    M.W.: 540.87
  • QA190216
    Ascorbic Acid Impurity 16
    CAS# NA
    M.F.: C7H10O7
    M.W.: 206.15
  • QB200500
    Bethanechol Chloride
    CAS# 590-63-6
    M.F.: C7H17ClN2O2
    M.W.: 196.68
  • QC010333
    [Ser29-O-Acetyl]Calcitonin (salmon)
    CAS# NA
    M.F.: C147H242N44O49S2
    M.W.: 3473.93
  • QC010332
    [Ser13-O-Acetyl]Calcitonin (salmon)
    CAS# NA
    M.F.: C147H242N44O49S2
    M.W.: 3473.93
  • QC010331
    [Ser5-O-Acetyl]Calcitonin (salmon)
    CAS# NA
    M.F.: C147H242N44O49S2
    M.W.: 3473.93
  • QC010330
    [Ser2-O-Acetyl]Calcitonin (salmon)
    CAS# NA
    M.F.: C147H242N44O49S2
    M.W.: 3473.93
  • QC010329
    [Asp26]Calcitonin (salmon)
    CAS# NA
    M.F.: C145H239N43O49S2
    M.W.: 3432.88
  • QC010328
    [Asp3]Calcitonin (salmon)
    CAS# NA
    M.F.: C145H239N43O49S2
    M.W.: 3432.88
  • QC010327
    [Glu14]Calcitonin (salmon)
    CAS# NA
    M.F.: C145H239N43O49S2
    M.W.: 3432.88
  • QN151878
    Noradrenaline (Norepinephrine) Impurity 78
    CAS# NA
    M.F.: C17H17NO4
    M.W.: 299.33
  • QN151877
    Noradrenaline (Norepinephrine) Impurity 77
    CAS# NA
    M.F.: C17H21NO4
    M.W.: 303.36
  • QO022040
    Obeticholic Acid Impurity 40
    CAS# 1834605-28-5
    M.F.: C26H40O4
    M.W.: 416.60
  • QC031645
    Cefcapene pivoxil Impurity 45
    CAS# NA
    M.F.: C47H58N10O16S4
    M.W.: 1147.28
  • QC031644
    Cefcapene pivoxil Impurity 44
    CAS# NA
    M.F.: C32H38N8O12S3
    M.W.: 822.88
  • QC031643
    Cefcapene pivoxil Impurity 43
    CAS# NA
    M.F.: C28H37N5O9S2
    M.W.: 651.75
  • QF120376
    Folic Acid Impurity 76
    CAS# NA
    M.F.: C21H27N7O6
    M.W.: 473.49
  • QD122065
    Dolutegravir Impurity 65
    CAS# NA
    M.F.: C17H14F2N2O6
    M.W.: 380.30
  • QE191837
    Estradiol Valerate Impurity 37
    CAS# 182624-54-0
    M.F.: C23H32O3
    M.W.: 356.50
  • QM050113
    Metamizole sodium Impurity 13
    CAS# NA
    M.F.: C13H19N3O7S2
    M.W.: 393.43
  • QF061340
    Fosfomycin Trometamol Impurity 40
    CAS# 2489782-66-1
    M.F.: C5H13O5P
    M.W.: 184.13
  • QA180267
    Arbidol Impurity 67
    CAS# 40945-79-7
    M.F.: C15H17NO4
    M.W.: 275.30
  • QO022039
    Obeticholic Acid Impurity 39
    CAS# 462122-38-9
    M.F.: C27H44O4
    M.W.: 432.65
  • QO022038
    Obeticholic Acid Impurity 38
    CAS# 863239-59-2
    M.F.: C27H42O4
    M.W.: 430.63
  • QP180806
    Pralidoxime Iodide Impurity 6
    CAS# 873-69-8
    M.F.: C6H6N2O
    M.W.: 122.13
  • QP180805
    Pralidoxime Iodide Impurity 5
    CAS# 3785-03-3
    M.F.: C7H7IN2
    M.W.: 246.05
  • QP180804
    Pralidoxime Iodide Impurity 4
    CAS# 3313-51-7
    M.F.: C7H10INO
    M.W.: 251.07
  • QP180803
    Pralidoxime Iodide Impurity 3
    CAS# 3784-97-2
    M.F.: C7H8INO
    M.W.: 249.05
  • QP180802
    Pralidoxime Iodide Impurity 2
    CAS# 45750-74-1(cation form)
    M.F.: C7H9IN2O
    M.W.: 264.07
  • QP180801
    Pralidoxime Iodide Impurity 1
    CAS# 694-85-9
    M.F.: C6H7NO
    M.W.: 109.13
  • QP186303
    (E)-Pralidoxime Chloride
    CAS# 14018-50-9
    M.F.: C7H9ClN2O
    M.W.: 172.61
  • QP186302
    (Z)-Pralidoxime Chloride
    CAS# 13698-37-8
    M.F.: C7H9ClN2O
    M.W.: 172.61
  • QP186300
    Pralidoxime Chloride
    CAS# 51-15-0
    M.F.: C7H9ClN2O
    M.W.: 172.61
  • QP186301
    Pralidoxime Chloride Impurity 1
    CAS# 3697-38-9
    M.F.: C7H8ClNO2
    M.W.: 173.60
  • QP180800
    Pralidoxime Iodide
    CAS# 94-63-3
    M.F.: C7H9IN2O
    M.W.: 264.07
  • QP052205
    Pentoxyverine hydrogen citrate Impurity 5
    CAS# 4535-96-0
    M.F.: C13H16O2
    M.W.: 204.27
  • QP052204
    Pentoxyverine hydrogen citrate Impurity 4
    CAS# 1421930-96-2
    M.F.: C18H27NO3
    M.W.: 305.42
  • QP052203
    Pentoxyverine hydrogen citrate Impurity 3
    CAS# NA
    M.F.: C16H21ClO3
    M.W.: 296.79
  • QP052202
    Pentoxyverine hydrogen citrate Impurity 2
    CAS# 1378312-51-6
    M.F.: C16H23NO
    M.W.: 245.37
  • QS221207
    Sivelestat sodium Impurity G
    CAS# NA
    M.F.: C20H22N2O7S
    M.W.: 434.46
  • QC052013
    Cetrorelix Impurity 13
    CAS# NA
    M.F.: C72H94ClN17O15
    M.W.: 1473.10
  • QS150409
    Alendronic Acid Impurity 9
    CAS# NA
    M.F.: C4H13NO8P2
    M.W.: 265.09
  • QF120375
    Folic Acid Impurity 75
    CAS# 31690-08-1;301298-88-4(Ca salt)
    M.F.: C20H25N7O6
    M.W.: 459.46
  • QL051518
    Calcium Levofolinate Nitroso Impurity 2
    CAS# NA
    M.F.: C21H23N7O8
    M.W.: 501.46
  • QL051517
    Calcium Levofolinate Nitroso Impurity 1
    CAS# NA
    M.F.: C20H22N8O8
    M.W.: 502.44
  • QL252032
    Lysine aspirin Impurity 32
    CAS# NA
    M.F.: C15H20N2O5
    M.W.: 308.33
  • QC022035
    Cabazitaxel Impurity 35
    CAS# 949459-78-3
    M.F.: C22H25NO6
    M.W.: 399.44
  • QF061339
    Fosfomycin Trometamol Impurity 39
    CAS# 76274-77-6
    M.F.: C3H9O4P
    M.W.: 140.07
  • QF061338
    Fosfomycin Trometamol Impurity 38
    CAS# 53621-85-5
    M.F.: C3H9O4P
    M.W.: 140.07
  • QF061337
    Fosfomycin Trometamol Impurity 37
    CAS# NA
    M.F.: C11H23O3P
    M.W.: 234.28
  • QH042453
    Hydroxychloroquine sulfate Impurity 53
    CAS# NA
    M.F.: C20H30ClN3O
    M.W.: 363.93
  • QH042452
    Hydroxychloroquine sulfate Impurity 52
    CAS# NA
    M.F.: C20H30ClN3O
    M.W.: 363.93
  • QE201634
    Ertapenem Impurity 34
    CAS# NA
    M.F.: C44H48N6O13S2
    M.W.: 933.02
  • QH042451
    Hydroxychloroquine sulfate Impurity 51
    CAS# 4203-18-3
    M.F.: C9H5Cl2N
    M.W.: 198.05
  • QH042450
    Hydroxychloroquine sulfate Impurity 50
    CAS# 23432-43-1
    M.F.: C9H6ClNO
    M.W.: 179.6
  • QH042449
    Hydroxychloroquine sulfate Impurity 49
    CAS# 57797-97-4
    M.F.: C9H6ClNO
    M.W.: 179.60
  • QN151876
    Noradrenaline (Norepinephrine) Impurity 76
    CAS# NA
    M.F.: C9H13NO6S
    M.W.: 263.26
  • QI091642
    Ipratropium Bromide Impurity 42
    CAS# NA
    M.F.: C18H25NO3
    M.W.: 303.40
  • QI091641
    Ipratropium Bromide Impurity 41
    CAS# NA
    M.F.: C18H23NO3
    M.W.: 301.39
  • QI091640
    Ipratropium Bromide Impurity 40
    CAS# NA
    M.F.: C19H25NO4
    M.W.: 331.41
  • QL051302
    Folinic Acid Impurity 2
    CAS# NA
    M.F.: C15H18N6O3
    M.W.: 330.35
  • QV051834
    Verapamil Impurity 34
    CAS# 114847-42-6
    M.F.: C26H36N2O4
    M.W.: 440.58
  • QF090570
    Finerenone Impurity 70
    CAS# NA
    M.F.: C25H26N4O4
    M.W.: 446.51
  • QG121817
    Glycyrrhizic Acid Impurity 17
    CAS# NA
    M.F.: C44H64O18
    M.W.: 880.98
  • QG121816
    Glycyrrhizic Acid Impurity 16
    CAS# 2270962-44-0
    M.F.: C44H66O16
    M.W.: 851.00
  • QB050434
    Bedaquiline Fumarate Impurity 34
    CAS# 1972612-60-4+857086-94-3
    M.F.: C32H31BrN2O2
    M.W.: 555.50
  • QB050433
    Bedaquiline Fumarate Impurity 33
    CAS# NA
    M.F.: C32H29BrN2O
    M.W.: 537.50
  • QG121815
    Glycyrrhizic Acid Impurity 15
    CAS# NA
    M.F.: C45H68O16
    M.W.: 865.02
  • QG121814
    Glycyrrhizic Acid Impurity 14
    CAS# NA
    M.F.: C45H68O16
    M.W.: 865.02
  • QG121813
    Glycyrrhizic Acid Impurity 13
    CAS# NA
    M.F.: C42H62O17
    M.W.: 838.94
  • QG121812
    Glycyrrhizic Acid Impurity 12
    CAS# NA
    M.F.: C42H62O17
    M.W.: 838.94
  • QG121811
    Glycyrrhizic Acid Impurity 11
    CAS# 2919137-39-4
    M.F.: C42H62O17
    M.W.: 838.94
  • QI142517
    Indocyanine Green Impurity 17
    CAS# 63450-66-8
    M.F.: C32H34N2O4S
    M.W.: 542.69
  • QI142516
    Indocyanine Green Impurity 16
    CAS# 41532-84-7
    M.F.: C15H15N
    M.W.: 209.29
  • QL251101
    (+)-Lyoniresinol 3α-O-β-D-glucopyranoside
    CAS# 87585-32-8
    M.F.: C28H38O13
    M.W.: 582.60
  • QB050432
    Bedaquiline Fumarate Impurity 32
    CAS# 2443970-23-6;2443970-24-7(HCl salt)
    M.F.: C16H17NO
    M.W.: 239.32
  • QP156702
    Poricoic acid B
    CAS# 137551-39-4
    M.F.: C30H44O5
    M.W.: 484.68
  • QE161264
    Epalrestat Nitroso Impurity 1
    CAS# NA
    M.F.: C2H4N2O3
    M.W.: 104.07
  • QE161263
    Epalrestat Impurity 63
    CAS# 39486-57-2
    M.F.: C5H6N2O2S2
    M.W.: 190.24
  • QD0207109
    Dabigatran Etexilate Impurity 109
    CAS# 2498-50-2
    M.F.: C7H9N3.2HCl
    M.W.: 135.17 72.92
  • QD0207108
    Dabigatran Etexilate Impurity 108
    CAS# 1416446-45-1
    M.F.: C33H39N7O5
    M.W.: 613.72
  • QD0207107
    Dabigatran Etexilate Impurity 107
    CAS# 1349500-09-9
    M.F.: C35H43N7O5
    M.W.: 641.77
  • QZ151216
    Zoledronic acid Impurity 16
    CAS# NA
    M.F.: C16H32N2O17P2
    M.W.: 586.38
  • QR241236
    Ruxolitinib Impurity 36
    CAS# NA
    M.F.: C22H26N6O2
    M.W.: 406.49
  • QD0207106
    Dabigatran Etexilate Impurity 106
    CAS# 1354892-78-6
    M.F.: C29H32N6O4
    M.W.: 528.61
  • QR457054
    Rocuronium bromide Impurity 54
    CAS# NA
    M.F.: C32H53BrN2O4
    M.W.: 609.69
  • QD030478
    Diclofenac sodium Impurity 78
    CAS# NA
    M.F.: C17H17Cl2NO3
    M.W.: 354.23
  • QC061452
    Cefdinir Impurity 52
    CAS# NA
    M.F.: C7H8N4O3S
    M.W.: 228.23
  • QM050112
    Metamizole sodium Impurity 12
    CAS# 92569-10-3
    M.F.: C12H15N3O3
    M.W.: 249.27
  • QL1412170
    Lenalidomide Impurity 170
    CAS# 220514-28-3
    M.F.: C9H8BrNO4
    M.W.: 274.07
  • QC120211
    Clobetasol Propionate Impurity 11
    CAS# 59860-99-0
    M.F.: C22H27FO4
    M.W.: 374.45
  • QP081868
    Phloroglucinol Impurity 68
    CAS# NA
    M.F.: C10H8O6
    M.W.: 224.17
  • QC062148
    Ceftazidime Impurity 48
    CAS# 86299-47-0
    M.F.: C13H19N3O5S
    M.W.: 329.37
  • QU180138
    Urapidil Nitroso Impurity 1
    CAS# 2219339-64-5
    M.F.: C11H15N3O2
    M.W.: 221.26
  • QP092106
    Primaquine Diphosphate Nitroso Impurity 2
    CAS# NA
    M.F.: C15H20N4O2
    M.W.: 288.35
  • QP092105
    Primaquine Diphosphate Nitroso Impurity 1
    CAS# NA
    M.F.: C15H20N4O2
    M.W.: 288.35
  • QO130201
    N-Nitroso Omidenepag Isopropyl
    CAS# NA
    M.F.: C26H27N7O5S
    M.W.: 549.61
  • QO130200
    Omidenepag Isopropyl
    CAS# 1187451-19-9
    M.F.: C26H28N6O4S
    M.W.: 520.61
  • QL010101
    (E)-Latanoprostene Bunod
    CAS# 2099033-66-4
    M.F.: C27H41NO8
    M.W.: 507.62
  • QM161852
    Metoprolol Impurity 52
    CAS# NA
    M.F.: C12H19NO3
    M.W.: 225.29
  • QM030501
    N-Nitroso Meclofenamic acid
    CAS# NA
    M.F.: C14H10Cl2N2O3
    M.W.: 325.15
  • QM030500
    Meclofenamic acid
    CAS# 644-62-2
    M.F.: C14H11Cl2NO2
    M.W.: 296.15
  • QP1824113
    Parecoxib Sodium Impurity 113
    CAS# 2242749-02-4
    M.F.: C19H18N2O4S
    M.W.: 370.42
  • QM201850
    Metaraminol Impurity 50
    CAS# NA
    M.F.: C13H17NO7
    M.W.: 299.28
  • QR052004
    3,4-Didehydroretinoic acid
    CAS# 4159-20-0
    M.F.: C20H26O2
    M.W.: 298.43
  • QI210102
    Ivacaftor Nitroso Impurity 2
    CAS# NA
    M.F.: C24H27N3O4
    M.W.: 421.50
  • QB180809
    Brompheniramine maleate Impurity 9
    CAS# NA
    M.F.: C16H19BrN2O2
    M.W.: 351.24
  • QB180808
    Brompheniramine maleate Impurity 8
    CAS# NA
    M.F.: C16H19BrN2O
    M.W.: 335.25
  • QT081303
    11-Dehydro Thromboxane B2
    CAS# 67910-12-7
    M.F.: C20H32O6
    M.W.: 368.47
  • QI142515
    Indocyanine Green Impurity 15
    CAS# NA
    M.F.: C24H26NNaO4S
    M.W.: 447.52
  • QI142514
    Indocyanine Green Impurity 14
    CAS# NA
    M.F.: C86H92N4Na2O12S4
    M.W.: 1547.92
  • QI142513
    Indocyanine Green Impurity 13
    CAS# NA
    M.F.: C30H32N2O3S
    M.W.: 500.66
  • QU121609
    N-Nitroso N-Desmethyl Ulipristal Acetate
    CAS# NA
    M.F.: C29H34N2O5
    M.W.: 490.60
  • QI142512
    Indocyanine Green Impurity 12
    CAS# 17432-66-5
    M.F.: C11H11NO
    M.W.: 173.22
  • QP010402
    N-Nitroso N-Desmethyl Padimate O
    CAS# NA
    M.F.: C16H24N2O3
    M.W.: 292.38
  • QO181459
    Ornidazole Impurity 59
    CAS# 13551-86-5
    M.F.: C6H8ClN3O3
    M.W.: 205.60
  • QM182504
    Maropitant Citrate Impurity 4
    CAS# 142035-23-2
    M.F.: C20H24N2
    M.W.: 292.43
  • QM182503
    Maropitant Citrate Impurity 3
    CAS# 155681-48-4
    M.F.: C27H30N2
    M.W.: 382.55
  • QM200516
    N-Nitroso N-Desmethyl Methylene Blue
    CAS# NA
    M.F.: C15H15ClN4OS
    M.W.: 334.82
  • QM013301
    N-Nitroso N-Desmethyl Maralixibat chloride
    CAS# NA
    M.F.: C39H53ClN4O5S
    M.W.: 725.39
  • QM013300
    Maralixibat chloride
    CAS# 228113-66-4
    M.F.: C40H56ClN3O4S
    M.W.: 710.42
  • QE182059
    N-Nitroso N-Desmethyl Erythromycin Ethylsuccinate
    CAS# NA
    M.F.: C42H72N2O17
    M.W.: 877.04
  • QD0207105
    N-Nitroso Dabigatran Etexilate
    CAS# 2892260-29-4
    M.F.: C34H40N8O6
    M.W.: 656.74
  • QB054701
    Berotralstat Nitroso Impurity 1
    CAS# NA
    M.F.: C30H25F4N7O2
    M.W.: 591.57
  • QP051706
    Pentamidine diisetionate Impurity 6
    CAS# NA
    M.F.: C19H22N2O4
    M.W.: 342.40
  • QP051705
    Pentamidine diisetionate Impurity 5
    CAS# NA
    M.F.: C21H26N2O4
    M.W.: 370.45
  • QP051704
    Pentamidine diisetionate Impurity 4
    CAS# 1252-44-4
    M.F.: C23H30N2O4
    M.W.: 398.50
  • QP051703
    Pentamidine diisetionate Impurity 3
    CAS# 7467-71-2
    M.F.: C19H18N2O2
    M.W.: 306.37
  • QP051702
    Pentamidine diisetionate Impurity 2
    CAS# 91945-01-6
    M.F.: C12H14BrNO
    M.W.: 268.15
  • QP120207
    Polymyxin B Sulfate
    CAS# 1405-20-5
    M.F.: C56H98N16O13.H2O4S
    M.W.: 1203.50 36.46
  • QB200111
    Betamethasone Dipropionate Impurity 11
    CAS# NA
    M.F.: C28H37FO7
    M.W.: 504.60
  • QP156701
    Poricoic acid A
    CAS# 137551-38-3
    M.F.: C31H46O5
    M.W.: 498.70
  • QA260507
    Azelnidipine Impurity 7
    CAS# NA
    M.F.: C33H34N4O7
    M.W.: 598.66
  • QF181958
    Furosemide Impurity 58
    CAS# 4818-85-3
    M.F.: C12H12N2O5S
    M.W.: 296.30
  • QG042424
    Gadoxetate Disodium Impurity 24
    CAS# NA
    M.F.: C21H26GdN3O8
    M.W.: 605.70
  • QG042423
    Gadoxetate Disodium Impurity 23
    CAS# NA
    M.F.: C21H26GdN3O8
    M.W.: 605.70
  • QM142425
    Minoxidil Impurity 25
    CAS# 1637646-87-7
    M.F.: C5H11NO2
    M.W.: 117.15
  • QT260433
    Trazodone hydrochloride Impurity 33
    CAS# NA
    M.F.: C40H46Cl2N10O2
    M.W.: 769.78
  • QF121946
    Fulvestrant Impurity 46
    CAS# 96045-13-5
    M.F.: C14H31BrOSi
    M.W.: 323.39
  • QV3077131
    Vitamin K1 Impurity 131
    CAS# NA
    M.F.: C31H46O3
    M.W.: 466.71
  • QV200109
    all-trans-Retinyl Stearate
    CAS# 631-87-8
    M.F.: C38H64O2
    M.W.: 552.93
  • QM092218
    Mivacurium chloride Impurity 18
    CAS# NA
    M.F.: C25H36ClNO6
    M.W.: 482.01
  • QV3077130
    Vitamin K1 Impurity 130
    CAS# 102608-53-7
    M.F.: C20H40O
    M.W.: 296.54
  • QT142600
    Tanshinone IIA
    CAS# 568-72-9
    M.F.: C19H18O3
    M.W.: 294.35
  • QS041924
    Sodium Valproate Impurity 24
    CAS# 6967-47-1
    M.F.: C8H13NO2
    M.W.: 155.20
  • QC042043
    Cefditoren pivoxil Impurity 43
    CAS# NA
    M.F.: C25H28N6O8S3
    M.W.: 636.71
  • QP090336
    Sodium Picosulfate Impurity 36
    CAS# NA
    M.F.: C19H15NNa2O8S2
    M.W.: 495.43
  • QC061620
    Cefpodoxime Proxetil Impurity 20
    CAS# NA
    M.F.: C44H56N10O18S4
    M.W.: 1141.22
  • QP132619
    Promethazine Nitroso Impurity 1
    CAS# NA
    M.F.: C3H7NO2
    M.W.: 89.09
  • QV3077129
    Vitamin K1 Impurity 129
    CAS# NA
    M.F.: C31H44O2
    M.W.: 448.69
  • QV3077128
    Vitamin K1 Impurity 128
    CAS# NA
    M.F.: C31H44O2
    M.W.: 448.69
  • QC061874
    Cefuroxime sodium Impurity 74
    CAS# NA
    M.F.: C16H18N4O9S
    M.W.: 442.40
  • QN151875
    Noradrenaline (Norepinephrine) Impurity 75
    CAS# NA
    M.F.: C16H19NO6
    M.W.: 321.33
  • QN151874
    Noradrenaline (Norepinephrine) Impurity 74
    CAS# NA
    M.F.: C16H19NO6
    M.W.: 321.33
  • QN151873
    Noradrenaline (Norepinephrine) Impurity 73
    CAS# NA
    M.F.: C16H15NO6
    M.W.: 317.30
  • QN151872
    Noradrenaline (Norepinephrine) Impurity 72
    CAS# NA
    M.F.: C16H15NO6
    M.W.: 317.30
  • QF061336
    Fosfomycin Trometamol Impurity 36
    CAS# NA
    M.F.: C7H15O4P
    M.W.: 194.17
  • QF061335
    Fosfomycin Trometamol Impurity 35
    CAS# NA
    M.F.: C3H6ClO3P
    M.W.: 156.5
  • QP093300
    Pipecuronium Bromide
    CAS# 52212-02-9
    M.F.: C35H62Br2N4O4
    M.W.: 762.71
  • QB053225
    Beraprost Impurity 25
    CAS# NA
    M.F.: C24H29NaO5
    M.W.: 420.48
  • QF061334
    Fosfomycin Trometamol Impurity 34
    CAS# NA
    M.F.: C5H11O4P
    M.W.: 166.11
  • QF061333
    Fosfomycin Trometamol Impurity 33
    CAS# 433979-70-5
    M.F.: C6H7O4P
    M.W.: 174.09
  • QF061332
    Fosfomycin Trometamol Impurity 32
    CAS# 1416734-33-2
    M.F.: C6H14O8P2
    M.W.: 276.12
  • QF061331
    Fosfomycin Trometamol Impurity 31
    CAS# NA
    M.F.: C3H6ClO3P
    M.W.: 156.50
  • QF061330
    Fosfomycin Trometamol Impurity 30
    CAS# 856609-47-7
    M.F.: C6H7O3P
    M.W.: 158.09
  • QV3077127
    Vitamin K1 Impurity 127
    CAS# NA
    M.F.: C20H40
    M.W.: 280.54
  • QV3077126
    Vitamin K1 Impurity 126
    CAS# NA
    M.F.: C20H40
    M.W.: 280.54
  • QF061329
    Fosfomycin Trometamol Impurity 29
    CAS# NA
    M.F.: C3H5O3P
    M.W.: 120.04
  • QF061328
    Fosfomycin Trometamol Impurity 28
    CAS# 55343-62-9
    M.F.: C3H5O4P
    M.W.: 136.04
  • QF061327
    Fosfomycin Trometamol Impurity 27
    CAS# NA
    M.F.: C11H18NO4P
    M.W.: 259.24
  • QM150925
    Morinidazole Impurity 25
    CAS# NA
    M.F.: C15H25N5O4
    M.W.: 339.40
  • QE191347
    Esmolol Impurity 47
    CAS# NA
    M.F.: C16H14O5
    M.W.: 286.28
  • QE191346
    Esmolol Impurity 46
    CAS# 69098-04-0
    M.F.: C9H10O4
    M.W.: 182.18
  • QB191635
    Bisoprolol Impurity 35
    CAS# NA
    M.F.: C10H12O3
    M.W.: 180.20
  • QP092718
    Pinaverium Bromide Impurity 18
    CAS# NA
    M.F.: C9H9Br3O2
    M.W.: 388.88
  • QA190215
    6-O-Acetylascorbic acid
    CAS# 20229-76-9
    M.F.: C8H10O7
    M.W.: 218.16
  • QM131932
    Mometasone Furoate Impurity 32
    CAS# NA
    M.F.: C32H32Cl2O8
    M.W.: 615.50
  • QC031642
    Cefcapene pivoxil Impurity 42
    CAS# NA
    M.F.: C27H37N5O8S2
    M.W.: 623.74
  • QO120501
    Oleanolic acid 3-acetate
    CAS# 4339-72-4
    M.F.: C32H50O4
    M.W.: 498.75
  • QA130253
    Ambroxol Impurity 53
    CAS# NA
    M.F.: C7H5Br2NO
    M.W.: 278.93
  • QT142429
    Tranexamic Acid Impurity 29
    CAS# 23358-95-4
    M.F.: C16H22O6
    M.W.: 310.35
  • QH150923
    Hyoscine Butylbromide Impurity 23
    CAS# NA
    M.F.: C19H25NO4
    M.W.: 331.41
  • QA200376
    Cisatracurium Besylate Impurity 76
    CAS# 1075727-00-2
    M.F.: C34H45NO9S
    M.W.: 643.79
  • QA200375
    Cisatracurium Besylate Impurity 75
    CAS# NA
    M.F.: C32H41NO9S
    M.W.: 615.74
  • QT260432
    Trazodone hydrochloride Impurity 32
    CAS# 1781591-94-3
    M.F.: C6H4ClN3O
    M.W.: 169.57
  • QT260431
    Trazodone hydrochloride Impurity 31
    CAS# 333988-45-7
    M.F.: C9H11Cl2N.HCl
    M.W.: 204.09 36.46
  • QA031616
    Acipimox Impurity 16
    CAS# 6890-38-6
    M.F.: C6H8N2O2
    M.W.: 140.14
  • QC-C990198
    Controlled Substance
    (Trazodone hydrochloride EP Impurity L)

    CAS# 6640-24-0
    M.F.: C10H13ClN2
    M.W.: 196.68
  • QM092217
    Mivacurium chloride Impurity 17
    CAS# NA
    M.F.: C61H86Cl2N2O15
    M.W.: 1158.26
  • QC-C121541
    Coenzyme A
    CAS# 85-61-0
    M.F.: C21H36N7O16P3S
    M.W.: 767.53
  • QM161850
    Metoprolol Impurity 50
    CAS# NA
    M.F.: C15H23NO2
    M.W.: 249.35
  • QB030509
    7,10-Bis[O-(triethylsilyl)]-10-deacetyl Baccatin III
    CAS# 149107-84-6
    M.F.: C41H64O10Si2
    M.W.: 773.12
  • QI040167
    Indacaterol Impurity 67
    CAS# NA
    M.F.: C13H14F3NO
    M.W.: 257.26
  • QB050430
    Bedaquiline Fumarate Impurity 30
    CAS# NA
    M.F.: C28H20BrNO2
    M.W.: 482.38
  • QD150307
    Docusate sodium Impurity 7
    CAS# NA
    M.F.: C12H21NaO7S
    M.W.: 332.34
  • QD150306
    Docusate sodium Impurity 6
    CAS# 29454-16-8
    M.F.: C4H5NaO7S
    M.W.: 220.13
  • QB030508
    Baccatin III Impurity 8
    CAS# NA
    M.F.: C79H76N2O18
    M.W.: 1341.47
  • QB030507
    Baccatin III Impurity 7
    CAS# NA
    M.F.: C35H42O13
    M.W.: 670.71
  • QB030506
    Baccatin III Impurity 6
    CAS# NA
    M.F.: C39H54O12Si
    M.W.: 742.93
  • QB030505
    Baccatin III Impurity 5
    CAS# NA
    M.F.: C43H66O11Si2
    M.W.: 815.16
  • QB030504
    Baccatin III Impurity 4
    CAS# NA
    M.F.: C39H54O12Si
    M.W.: 742.93
  • QB030503
    7,10,13-tris(triethylsilyl)-10-deacetylbaccatin III
    CAS# 194720-19-9
    M.F.: C47H78O10Si3
    M.W.: 887.39
  • QO1920149
    Oseltamivir Impurity 149
    CAS# NA
    M.F.: C25H42N2O4
    M.W.: 434.62
  • QT691559
    Testosterone Undecanoate Impurity 59
    CAS# NA
    M.F.: C30H46O3
    M.W.: 454.70
  • QE192701
    Estetrol Impurity 1
    CAS# 1426679-35-7
    M.F.: C25H30O4
    M.W.: 394.51
  • QB051334
    Bempedoic acid Impurity 34
    CAS# NA
    M.F.: C10H18O3
    M.W.: 186.25
  • QB051333
    Bempedoic acid Impurity 33
    CAS# NA
    M.F.: C13H26O3
    M.W.: 230.35
  • QC132675
    Cefmetazole sodium Impurity 75
    CAS# NA
    M.F.: C15H17N7O6S3
    M.W.: 487.52
  • QC132674
    Cefmetazole sodium Impurity 74
    CAS# NA
    M.F.: C14H15N7O5S3
    M.W.: 457.50
  • QF030344
    Famciclovir Impurity 44
    CAS# NA
    M.F.: C14H19N5O5
    M.W.: 337.34
  • QM201849
    Metaraminol Impurity 49
    CAS# NA
    M.F.: C15H22ClNO3
    M.W.: 299.80
  • QA182301
    Artemisinic Aldehyde
    CAS# 125276-60-0
    M.F.: C15H22O
    M.W.: 218.34
  • QM050111
    Metamizole sodium Impurity 11
    CAS# NA
    M.F.: C13H15N3O
    M.W.: 229.28
  • QO240122
    Oxacillin sodium Impurity 22
    CAS# 91059-01-7
    M.F.: C11H7Cl2NO2
    M.W.: 256.08
  • QO240121
    Oxacillin sodium Impurity 21
    CAS# 1598387-74-6
    M.F.: C11H7Cl2NO2
    M.W.: 256.08
  • QO240120
    Oxacillin sodium Impurity 20
    CAS# NA
    M.F.: C11H7Cl2NO2
    M.W.: 256.08
  • QO240119
    Oxacillin sodium Impurity 19
    CAS# 1143-82-4
    M.F.: C13H13NO3
    M.W.: 231.25
  • QS041923
    Sodium Valproate Impurity 23
    CAS# 1085698-06-1
    M.F.: C11H20O4
    M.W.: 216.28
  • QD171213
    Dequalinium chloride Impurity 13
    CAS# NA
    M.F.: C20H30Cl2N2
    M.W.: 369.37
  • QD171212
    Dequalinium chloride Impurity 12
    CAS# 77726-78-4
    M.F.: C10H12N2O
    M.W.: 176.22
  • QC081350
    Calcitriol Impurity 50
    CAS# NA
    M.F.: C27H44O3
    M.W.: 416.65
  • QA161893
    Aprepitant Impurity 93
    CAS# NA
    M.F.: C20H18F7NO2
    M.W.: 437.36
  • QG124602
    Glycine Nitroso Impurity 2
    CAS# 25081-31-6
    M.F.: C4H6N2O5
    M.W.: 162.10
  • QT211203
    Tulathromycin A Impurity 3
    CAS# NA
    M.F.: C41H81N3O13
    M.W.: 824.11
  • QA163046
    Apremilast Impurity 46
    CAS# NA
    M.F.: C12H17NO4S
    M.W.: 271.33
  • QP092717
    Pinaverium Bromide Impurity 17
    CAS# NA
    M.F.: C26H41Br2NO4
    M.W.: 591.43
  • QM050110
    Metamizole sodium Impurity 10
    CAS# NA
    M.F.: C12H15N3O2
    M.W.: 233.27
  • QM050109
    Metamizole sodium Nitroso Impurity 2
    CAS# NA
    M.F.: C12H14N4O5S
    M.W.: 326.33
  • QM050108
    Metamizole sodium Impurity 8
    CAS# 62902-13-0
    M.F.: C13H17N3O2
    M.W.: 247.30
  • QU190452
    Ursodeoxycholic Acid Impurity 52
    CAS# 73465-45-9
    M.F.: C25H42O4
    M.W.: 406.61
  • QP081866
    Phloroglucinol Impurity 66
    CAS# NA
    M.F.: C18H14O9
    M.W.: 374.30
  • QA030613
    N-Nitroso Aceclofenac
    CAS# NA
    M.F.: C16H12Cl2N2O5
    M.W.: 383.18
  • QF151500
    Fospropofol disodium
    CAS# 258516-87-9;258516-89-1(free acid)
    M.F.: C13H19Na2O5P
    M.W.: 332.24
  • QD150228
    Dobutamine Impurity 28
    CAS# NA
    M.F.: C16H21NO4
    M.W.: 291.35
  • QD150227
    Dobutamine Impurity 27
    CAS# NA
    M.F.: C18H23NO4
    M.W.: 317.39
  • QC013700
    Catharanthine sulfate
    CAS# 70674-90-7
    M.F.: C21H24N2O2.H2O4S
    M.W.: 336.44 98.07
  • QP090335
    Sodium Picosulfate Impurity 35
    CAS# NA
    M.F.: C30H24N2O3
    M.W.: 460.53
  • QG211208
    Sodium Gualenate Impurity 8
    CAS# 24687-72-7
    M.F.: C15H16O2
    M.W.: 228.29
  • QG211207
    Sodium Gualenate Impurity 7
    CAS# NA
    M.F.: C15H16O
    M.W.: 212.29
  • QG211206
    Sodium Gualenate Impurity 6
    CAS# NA
    M.F.: C15H17NaO3S
    M.W.: 300.35
  • QC031641
    Cefcapene pivoxil Impurity 41
    CAS# NA
    M.F.: C55H61N13O16S6
    M.W.: 1352.53
  • QC031640
    Cefcapene pivoxil Impurity 40
    CAS# NA
    M.F.: C16H18N4O5S2
    M.W.: 410.46
  • QE160512
    Eperisone Impurity 12
    CAS# NA
    M.F.: C19H29NO.HCl
    M.W.: 287.45 36.46
  • QF090533
    Finerenone Impurity 33
    CAS# NA
    M.F.: C26H23N3O4
    M.W.: 441.49
  • QU160116
    Upadacitinib Impurity 16
    CAS# NA
    M.F.: C29H29N5O4S
    M.W.: 543.64
  • QZ121631
    Zolpidem tartrate Impurity 31
    CAS# 258273-50-6
    M.F.: C18H18N2O2
    M.W.: 294.35
  • QZ121630
    Zolpidem tartrate Impurity 30
    CAS# NA
    M.F.: C18H18N2O3
    M.W.: 310.35
  • QB141700
    Benztropine Mesylate
    CAS# 132-17-2
    M.F.: C21H25NO.CH4O3S
    M.W.: 307.44 96.10
  • QB050429
    Bedaquiline Fumarate Impurity 29
    CAS# NA
    M.F.: C32H31BrN2O3
    M.W.: 571.52
  • QU181201
    Urolithin A
    CAS# 1143-70-0
    M.F.: C13H8O4
    M.W.: 228.20
  • QK200321
    Ketoconazole Impurity 21
    CAS# 29098-85-9
    M.F.: C12H7Cl3O2
    M.W.: 289.54
  • QH040325
    Hydrocortisone Impurity 25
    CAS# NA
    M.F.: C25H36O7
    M.W.: 448.56
  • QR457053
    Rocuronium bromide Impurity 53
    CAS# NA
    M.F.: C23H39NO3
    M.W.: 377.57
  • QR457052
    Rocuronium bromide Impurity 52
    CAS# NA
    M.F.: C32H52N2O4
    M.W.: 528.78
  • QR457051
    Rocuronium bromide Impurity 51
    CAS# NA
    M.F.: C32H53BrN2O4
    M.W.: 609.69
  • QR457050
    Rocuronium bromide Impurity 50
    CAS# NA
    M.F.: C32H51BrN2O3
    M.W.: 591.68
  • QR457049
    Rocuronium bromide Impurity 49
    CAS# NA
    M.F.: C32H51BrN2O3
    M.W.: 591.68
  • QD152613
    7-Ketodeoxycholic acid
    CAS# 911-40-0
    M.F.: C24H38O5
    M.W.: 406.56
  • QC061450
    Cefdinir Impurity 50
    CAS# NA
    M.F.: C42H39N15O15S6
    M.W.: 1186.22
  • QR182484
    Brexpiprazole Impurity 84
    CAS# 2190474-85-0
    M.F.: C50H54N6O4S2
    M.W.: 867.14
  • QF051300
    Fenoldopam Mesylate
    CAS# 67227-57-0;67227-56-9(free base)
    M.F.: C16H16ClNO3.CH4O3S
    M.W.: 305.76 96.10
  • QC052009
    Cetrorelix Impurity 9
    CAS# NA
    M.F.: C64H80ClN13O13
    M.W.: 1274.87
  • QL091687
    Lipoic Acid Impurity 87
    CAS# NA
    M.F.: C8H14O3S2
    M.W.: 222.32
  • QV3077125
    Vitamin K1 Impurity 125
    CAS# NA
    M.F.: C31H46O3
    M.W.: 466.71
  • QR190800
    Ro 19-8022
    CAS# 104604-66-2
    M.F.: C25H21ClN2O3
    M.W.: 432.90
  • QC0303142
    Cinacalcet Impurity 142
    CAS# 27557-86-4
    M.F.: C13H15N
    M.W.: 185.27
  • QM092216
    Mivacurium chloride Impurity 16
    CAS# NA
    M.F.: C36H51Cl2NO9
    M.W.: 712.70
  • QM092215
    Mivacurium chloride Impurity 15
    CAS# 104758-49-8
    M.F.: C22H29NO5
    M.W.: 387.48
  • QM092214
    Mivacurium chloride Impurity 14
    CAS# NA
    M.F.: C14H22Cl2O4
    M.W.: 325.23
  • QM092213
    Mivacurium chloride Impurity 13
    CAS# 48059-97-8
    M.F.: C8H12O4
    M.W.: 172.18
  • QI142510
    Indocyanine Green Impurity 10
    CAS# 52568-84-0
    M.F.: C15H15N
    M.W.: 209.29
  • QI142511
    Indocyanine Green Impurity 11
    CAS# NA
    M.F.: C43H47N2NaO6S2
    M.W.: 774.97
  • QI142509
    Indocyanine Green Impurity 9
    CAS# 20893-80-5
    M.F.: C10H7ClN2
    M.W.: 190.63
  • QN162446
    (+/-)-Naproxen D3
    CAS# 958293-79-3
    M.F.: C14H11D3O3
    M.W.: 233.28
  • QF121613
    Flupentixol Impurity 13
    CAS# NA
    M.F.: C19H20F3NO2S
    M.W.: 383.43
  • QS210309
    Sucrose Octasulfate Octatriethylamine Salt
    CAS# 869561-07-9
    M.F.: C12H22O35S8.8C6H15N
    M.W.: 982.75 8(101.19)
  • QG122546
    Glycopyrrolate-d5 Bromide
    CAS# NA
    M.F.: C19H23D5BrNO3
    M.W.: 403.37
  • QO240118
    Oxacillin sodium Impurity 18
    CAS# NA
    M.F.: C19H19N3O5S
    M.W.: 401.44
  • QV051402
    Venetoclax Impurity 2
    CAS# 2254393-29-6;1235865-77-6(free base)
    M.F.: C33H35ClN4O3.HCl
    M.W.: 571.12 36.46
  • QG121926
    Granisetron Impurity 26
    CAS# NA
    M.F.: C15H11ClN2O2
    M.W.: 286.72
  • QT260430
    Trazodone hydrochloride Impurity 30
    CAS# NA
    M.F.: C40H46Cl2N10O2
    M.W.: 769.78
  • QP081307
    Phentolamine Mesylate Impurity 7
    CAS# NA
    M.F.: C15H15NO3
    M.W.: 257.29
  • QP081306
    Phentolamine Mesylate Impurity 6
    CAS# NA
    M.F.: C18H21N3O3S
    M.W.: 359.44
  • QO022037
    Obeticholic Acid Impurity 37
    CAS# NA
    M.F.: C30H52O4
    M.W.: 476.74
  • QO022036
    Obeticholic Acid Impurity 36
    CAS# NA
    M.F.: C28H48O4
    M.W.: 448.69
  • QO022035
    Obeticholic Acid Impurity 35
    CAS# 951694-73-8
    M.F.: C27H46O4
    M.W.: 434.66
  • QC031639
    Cefcapene pivoxil Impurity 39
    CAS# NA
    M.F.: C28H37N5O10S2
    M.W.: 667.75
  • QO1920140
    Oseltamivir Impurity 140
    CAS# NA
    M.F.: C22H32N2O9
    M.W.: 468.50
  • QC031638
    Cefcapene pivoxil Impurity 38
    CAS# NA
    M.F.: C14H20N2O4S
    M.W.: 312.38
  • QC031637
    Cefcapene pivoxil Impurity 37
    CAS# NA
    M.F.: C24H31N5O9S2
    M.W.: 597.66
  • QC031636
    Cefcapene pivoxil Impurity 36
    CAS# NA
    M.F.: C28H37N5O9S2
    M.W.: 651.75
  • QC031635
    Cefcapene pivoxil Impurity 35
    CAS# NA
    M.F.: C22H28N4O6S2
    M.W.: 508.61
  • QC031634
    Cefcapene pivoxil Impurity 34
    CAS# NA
    M.F.: C28H37N5O10S2
    M.W.: 667.75
  • QC031633
    Cefcapene pivoxil Impurity 33
    CAS# NA
    M.F.: C29H39N5O11S2
    M.W.: 697.78
  • QC031632
    Cefcapene pivoxil Impurity 32
    CAS# NA
    M.F.: C33H45N5O11S2
    M.W.: 751.87
  • QC031631
    Cefcapene pivoxil Impurity 31
    CAS# NA
    M.F.: C21H24N4O6S2
    M.W.: 492.57
  • QC031630
    Cefcapene pivoxil Impurity 30
    CAS# NA
    M.F.: C19H28N2O6S
    M.W.: 412.50
  • QC031629
    Cefcapene pivoxil Impurity 29
    CAS# NA
    M.F.: C14H20N2O6S
    M.W.: 344.38
  • QC031628
    Cefcapene pivoxil Impurity 28
    CAS# NA
    M.F.: C27H36N4O9S2
    M.W.: 624.72
  • QC031627
    Cefcapene pivoxil Impurity 27
    CAS# NA
    M.F.: C27H36N4O8S2
    M.W.: 608.73
  • QC031626
    Cefcapene pivoxil Impurity 26
    CAS# NA
    M.F.: C29H38N4O10S2
    M.W.: 666.76
  • QC031625
    Cefcapene pivoxil Impurity 25
    CAS# NA
    M.F.: C29H39N5O10S2
    M.W.: 681.78
  • QC031624
    Cefcapene pivoxil Impurity 24
    CAS# NA
    M.F.: C21H26N4O7S2
    M.W.: 510.58
  • QC031623
    Cefcapene pivoxil Impurity 23
    CAS# NA
    M.F.: C21H26N4O6S2
    M.W.: 494.58
  • QC031622
    Cefcapene pivoxil Impurity 22
    CAS# NA
    M.F.: C23H28N4O8S2
    M.W.: 552.62
  • QC031621
    Cefcapene pivoxil Impurity 21
    CAS# NA
    M.F.: C22H27N5O8S2
    M.W.: 553.61
  • QC031620
    Cefcapene pivoxil Impurity 20
    CAS# NA
    M.F.: C14H20N2O4S
    M.W.: 312.38
  • QC031619
    Cefcapene pivoxil Impurity 19
    CAS# NA
    M.F.: C9H12N2O2S
    M.W.: 212.27
  • QP072051
    Pioglitazone hydrochloride Impurity 51
    CAS# NA
    M.F.: C19H23NO3S
    M.W.: 345.46
  • QP072050
    Pioglitazone hydrochloride Impurity 50
    CAS# NA
    M.F.: C18H22N2O2S
    M.W.: 330.45
  • QO240117
    Oxacillin sodium Impurity 17
    CAS# NA
    M.F.: C38H38N6O10S2
    M.W.: 802.87
  • QO240116
    Oxacillin sodium Impurity 16
    CAS# NA
    M.F.: C38H40N6O11S2
    M.W.: 820.89
  • QO240115
    Oxacillin sodium Impurity 15
    CAS# NA
    M.F.: C38H38N6O10S2
    M.W.: 802.87
  • QP092716
    Pinaverium Bromide Impurity 16
    CAS# NA
    M.F.: C12H17BrO3
    M.W.: 289.17
  • QP092715
    Pinaverium Bromide Impurity 15
    CAS# 3647-69-6;3240-94-6(free base)
    M.F.: C6H12ClNO.HCl
    M.W.: 149.62 36.46
  • QP092714
    Pinaverium Bromide Impurity 14
    CAS# 4747-61-9
    M.F.: C11H20O
    M.W.: 168.28
  • QP092713
    Pinaverium Bromide Impurity 13
    CAS# 54370-01-3
    M.F.: C9H10BrClO2
    M.W.: 265.53
  • QP092712
    Pinaverium Bromide Impurity 12
    CAS# 1185300-68-8
    M.F.: C13H20N2O2.2HCl
    M.W.: 236.32 72.92
  • QD122059
    Dolutegravir Impurity 59
    CAS# 2583719-60-0
    M.F.: C14H16N2O6
    M.W.: 308.29
  • QB050300D
    Beclometasone Dipropionate Monohydrate
    CAS# 77011-63-3
    M.F.: C28H37ClO7.H2O
    M.W.: 521.05 18.02
  • QF121705
    Flumetasone pivalate Impurity 5
    CAS# NA
    M.F.: C27H36F2O6
    M.W.: 494.58
  • QF211505
    Fluocortolone pivalate Impurity 5
    CAS# NA
    M.F.: C27H37FO5
    M.W.: 460.59
  • QH150922
    Hyoscine Butylbromide Impurity 22
    CAS# NA
    M.F.: C12H22BrNO2
    M.W.: 292.22
  • QH150921
    Hyoscine Butylbromide Impurity 21
    CAS# NA
    M.F.: C12H22BrNO2
    M.W.: 292.22
  • QV3077123
    Vitamin K1 Impurity 123
    CAS# 25486-55-9
    M.F.: C31H46O3
    M.W.: 466.71
  • QC061873
    Cefuroxime sodium Impurity 73
    CAS# 84522-17-8
    M.F.: C6H5NO3
    M.W.: 139.11
  • QU190451
    7β-Hydroxy-5β-cholanoic Acid
    CAS# 10601-78-2
    M.F.: C24H40O3
    M.W.: 376.58
  • QC061872
    Cefuroxime sodium Impurity 72
    CAS# NA
    M.F.: C15H13N3O8S
    M.W.: 395.34
  • QN051521
    Neostigmine bromide Impurity 21
    CAS# NA
    M.F.: C26H33N3O3
    M.W.: 435.57
  • QN051520
    Neostigmine bromide Impurity 20
    CAS# 63468-95-1
    M.F.: C17H22N2O2
    M.W.: 286.38
  • QS213100
    Suplatast Tosylate
    CAS# 94055-76-2
    M.F.: C23H33NO7S2
    M.W.: 499.64
  • QL091686
    Lipoic Acid Impurity 86
    CAS# NA
    M.F.: C24H44O6S6
    M.W.: 620.97
  • QL091685
    Lipoic Acid Impurity 85
    CAS# NA
    M.F.: C24H44O6S6
    M.W.: 620.97
  • QL091684
    Lipoic Acid Impurity 84
    CAS# NA
    M.F.: C16H30O4S4
    M.W.: 414.65
  • QR091219
    Riluzole Impurity 19
    CAS# NA
    M.F.: C16H6F6N4O2S2
    M.W.: 464.36
  • QC031618
    Cefcapene pivoxil Impurity 18
    CAS# NA
    M.F.: C16H16N4O4S2
    M.W.: 392.45
  • QL092601
    Dimethyl lithospermate B
    CAS# 875313-64-7
    M.F.: C38H34O16
    M.W.: 746.67
  • QD098400
    Difluocortolone Valerate
    CAS# 59198-70-8
    M.F.: C27H36F2O5
    M.W.: 478.58
  • QF012227
    Favipiravir Impurity 27
    CAS# 55321-99-8;1237524-82-1(Na salt)
    M.F.: C5H5N3O2
    M.W.: 139.11
  • QC031617
    Cefcapene pivoxil Impurity 17
    CAS# 86978-24-7
    M.F.: C13H18N2O4S
    M.W.: 298.36
  • QS150408
    Alendronic Acid Impurity 8
    CAS# 457942-40-4
    M.F.: C11H13NO4
    M.W.: 223.23
  • QS150407
    Alendronic Acid Impurity 7
    CAS# NA
    M.F.: C11H17NO9P2
    M.W.: 369.20
  • QS150406
    Alendronic Acid Impurity 6
    CAS# NA
    M.F.: C12H19NO9P2
    M.W.: 383.23
  • QS150405
    Alendronic Acid Impurity 5
    CAS# NA
    M.F.: C14H23NO9P2
    M.W.: 411.28
  • QA190214
    Ascorbic Acid 3-Sulfate
    CAS# 22430-27-9
    M.F.: C6H8O9S
    M.W.: 256.18
  • QA555935
    Adenosine 3'-monophosphate
    CAS# 84-21-9
    M.F.: C10H14N5O7P
    M.W.: 347.22
  • QA130509
    Aminolevulinic Acid Impurity 9
    CAS# NA
    M.F.: C12H16N2O4
    M.W.: 252.27
  • QA130508
    Aminolevulinic Acid Impurity 8
    CAS# NA
    M.F.: C11H14N2O4
    M.W.: 238.24
  • QA130507
    Aminolevulinic Acid Impurity 7
    CAS# NA
    M.F.: C15H18N2O7
    M.W.: 338.32
  • QA130506
    Aminolevulinic Acid Impurity 6
    CAS# 56766-77-9
    M.F.: C6H10O4
    M.W.: 146.14
  • QA130505
    Aminolevulinic Acid Impurity 5
    CAS# NA
    M.F.: C10H16N2O5
    M.W.: 244.25
  • QV011233
    Valproic acid-d15
    CAS# 362049-65-8
    M.F.: C8HD15O2
    M.W.: 159.31
  • QI191659
    Isoproterenol Impurity 59
    CAS# NA
    M.F.: C11H11NO3
    M.W.: 205.21
  • QC031616
    Cefcapene pivoxil Impurity 16
    CAS# 118109-49-2
    M.F.: C8H10N2O2S
    M.W.: 198.24
  • QC031615
    Cefcapene pivoxil Impurity 15
    CAS# 159860-40-9
    M.F.: C13H18N2O4S
    M.W.: 298.36
  • QP092711
    Pinaverium Bromide Impurity 11
    CAS# NA
    M.F.: C26H41Br2NO4
    M.W.: 591.43
  • QC042042
    Cefditoren pivoxil Impurity 42
    CAS# NA
    M.F.: C31H40N6O10S3
    M.W.: 752.87
  • QP181924
    Prasugrel Impurity X
    CAS# 1373350-57-2
    M.F.: C11H11Br2FO
    M.W.: 338.01
  • QD098200
    Diffractaic acid
    CAS# 436-32-8
    M.F.: C20H22O7
    M.W.: 374.39
  • QB052522
    Benzylpenicillin sodium Impurity 22
    CAS# NA
    M.F.: C32H36N4O8S2
    M.W.: 668.78
  • QB053218
    Beraprost Impurity 18
    CAS# 132203-90-8
    M.F.: C17H22O5
    M.W.: 306.36
  • QV3077122
    Vitamin K1 Impurity 122
    CAS# NA
    M.F.: C31H46O2
    M.W.: 450.71
  • QV3077121
    Vitamin K1 Impurity 121
    CAS# NA
    M.F.: C31H46O2
    M.W.: 450.71
  • QV3077120
    Vitamin K1 Impurity 120
    CAS# NA
    M.F.: C31H46O2
    M.W.: 450.71
  • QV3077119
    Vitamin K1 Impurity 119
    CAS# 132487-93-5
    M.F.: C31H46O2
    M.W.: 450.71
  • QV3077118
    Vitamin K1 Impurity 118
    CAS# 132487-94-6
    M.F.: C31H46O2
    M.W.: 450.71
  • QV3077117
    Vitamin K1 Impurity 117
    CAS# 132487-95-7
    M.F.: C31H46O2
    M.W.: 450.71
  • QB011534
    Baloxavir Impurity 34
    CAS# NA
    M.F.: C27H23F2N3O7S
    M.W.: 571.55
  • QO240114
    Oxacillin sodium Impurity 14
    CAS# NA
    M.F.: C19H19N3O5S
    M.W.: 401.44
  • QF052004
    Fenticonazole nitrate EP Impurity D
    CAS# NA
    M.F.: C24H21Cl2N3O4S
    M.W.: 518.41
  • QM182502
    Maropitant Citrate Impurity 2
    CAS# NA
    M.F.: C32H40N2O
    M.W.: 468.69
  • QP090334
    Sodium Picosulfate Impurity 34
    CAS# 2563-78-2
    M.F.: C12H10N2O2
    M.W.: 214.22
  • QV3077115
    Vitamin K1 Impurity 115
    CAS# 1637238-61-9
    M.F.: C20H39Br
    M.W.: 359.44
  • QV3077114
    Vitamin K1 Impurity 114
    CAS# NA
    M.F.: C21H20O2
    M.W.: 304.39
  • QV3077113
    Vitamin K1 Impurity 113
    CAS# 108977-34-0
    M.F.: C20H18O2
    M.W.: 290.36
  • QV3077112
    Vitamin K1 Impurity 112
    CAS# 943232-38-0
    M.F.: C20H39Br
    M.W.: 359.44
  • QB051332
    Bempedoic acid Impurity 5-d4
    CAS# 2408132-01-2
    M.F.: C19H30D4O5
    M.W.: 346.50
  • QC016600
    Carotegrast methyl
    CAS# 401905-67-7
    M.F.: C28H26Cl2N4O5
    M.W.: 569.44
  • QB051331
    Bempedoic acid-d4
    CAS# 2408131-70-2
    M.F.: C19H32D4O5
    M.W.: 348.52
  • QT031892
    Vitamin E Impurity 92
    CAS# NA
    M.F.: C31H52O3
    M.W.: 472.75
  • QM050107
    Metamizole sodium Impurity 7
    CAS# NA
    M.F.: C13H17N3O7S2
    M.W.: 391.41
  • QO022034
    Obeticholic Acid Impurity 34
    CAS# 1516887-34-5
    M.F.: C26H40O4
    M.W.: 416.60
  • QP181265
    Prucalopride Impurity 65
    CAS# NA
    M.F.: C16H14Cl2N2O6
    M.W.: 401.20
  • QT180508
    Trametinib Impurity 8
    CAS# 871701-87-0
    M.F.: C24H21FIN5O3
    M.W.: 573.37
  • QC131434
    Cefminox Sodium Impurity 34
    CAS# NA
    M.F.: C12H12Cl2N6O4S2
    M.W.: 439.29
  • QV3077111
    Vitamin B6 Impurity 111
    CAS# 765235-25-4;122776-03-8(HCl salt)
    M.F.: C10H15NO3
    M.W.: 197.23
  • QO200910
    Otilonium Bromide Impurity 10
    CAS# NA
    M.F.: C33H51BrN2O4
    M.W.: 619.69
  • QO200909
    Otilonium Bromide Impurity 9
    CAS# NA
    M.F.: C32H49BrN2O4
    M.W.: 605.66
  • QO200908
    Otilonium Bromide Impurity 8
    CAS# NA
    M.F.: C31H47BrN2O4
    M.W.: 591.63
  • QO200907
    Otilonium Bromide Impurity 7
    CAS# NA
    M.F.: C30H45BrN2O4
    M.W.: 577.60
  • QO200906
    Otilonium Bromide Impurity 6
    CAS# 49557-33-7
    M.F.: C28H41BrN2O4
    M.W.: 549.55
  • QO200905
    Otilonium Bromide Impurity 5
    CAS# NA
    M.F.: C27H39BrN2O4
    M.W.: 535.52
  • QO200904
    Otilonium Bromide Impurity 4
    CAS# NA
    M.F.: C26H37BrN2O4
    M.W.: 521.50
  • QO200903
    Otilonium Bromide Impurity 3
    CAS# NA
    M.F.: C25H35BrN2O4
    M.W.: 507.47
  • QO200902
    Otilonium Bromide Impurity 2
    CAS# 27830-12-2
    M.F.: C15H22O3
    M.W.: 250.34
  • QO200901
    Otilonium Bromide Impurity 1
    CAS# 51444-79-2
    M.F.: C22H27NO4
    M.W.: 369.46
  • QE191827
    Estradiol Enantate
    CAS# 4956-37-0
    M.F.: C25H36O3
    M.W.: 384.56
  • QF120606
    Flomoxef Impurity 6
    CAS# NA
    M.F.: C27H30F4N8O13S3
    M.W.: 846.75
  • QA132457
    Amoxicillin Impurity 57
    CAS# NA
    M.F.: C15H21N3O4S
    M.W.: 339.41
  • QO032808
    Octreotide EP Impurity I;N2.1-acetyloctreotide
    CAS# NA
    M.F.: C51H68N10O11S2
    M.W.: 1061.28
  • QI242625
    MLN-9708
    CAS# 1201902-80-8
    M.F.: C20H23BCl2N2O9
    M.W.: 517.12
  • QB011529
    Baloxavir Impurity 29
    CAS# NA
    M.F.: C26H19F2N3O8S
    M.W.: 571.51
  • QB031811
    Bromocriptine mesilate Impurity 11
    CAS# 157135-98-3
    M.F.: C33H42BrN5O5
    M.W.: 668.63
  • QB031810
    Bromocriptine mesilate Impurity 10
    CAS# NA
    M.F.: C64H79BrN10O10
    M.W.: 1228.30
  • QB031809
    Bromocriptine mesilate Impurity 9
    CAS# NA
    M.F.: C32H40ClN5O5
    M.W.: 610.15
  • QS0102133
    Salbutamol Impurity 133
    CAS# NA
    M.F.: C9H7BrO3
    M.W.: 243.06
  • QD053702
    anti-Dechlorane Plus
    CAS# 135821-74-8
    M.F.: C18H12Cl12
    M.W.: 653.69
  • QD053701
    syn-Dechlorane Plus
    CAS# 135821-03-3
    M.F.: C18H12Cl12
    M.W.: 653.69
  • QD053700
    Dechlorane Plus
    CAS# 13560-89-9
    M.F.: C18H12Cl12
    M.W.: 653.69
  • QC121924
    Cilastatin EP Impurity G(epimer 2)
    CAS# NA
    M.F.: C16H26N2O5S
    M.W.: 358.45
  • QG040501
    Gadobenate Dimeglumine Impurity 1
    CAS# NA
    M.F.: C12H19N3O7
    M.W.: 317.30
  • QF132047
    Formoterol Impurity 47
    CAS# 871266-45-4
    M.F.: C15H12ClNO4
    M.W.: 305.71
  • QC191701
    Cisplatin EP Impurity A
    CAS# 14913-33-8
    M.F.: Cl2H6N2Pt
    M.W.: 300.05
  • QD151915
    Calcium Dobesilate Impurity 15
    CAS# 609-46-1
    M.F.: C6H6O4S
    M.W.: 174.17
  • QD151914
    Calcium Dobesilate Impurity 14
    CAS# 35857-70-6;2446301-91-1(diethylamine salt)
    M.F.: C6H6O5S
    M.W.: 190.17
  • QD151913
    Calcium Dobesilate Impurity 13
    CAS# 17724-11-7;2446301-90-0(Bis-diethylamine salt)
    M.F.: C6H6O8S2
    M.W.: 270.23
  • QD151912
    Calcium Dobesilate Impurity 12
    CAS# 81010-88-0
    M.F.: C6H6O8S2
    M.W.: 270.23
  • QH150920
    Hyoscine Butylbromide Impurity 20
    CAS# NA
    M.F.: C12H22BrNO2
    M.W.: 292.22
  • QA164192
    Avanafil Impurity 92
    CAS# NA
    M.F.: C23H30ClN5O4
    M.W.: 475.97
  • QC042041
    Cefditoren pivoxil Impurity 41
    CAS# NA
    M.F.: C31H38N6O9S3
    M.W.: 734.86
  • QC042040
    Cefditoren pivoxil Impurity 40
    CAS# NA
    M.F.: C31H40N6O10S3
    M.W.: 752.87
  • QC042039
    Cefditoren pivoxil Impurity 39
    CAS# NA
    M.F.: C50H56N12O14S6
    M.W.: 1241.43
  • QC042038
    Cefditoren pivoxil Impurity 38
    CAS# NA
    M.F.: C25H28N6O7S3
    M.W.: 620.71
  • QG042422
    Gadoxetate Disodium Impurity 22
    CAS# NA
    M.F.: C41H69N3O11
    M.W.: 780.01
  • QG042421
    Gadoxetate Disodium Impurity 21
    CAS# NA
    M.F.: C37H63N3O9
    M.W.: 693.92
  • QG042420
    Gadoxetate Disodium Impurity 20
    CAS# NA
    M.F.: C27H41N3O11
    M.W.: 583.64
  • QA201627
    Nortropinone
    CAS# 5632-84-8
    M.F.: C7H11NO
    M.W.: 125.17
  • QV3077110
    Vitamin K1 Impurity 110
    CAS# 85761-30-4
    M.F.: C20H42O
    M.W.: 298.56
  • QV3077109
    Vitamin K1 Impurity 109
    CAS# 29171-23-1
    M.F.: C20H38O
    M.W.: 294.52
  • QV3077108
    Vitamin K1 Impurity 108
    CAS# NA
    M.F.: C31H50O2
    M.W.: 454.74
  • QV3077107
    Vitamin K1 Impurity 107
    CAS# 859974-92-8
    M.F.: C19H38O
    M.W.: 282.51
  • QI142508
    Indocyanine Green Impurity 8
    CAS# NA
    M.F.: C43H48N2O7S2
    M.W.: 768.98
  • QI142507
    Indocyanine Green Impurity 7
    CAS# NA
    M.F.: C13H13NO2
    M.W.: 215.25
  • QE161255
    Epalrestat Impurity 55
    CAS# 149789-77-5
    M.F.: C6H7NO3S2
    M.W.: 205.25
  • QS012601
    Salvianolic acid Y
    CAS# 1638738-76-7
    M.F.: C36H30O16
    M.W.: 718.62
  • QP186000
    Prednienic acid
    CAS# 37927-29-0
    M.F.: C20H26O5
    M.W.: 346.42
  • QT151235
    Tolvaptan Impurity 35
    CAS# NA
    M.F.: C18H18N2O2
    M.W.: 294.35
  • QT151225
    Tolvaptan Impurity 25
    CAS# 54620-98-3
    M.F.: C20H21NO5S
    M.W.: 387.45
  • QB152100
    alpha-Boswellic acid
    CAS# 471-66-9
    M.F.: C30H48O3
    M.W.: 456.71
  • QD152612
    Deoxycholic Acid-d5
    CAS# 52840-14-9
    M.F.: C24H35D5O4
    M.W.: 397.61
  • QE201006
    Ethacridine lactate monohydrate Impurity 6
    CAS# NA
    M.F.: C15H13N3O3.HCl
    M.W.: 283.29 36.46
  • QE201005
    Ethacridine lactate monohydrate Impurity 5
    CAS# 20304-69-2
    M.F.: C15H11ClN2O3
    M.W.: 302.71
  • QD151636
    Dopamine Impurity 36
    CAS# 1519015-73-6
    M.F.: C20H22N2O6
    M.W.: 386.40
  • QR051264
    Relugolix Impurity 64
    CAS# NA
    M.F.: C23H19F2N3O5S
    M.W.: 487.48
  • QP180522
    Prilocaine Impurity 22
    CAS# 780037-66-3;677029-53-7(HCl salt)
    M.F.: C15H22N2O
    M.W.: 246.35
  • QP081854
    Phloroglucinol Impurity 54
    CAS# NA
    M.F.: C12H8O8
    M.W.: 280.19
  • QG122728
    Glycopyrronium Bromide Impurity 28
    CAS# 207856-85-7
    M.F.: C18H25NO3
    M.W.: 303.40
  • QP1903200
    Posaconazole Impurity 200
    CAS# NA
    M.F.: C13H20N2O3
    M.W.: 252.31
  • QD030475
    Diclofenac sodium Impurity 75
    CAS# 944251-06-3
    M.F.: C14H11Cl2NO3
    M.W.: 312.15
  • QG121505
    Glycocholic Acid Impurity 5
    CAS# NA
    M.F.: C30H50N2O7
    M.W.: 550.74
  • QV3077106
    Vitamin K1 Impurity 106
    CAS# 2211-27-0
    M.F.: C13H12O3
    M.W.: 216.24
  • QV3077105
    Vitamin K1 Impurity 105
    CAS# 15448-59-6
    M.F.: C11H8O3
    M.W.: 188.18
  • QI091639
    Ipratropium Bromide Impurity 39
    CAS# 259092-15-4
    M.F.: C10H19NO
    M.W.: 169.27
  • QF120374
    Folic Acid Impurity 74
    CAS# NA
    M.F.: C31H31N9O10
    M.W.: 689.64
  • QF122924
    Fluocinolone acetonide Impurity 24
    CAS# NA
    M.F.: C19H22F2O4
    M.W.: 352.38
  • QF122923
    Fluocinolone acetonide Impurity 23
    CAS# NA
    M.F.: C24H28F2O6
    M.W.: 450.48
  • QB054400
    Betulonic acid
    CAS# 4481-62-3
    M.F.: C30H46O3
    M.W.: 454.70
  • QN090500
    Nifekalant hydrochloride
    CAS# 130656-51-8
    M.F.: C19H27N5O5.HCl
    M.W.: 405.46 36.46
  • QD030474
    Diclofenac sodium Impurity 74
    CAS# NA
    M.F.: C14H12Cl3N
    M.W.: 300.61
  • QC061871
    Cefuroxime sodium Impurity 71
    CAS# NA
    M.F.: C14H13N3O7S
    M.W.: 367.33
  • QD030473
    Diclofenac sodium Impurity 73
    CAS# NA
    M.F.: C14H12Cl3N
    M.W.: 300.61
  • QC182711
    Sodium Cromoglicate Impurity 11
    CAS# 16130-28-2
    M.F.: C11H12O4
    M.W.: 208.21
  • QL051516
    Calcium levofolinate Impurity 16
    CAS# NA
    M.F.: C20H25CaN7O6
    M.W.: 499.54
  • QI190902
    Taurolithocholic acid
    CAS# 516-90-5
    M.F.: C26H45NO5S
    M.W.: 483.71
  • QI190901
    Tauroursodeoxycholic Acid Impurity 4
    CAS# 75808-01-4
    M.F.: C26H43NO6S
    M.W.: 497.69
  • QD0207103
    Dabigatran Etexilate Impurity 103
    CAS# NA
    M.F.: C41H53N7O7
    M.W.: 755.92
  • QG120600
    Glatiramer acetate
    CAS# 147245-92-9
    M.F.: C25H45N5O13
    M.W.: 623.66
  • QC182710
    Sodium Cromoglicate Impurity 10
    CAS# 3361-18-0
    M.F.: C11H14O5
    M.W.: 226.23
  • QC182709
    Sodium Cromoglicate Impurity 9
    CAS# 50521-64-7
    M.F.: C12H10O5
    M.W.: 234.21
  • QD092500
    Dihydrostreptomycin sulfate
    CAS# 5490-27-7;128-46-1(free base)
    M.F.: 2(C21H41N7O12).3(H2SO4)
    M.W.: 2(583.60) 3(98.07)
  • QA161889
    Aprepitant Impurity 89
    CAS# NA
    M.F.: C10H8F6O
    M.W.: 258.16
  • QR182476
    Brexpiprazole Impurity 76
    CAS# 2126178-13-8
    M.F.: C20H18N2S2
    M.W.: 350.50
  • QH091901
    Histamine Diphosphate
    CAS# 51-74-1
    M.F.: C5H9N3.2H3O4P
    M.W.: 111.15 195.99
  • QI141400
    Inosinic acid
    CAS# 131-99-7;4691-65-0(2Na salt);
    20813-76-7(2Na salt 8H2O)
    M.F.: C10H13N4O8P
    M.W.: 348.21
  • QC061915
    Ceftaroline Fosamil Impurity O
    CAS# NA
    M.F.: C22H20N8O5S4
    M.W.: 604.69
  • QL252900
    LY-2940094 tartrate
    CAS# 1307245-87-9
    M.F.: C22H23ClF2N4O2S.C4H6O6
    M.W.: 480.96 150.09
  • QC220900
    Cevidoplenib dimesylate
    CAS# 2043659-93-2
    M.F.: C25H27N7O3.2CH4O3S
    M.W.: 473.54 192.20
  • QD095000
    Didemnin B
    CAS# 77327-05-0
    M.F.: C57H89N7O15
    M.W.: 1112.37
  • QN221700
    NVR 3-778
    CAS# 1445790-55-5
    M.F.: C18H16F4N2O4S
    M.W.: 432.39
  • QB181800
    Brr2 Inhibitor C9
    CAS# 2104030-82-0
    M.F.: C24H20N4O3S
    M.W.: 444.51
  • QG141800
    GnRH antagonist 2
    CAS# 1709823-61-9
    M.F.: C28H27F2N9O5
    M.W.: 607.58
  • QS203100
    STING inhibitor-2
    CAS# 2249435-90-1
    M.F.: C25H19FN2O4S
    M.W.: 462.50
  • QC182708
    Sodium Cromoglicate Impurity 8
    CAS# NA
    M.F.: C19H16O9
    M.W.: 388.33
  • QC182707
    Sodium Cromoglicate Impurity 7
    CAS# NA
    M.F.: C20H16O10
    M.W.: 416.34
  • QC182706
    Sodium Cromoglicate Impurity 6
    CAS# 802857-44-9
    M.F.: C13H12O7
    M.W.: 280.23
  • QA141900
    Ansamitocin P-3
    CAS# 66584-72-3
    M.F.: C32H43ClN2O9
    M.W.: 635.15
  • QY021900
    Y-29794 Tosylate
    CAS# 143984-17-2
    M.F.: C23H34N2OS2.C7H8O3S
    M.W.: 418.66 172.20
  • QO241100
    3-Oxo-4,6-choladien-24-oic acid
    CAS# 88179-71-9
    M.F.: C24H34O3
    M.W.: 370.53
  • QI200200
    IT1t Dihydrochloride
    CAS# 1092776-63-0
    M.F.: C21H34N4S2.2HCl
    M.W.: 406.65 72.92
  • QG141101
    Ginkgolide B
    CAS# 15291-77-7
    M.F.: C20H24O10
    M.W.: 424.40
  • QD010600
    DAF-2 DA
    CAS# 205391-02-2
    M.F.: C24H18N2O7
    M.W.: 446.42
  • QA124300
    Alvespimycin Hydrochloride
    CAS# 467214-21-7
    M.F.: C32H48N4O8.HCl
    M.W.: 616.76 36.46
  • QA122100
    Allura Red AC
    CAS# 25956-17-6
    M.F.: C18H14N2Na2O8S2
    M.W.: 496.42
  • QF120373
    Folic Acid Nitroso Impurity 1
    CAS# 26360-21-4
    M.F.: C19H18N8O7
    M.W.: 470.40
  • QE081800
    EGFR inhibitor
    CAS# 879127-07-8
    M.F.: C21H18F3N5O
    M.W.: 413.40
  • QA133600
    AMI-1 Disodium Salt
    CAS# 20324-87-2
    M.F.: C21H14N2Na2O9S2
    M.W.: 548.45
  • QM191000
    Maslinic Acid
    CAS# 4373-41-5
    M.F.: C30H48O4
    M.W.: 472.71
  • QA121100
    ALK/IGF1R inhibitor
    CAS# 1356962-20-3
    M.F.: C24H25ClN6O
    M.W.: 448.96
  • QB180400
    BRD4 Inhibitor-10
    CAS# 1660117-38-3
    M.F.: C25H27N5O2
    M.W.: 429.52
  • QN093300
    Nicotinamide Riboside
    CAS# 1341-23-7
    M.F.: C11H15N2O5+
    M.W.: 255.25
  • QY030900
    Y-39983 Hydrochloride
    CAS# 471843-75-1
    M.F.: C16H16N4O.HCl
    M.W.: 280.33 36.46
  • QA133500
    AMG 487
    CAS# 473719-41-4
    M.F.: C32H28F3N5O4
    M.W.: 603.60
  • QV3077102
    Vitamin B6 Impurity 102
    CAS# 524-07-2
    M.F.: C8H9NO4
    M.W.: 183.16
  • QV3077101
    Vitamin B6 Impurity 101
    CAS# NA
    M.F.: C16H20N2O5
    M.W.: 320.35
  • QZ121629
    Zolpidem tartrate Impurity 29
    CAS# 14547-80-9
    M.F.: C13H12N2O
    M.W.: 212.25
  • QZ121628
    Zolpidem tartrate Impurity 28
    CAS# 20972-36-5
    M.F.: C11H10O3
    M.W.: 190.20
  • QP190500
    Pseudovitamin B12
    CAS# 13408-75-8
    M.F.: C59H83CoN17O14P
    M.W.: 1344.33
  • QT031891
    Vitamin E Impurity 91
    CAS# 86993-71-7
    M.F.: C30H52O2
    M.W.: 444.74
  • QM141400
    Menaquinone 4;Menatetrenone
    CAS# 863-61-6
    M.F.: C31H40O2
    M.W.: 444.66
  • QL090649
    Lifitegrast Impurity 49
    CAS# 166599-84-4
    M.F.: C9H6O3
    M.W.: 162.14
  • QP080512
    Phenytoin Sodium Impurity 12
    CAS# NA
    M.F.: C15H11N3O4
    M.W.: 297.27
  • QM092212
    Mivacurium chloride Impurity 12
    CAS# NA
    M.F.: C28H42ClNO7
    M.W.: 540.09
  • QM092211
    Mivacurium chloride Impurity 11
    CAS# NA
    M.F.: C23H30INO5
    M.W.: 527.40
  • QM092210
    Mivacurium chloride Impurity 10
    CAS# NA
    M.F.: C21H25NO6
    M.W.: 387.43
  • QE261243
    Enzalutamide Impurity 43
    CAS# NA
    M.F.: C9H3F3N2S
    M.W.: 228.19
  • QB152001
    (+)-Bornyl acetate
    CAS# 20347-65-3
    M.F.: C12H20O2
    M.W.: 196.29
  • QR027025
    Rifampicin Impurity 25
    CAS# NA
    M.F.: C44H60N4O12
    M.W.: 836.98
  • QC080311
    Cholic Acid Impurity 11
    CAS# 15073-99-1
    M.F.: C26H44O5
    M.W.: 436.63
  • QA122616
    Alprazolam USP Related Compound A
    CAS# 28910-89-6
    M.F.: C17H15ClN4O
    M.W.: 326.78
  • QG131819
    Gimeracil Impurity 19
    CAS# NA
    M.F.: C7H4Cl2N2O2
    M.W.: 219.02
  • QV041426
    Vardenafil Impurity 26
    CAS# 1417529-67-9
    M.F.: C17H18N4O4
    M.W.: 342.36
  • QG010600
    Gadoterate Meglumine
    CAS# 92943-93-6
    M.F.: C16H25GdN4O8.C7H17NO5
    M.W.: 558.65 195.22
  • QL011430
    Landiolol Impurity 30
    CAS# NA
    M.F.: C5H14N4O
    M.W.: 146.19
  • QL011427
    Landiolol Impurity 27
    CAS# NA
    M.F.: C26H42N6O7
    M.W.: 550.66
  • QL011422
    Landiolol Impurity 22
    CAS# 69630-20-2
    M.F.: C11H13NO3
    M.W.: 207.23
  • QG121504
    Glycocholic Acid Impurity 4
    CAS# 26563-58-6
    M.F.: C28H46N2O7
    M.W.: 522.68
  • QI032000
    Icotinib hydrochloride
    CAS# 1204313-51-8
    M.F.: C22H21N3O4.HCl
    M.W.: 391.43 36.46
  • QL091683
    Lipoic Acid Impurity 83
    CAS# NA
    M.F.: C10H20N2OS2
    M.W.: 248.40
  • QL091682
    Lipoic Acid Impurity 82
    CAS# NA
    M.F.: C10H20N2OS2
    M.W.: 248.40
  • QS041922
    Sodium Valproate Impurity 22
    CAS# 66546-92-7
    M.F.: C10H17NO2
    M.W.: 183.25
  • QS041921
    Sodium Valproate Impurity 21
    CAS# 66546-91-6
    M.F.: C9H15NO2
    M.W.: 169.22
  • QR051258
    Relugolix Impurity 58
    CAS# 2814571-37-2
    M.F.: C29H26F2N6O5S
    M.W.: 608.62
  • QB142900
    Benzalkonium chloride
    CAS# 8001-54-5
    M.F.: NA
    M.W.: NA
  • QC141201
    Controlled Substance
    (delta(9)-Tetrahydrocannabinolic acid)

    CAS# 23978-85-0
    M.F.: C22H30O4
    M.W.: 358.48
  • QB152101
    beta-Boswellic acid
    CAS# 631-69-6
    M.F.: C30H48O3
    M.W.: 456.71
  • QD162010
    Daptomycin Impurity J
    CAS# NA
    M.F.: C74H107N17O27
    M.W.: 1666.76
  • QN140448
    Nintedanib Impurity 48
    CAS# 54699-92-2
    M.F.: C7H14N2O2
    M.W.: 158.20
  • QN140426
    Nintedanib Impurity 26
    CAS# 708279-23-6
    M.F.: C13H18N4O3
    M.W.: 278.31
  • QA010301
    Arachidonic acid-d11
    CAS# NA
    M.F.: C20H21D11O2
    M.W.: 315.54
  • QO130400
    Omadacycline tosylate
    CAS# 1075240-43-5;389139-89-3(free base)
    M.F.: C29H40N4O7.C7H8O3S
    M.W.: 556.66 172.20
  • QC182704
    Sodium Cromoglicate Impurity 4
    CAS# NA
    M.F.: C36H26O17
    M.W.: 730.59
  • QV3077100
    Vitamin K1 Chromenol
    CAS# 34044-00-3
    M.F.: C31H46O2
    M.W.: 450.71
  • QV307799
    Vitamin K1 Impurity 99
    CAS# 16825-16-4
    M.F.: C18H36O
    M.W.: 268.49
  • QD094600
    DL-Dihydroorotic acid
    CAS# 155-54-4
    M.F.: C5H6N2O4
    M.W.: 158.11
  • QA031608
    Acipimox Impurity 8
    CAS# 1368358-42-2
    M.F.: C6H4N2O3
    M.W.: 152.11
  • QI040158
    Indacaterol Impurity 58
    CAS# NA
    M.F.: C29H30N2O3
    M.W.: 454.57
  • QR152459
    Roxadustat Impurity 59
    CAS# NA
    M.F.: C20H18N2O4
    M.W.: 350.37
  • QL012407
    Latamoxef Impurity 7
    CAS# NA
    M.F.: C41H38N6O10S
    M.W.: 806.85
  • QI210675
    Ibuprofen Impurity 75
    CAS# NA
    M.F.: C12H15ClO
    M.W.: 210.70
  • QG040274
    Gadobutrol Impurity 74
    CAS# NA
    M.F.: C16H26CaN4O8
    M.W.: 442.48
  • QS075495
    Sugammadex Impurity 95
    CAS# NA
    M.F.: C48H72Br7ClO32
    M.W.: 1755.85
  • QC132673
    Cefmetazole sodium Impurity 73
    CAS# NA
    M.F.: C24H22N2O5S2
    M.W.: 482.57
  • QC132671
    Cefmetazole sodium Impurity 71
    CAS# NA
    M.F.: C24H22N6O3S3
    M.W.: 538.66
  • QD152507
    Doxycycline hyclate Impurity 7
    CAS# NA
    M.F.: C22H24N2O9
    M.W.: 460.44
  • QC132670
    Cefmetazole sodium Impurity 70
    CAS# NA
    M.F.: C24H24N2O6S
    M.W.: 468.52
  • QF022498
    Febuxostat Impurity 98
    CAS# 2428631-65-4
    M.F.: C17H15N3O3S
    M.W.: 341.39
  • QD030472
    Diclofenac sodium Impurity 72
    CAS# NA
    M.F.: C14H8Cl4NNaO2
    M.W.: 387.01
  • QD030471
    Diclofenac sodium Impurity 71
    CAS# NA
    M.F.: C14H7Cl4NO
    M.W.: 347.02
  • QA180254
    Arbidol Impurity 54
    CAS# 39830-85-8
    M.F.: C30H32N2O8
    M.W.: 548.59
  • QI182081
    Ibrutinib Impurity 81
    CAS# 109384-19-2
    M.F.: C10H19NO3
    M.W.: 201.27
  • QO132087
    Olmesartan Medoxomil Impurity 87
    CAS# NA
    M.F.: C53H54N12O8
    M.W.: 987.09
  • QE161250
    Epalrestat Impurity 50
    CAS# NA
    M.F.: C11H13NO3S2
    M.W.: 271.35
  • QT260428
    Trazodone hydrochloride Impurity 28
    CAS# 23431-04-1
    M.F.: C5H4N4O
    M.W.: 136.11
  • QA130504
    Aminolevulinic Acid Impurity 4
    CAS# 106-65-0
    M.F.: C6H10O4
    M.W.: 146.14
  • QA130503
    Aminolevulinic Acid Impurity 3
    CAS# 3878-55-5
    M.F.: C5H8O4
    M.W.: 132.12
  • QA163039
    Apremilast Impurity 39
    CAS# 208774-55-4
    M.F.: C10H11NO4
    M.W.: 209.20
  • QZ151215
    Zoledronic acid EP Impurity A
    CAS# NA
    M.F.: C7H12N2O9P2
    M.W.: 330.13
  • QI091638
    Ipratropium Bromide Impurity 38
    CAS# NA
    M.F.: C19H18O6
    M.W.: 342.35
  • QZ140102
    Zanamivir EP Impurity C
    CAS# NA
    M.F.: C11H18N2O7
    M.W.: 290.27
  • QT180925
    Triamcinolone hexacetonide EP Impurity B
    CAS# NA
    M.F.: C29H39FO7
    M.W.: 518.62
  • QC124100
    Calcium Gluconate
    CAS# 18016-24-5
    M.F.: C12H22CaO14.H2O
    M.W.: 430.37 18.02
  • QT152800
    all-rac-α-Tocopheryl acetate
    CAS# 7695-91-2
    M.F.: C31H52O3
    M.W.: 472.75
  • QD141648
    Donepezil Benzyl Chloride
    CAS# 937362-16-8
    M.F.: C31H36ClNO3
    M.W.: 506.08
  • QM200513
    Methylene Blue Nitroso Impurity 1
    CAS# NA
    M.F.: C12H7N3O2S
    M.W.: 257.27
  • QM200512
    Methylene Blue Impurity 12
    CAS# 1195557-65-3
    M.F.: C12H10IN
    M.W.: 295.12
  • QM200511
    Methylene Blue Impurity 11
    CAS# 2204245-78-1
    M.F.: C12H9I2N
    M.W.: 421.02
  • QM200510
    Leucomethylene Blue
    CAS# 613-11-6
    M.F.: C16H19N3S
    M.W.: 285.41
  • QM200509
    Methylene Blue Impurity 9
    CAS# 16078-95-8
    M.F.: C12H11NS
    M.W.: 201.29
  • QM200515
    Methylene Blue Impurity 15
    CAS# 20255-70-3
    M.F.: C12H9I2N
    M.W.: 421.02
  • QM200514
    Methylene Blue Impurity 14
    CAS# 61613-21-6
    M.F.: C12H10IN
    M.W.: 295.12
  • QT691544
    Testosterone Propionate EP Impurity E
    CAS# NA
    M.F.: C22H30O3
    M.W.: 342.48
  • QT691543
    Testosterone Propionate EP Impurity D
    CAS# NA
    M.F.: C22H30O3
    M.W.: 342.48
  • QT691539
    Testosterone Enantate EP Impurity H
    CAS# NA
    M.F.: C33H54O4
    M.W.: 514.79
  • QT082103
    Terpin EP Impurity C;Limonene
    CAS# 138-86-3
    M.F.: C10H16
    M.W.: 136.24
  • QT082100
    Terpin Monohydrate
    CAS# 2451-01-6
    M.F.: C10H20O2.H2O
    M.W.: 172.27 18.02
  • QI041804
    Idarubicinone
    CAS# 60660-75-5
    M.F.: C20H16O7
    M.W.: 368.34
  • QS210501
    Sulfacetamide sodium EP Impurity C
    CAS# NA
    M.F.: C10H12N2O4S
    M.W.: 256.28
  • QS210500
    Sulfacetamide sodium monohydrate
    CAS# 6209-17-2
    M.F.: C8H9N2NaO3S.H2O
    M.W.: 236.22 18.02
  • QS161603
    Spirapril EP Impurity D
    CAS# NA
    M.F.: C25H36N2O5S2
    M.W.: 508.69
  • QE200394
    Entacapone Impurity 94
    CAS# 80547-69-9
    M.F.: C8H7NO5
    M.W.: 197.15
  • QP032025
    Procaterol Impurity 25
    CAS# NA
    M.F.: C16H22N2O3
    M.W.: 290.36
  • QP032024
    Procaterol Impurity 24
    CAS# NA
    M.F.: C16H22N2O2
    M.W.: 274.36
  • QP032023
    Procaterol Impurity 23
    CAS# NA
    M.F.: C13H11Br2NO3
    M.W.: 389.04
  • QF151405
    Fondaparinux Sodium Impurity 5
    CAS# NA
    M.F.: C32H42N3Na9O47S7
    M.W.: 1651.99
  • QF151404
    Fondaparinux Sodium Impurity 4
    CAS# NA
    M.F.: C38H55N3Na10O49S8
    M.W.: 1824.21
  • QF151403
    Fondaparinux Sodium Impurity 3
    CAS# NA
    M.F.: C32H44N3Na9O47S7
    M.W.: 1654.01
  • QF151402
    Fondaparinux Sodium Impurity 2
    CAS# NA
    M.F.: C31H42N3Na11O52S9
    M.W.: 1830.07
  • QF151401
    Fondaparinux Sodium Impurity 1
    CAS# NA
    M.F.: C31H44N3Na9O46S7
    M.W.: 1626.00
  • QS0102121
    Salbutamol Impurity 121
    CAS# 27566-09-2
    M.F.: C14H21NO4
    M.W.: 267.33
  • QS150404
    Alendronic acid
    CAS# 66376-36-1
    M.F.: C4H13NO7P2
    M.W.: 249.10
  • QS0102119
    Salbutamol Impurity 119
    CAS# 29754-58-3
    M.F.: C10H10O6
    M.W.: 226.18
  • QG042419
    Gadoxetate Disodium Impurity 19
    CAS# NA
    M.F.: C30H44N4O5
    M.W.: 540.71
  • QG042418
    Gadoxetate Disodium Impurity 18
    CAS# NA
    M.F.: C13H22N2O2.2HCl
    M.W.: 238.33 72.92
  • QG042417
    Gadoxetate Disodium Impurity 17
    CAS# NA
    M.F.: C18H23NO4S
    M.W.: 349.45
  • QR122008
    Raltegravir potassium EP Impurity H
    CAS# 1391918-18-5
    M.F.: C34H36F2N8O8
    M.W.: 722.71
  • QE160505
    Eperisone Impurity 5
    CAS# 27465-51-6
    M.F.: C11H14O
    M.W.: 162.23
  • QP150707
    Proguanil hydrochloride EP Impurity G
    CAS# NA
    M.F.: C11H16ClN5
    M.W.: 253.73
  • QP150706
    Proguanil hydrochloride EP Impurity F
    CAS# NA
    M.F.: C11H15Cl2N5
    M.W.: 288.18
  • QP150705
    Proguanil hydrochloride EP Impurity E
    CAS# NA
    M.F.: C8H7ClN4
    M.W.: 194.62
  • QP150303
    Prochlorperazine Maleate EP Impurity C
    CAS# 1346602-34-3
    M.F.: C20H24ClN3S
    M.W.: 373.94
  • QP150302
    Prochlorperazine Maleate EP Impurity B;
    Perazine

    CAS# 84-97-9;14516-56-4(dimaleate)
    M.F.: C20H25N3S
    M.W.: 339.50
  • QP150301
    Prochlorperazine Maleate EP Impurity A
    CAS# 10078-27-0
    M.F.: C20H24ClN3OS
    M.W.: 389.94
  • QP092104
    Primaquine Diphosphate EP Impurity D
    CAS# NA
    M.F.: C23H23N3O3
    M.W.: 389.46
  • QP092103
    Primaquine Diphosphate EP Impurity C
    CAS# 90-52-8
    M.F.: C10H10N2O
    M.W.: 174.20
  • QP092102
    Primaquine Diphosphate EP Impurity B
    CAS# 85-81-4
    M.F.: C10H8N2O3
    M.W.: 204.19
  • QP092101
    Primaquine Diphosphate EP Impurity A;Quinocide
    CAS# 525-61-1
    M.F.: C15H21N3O
    M.W.: 259.35
  • QE192902
    Estradiol Cypionate Impurity 2
    CAS# NA
    M.F.: C27H38O3
    M.W.: 410.60
  • QE192901
    Estradiol Cypionate Impurity 1
    CAS# NA
    M.F.: C26H34O3
    M.W.: 394.56
  • QE192900
    Estradiol Cypionate
    CAS# 313-06-4
    M.F.: C26H36O3
    M.W.: 396.57
  • QT131214
    Timolol Maleate Impurity 14
    CAS# NA
    M.F.: C6H9N3O3S
    M.W.: 203.22
  • QC181722
    Crotamiton Impurity 22
    CAS# NA
    M.F.: C13H18ClNO
    M.W.: 239.74
  • QP081305
    Phentolamine Mesylate Impurity 5
    CAS# NA
    M.F.: C21H25N5O
    M.W.: 363.47
  • QR152453
    Roxadustat Impurity 53
    CAS# 39987-25-2
    M.F.: C6H11NO4.HCl
    M.W.: 161.16 36.46
  • QI192285
    Isavuconazole Impurity 85
    CAS# NA
    M.F.: C35H36F2N8O9S2
    M.W.: 814.84
  • QT260426
    Trazodone hydrochloride Impurity Z
    CAS# 2727463-29-6
    M.F.: C40H46Cl2N10O2
    M.W.: 769.78
  • QI152300
    Iothalamic acid
    CAS# 2276-90-6
    M.F.: C11H9I3N2O4
    M.W.: 613.92
  • QA163020
    Apremilast Impurity 20
    CAS# 113579-20-7
    M.F.: C9H9NO4
    M.W.: 195.17
  • QC130426
    Cefamandole Impurity 26
    CAS# NA
    M.F.: C18H17ClN6O4S2
    M.W.: 480.94
  • QC130425
    Cefamandole Impurity 25
    CAS# NA
    M.F.: C27H26N8O9S3
    M.W.: 702.73
  • QA161912
    Acetylsalicylic Acid Impurity 12
    CAS# NA
    M.F.: C14H13N3O4
    M.W.: 287.28
  • QA161911
    Acetylsalicylic Acid Impurity 11
    CAS# NA
    M.F.: C14H12N2O5
    M.W.: 288.26
  • QR021660
    Rabeprazole Impurity 60
    CAS# NA
    M.F.: C14H12ClN3OS
    M.W.: 305.78
  • QO240113
    Oxacillin sodium Impurity 13
    CAS# NA
    M.F.: C19H20N4O6S
    M.W.: 432.45
  • QC153700
    Combretastatin A4 Phosphate Disodium Salt
    CAS# 168555-66-6
    M.F.: C18H19Na2O8P
    M.W.: 440.30
  • QC042433
    Cefadroxil Impurity 33
    CAS# NA
    M.F.: C48H48N8O14S2
    M.W.: 1025.07
  • QB212539
    Butylphthalide Impurity 39
    CAS# 72917-31-8
    M.F.: C12H12O2
    M.W.: 188.23
  • QA120744
    Alogliptin Impurity 44
    CAS# 2749357-07-9
    M.F.: C12H8ClN3O2
    M.W.: 261.67
  • QC081341
    Calcitriol Impurity 41
    CAS# NA
    M.F.: C39H70O4Si2
    M.W.: 659.16
  • QA132617
    Amorolfine Impurity 17
    CAS# 67467-96-3
    M.F.: C15H22O
    M.W.: 218.34
  • QP092710
    Pinaverium Bromide Impurity 10
    CAS# NA
    M.F.: C15H22BrCl2NO3
    M.W.: 415.15
  • QC181954
    Crisaborole Impurity 54
    CAS# NA
    M.F.: C16H16BrNO3
    M.W.: 350.21
  • QI191651
    Isoproterenol Impurity 51
    CAS# 28177-45-9
    M.F.: C11H17NO5S
    M.W.: 275.32
  • QC182703
    Sodium Cromoglicate Impurity 3
    CAS# NA
    M.F.: C45H30O20
    M.W.: 890.72
  • QP160475
    Paliperidone Impurity 75
    CAS# 1071864-06-6
    M.F.: C30H31FN4O4
    M.W.: 530.60
  • QA130311
    Aminocaproic acid Impurity K
    CAS# 56403-09-9
    M.F.: C12H22N2O2
    M.W.: 226.32
  • QA130310
    Aminocaproic acid Impurity J
    CAS# 19837-09-3
    M.F.: C12H22N2O2
    M.W.: 226.32
  • QA130309
    Aminocaproic acid Impurity I
    CAS# 371-34-6
    M.F.: C8H17NO2
    M.W.: 159.23
  • QM041851
    Minodronic Acid Impurity 51
    CAS# NA
    M.F.: C9H11N2O4P
    M.W.: 242.17
  • QM041850
    Minodronic Acid Impurity 50
    CAS# NA
    M.F.: C9H11ClN2O6P2
    M.W.: 340.59
  • QT120231
    Tulobuterol Impurity 31
    CAS# NA
    M.F.: C28H48ClNO3
    M.W.: 482.15
  • QL091681
    Lipoic Acid Impurity 81
    CAS# NA
    M.F.: C24H42O6S6
    M.W.: 618.95
  • QU130506
    Umeclidinium bromide Nitroso Impurity 1
    CAS# 1038-06-8
    M.F.: C18H20N2O2
    M.W.: 296.37
  • QC042036
    Cefditoren Pivoxil-13C-d3
    CAS# NA
    M.F.: C2413CH25D3N6O7S3
    M.W.: 624.72
  • QC042035
    Cefditoren pivoxil Impurity 35
    CAS# NA
    M.F.: C51H59N13O14S6
    M.W.: 1270.47
  • QM201600
    Mitoquinone
    CAS# 444890-41-9
    M.F.: C37H44O4P+
    M.W.: 583.73
  • QG040500
    Gadobenate Dimeglumine
    CAS# 127000-20-8
    M.F.: C36H62GdN5O21
    M.W.: 1058.16
  • QC061900
    Ceftaroline fosamil acetate
    CAS# 400827-46-5;866021-48-9(acetate monohydrate)
    M.F.: C24H25N8O10PS4
    M.W.: 744.72
  • QT120223
    Tulobuterol Impurity 23
    CAS# NA
    M.F.: C14H20ClNO2
    M.W.: 269.77
  • QE160946
    Epinastine Impurity 46
    CAS# NA
    M.F.: C13H13N3
    M.W.: 211.27
  • QV200108
    Vitamin A palmitate
    CAS# 79-81-2
    M.F.: C36H60O2
    M.W.: 524.87
  • QI193300
    Isosulfan Blue
    CAS# 68238-36-8
    M.F.: C27H31N2NaO6S2
    M.W.: 566.66
  • QL220340
    Levocarnitine propionate hydrochloride
    CAS# 119793-66-7
    M.F.: C10H20ClNO4
    M.W.: 253.72
  • QV307798
    Dihydro Vitamin K1
    CAS# 572-96-3
    M.F.: C31H48O2
    M.W.: 452.72
  • QL210901
    Lucidenic acid A
    CAS# 95311-94-7
    M.F.: C27H38O6
    M.W.: 458.60
  • QG011404
    Ganoderic Acid G
    CAS# 98665-22-6
    M.F.: C30H44O8
    M.W.: 532.67
  • QG011403
    Ganoderic Acid C2
    CAS# 103773-62-2
    M.F.: C30H46O7
    M.W.: 518.69
  • QA010736
    Alanyl Glutamine Impurity 36
    CAS# 2680610-96-0
    M.F.: C8H12N2O4
    M.W.: 200.19
  • QI142104
    Insulin degludec Impurity 4
    CAS# NA
    M.F.: C25H38N2O8
    M.W.: 494.59
  • QI142103
    Insulin degludec Impurity 3
    CAS# NA
    M.F.: C29H48N2O9
    M.W.: 568.71
  • QI142102
    Insulin degludec Impurity 2
    CAS# NA
    M.F.: C21H35NO6
    M.W.: 397.51
  • QI142101
    Insulin degludec Impurity 1
    CAS# NA
    M.F.: C21H37NO7
    M.W.: 415.53
  • QM050106
    Metamizole sodium Nitroso Impurity 1
    CAS# NA
    M.F.: C10H8N4O3
    M.W.: 232.20
  • QN091242
    Nilotinib Impurity 42
    CAS# 641571-06-4
    M.F.: C11H10F3N3
    M.W.: 241.22
  • QV071209
    Voglibose Impurity 9
    CAS# NA
    M.F.: C10H21NO7
    M.W.: 267.28
  • QP092709
    Pinaverium Bromide Impurity 9
    CAS# NA
    M.F.: C15H22Br2ClNO3
    M.W.: 459.60
  • QP092708
    Pinaverium Bromide Impurity 8
    CAS# NA
    M.F.: C15H23Br2NO4
    M.W.: 441.16
  • QD151911
    Calcium Dobesilate Impurity 11
    CAS# NA
    M.F.: C8H8O5S
    M.W.: 216.21
  • QB201345
    Betamethasone Impurity 45
    CAS# 1202001-99-7;1201919-11-0(2Na salt)
    M.F.: C22H30FO8P
    M.W.: 472.45
  • QC0303136
    Cinacalcet Impurity 136
    CAS# NA
    M.F.: C22H22F3N
    M.W.: 357.42
  • QE121200
    Ellagic acid
    CAS# 476-66-4
    M.F.: C14H6O8
    M.W.: 302.19
  • QC192053
    Candesartan Cilexetil Impurity 53
    CAS# NA
    M.F.: C10H9NO6
    M.W.: 239.18
  • QC192052
    Candesartan Cilexetil Impurity 52
    CAS# NA
    M.F.: C14H18N2O6
    M.W.: 310.31
  • QM191400
    Masitinib mesylate
    CAS# 1048007-93-7;790299-79-5(free base)
    M.F.: C28H30N6OS.CH4O3S
    M.W.: 498.65 96.10
  • QF120806
    Flecainide acetate Nitroso Impurity 1
    CAS# NA
    M.F.: C17H18F6N4O5
    M.W.: 472.34
  • QF061322
    Fosfomycin Trometamol Impurity 22
    CAS# NA
    M.F.: C7H17O5P
    M.W.: 212.18
  • QF061321
    Fosfomycin Trometamol Impurity 21
    CAS# NA
    M.F.: C5H13O5P
    M.W.: 184.13
  • QC192051
    Candesartan Cilexetil Impurity 51
    CAS# 62351-79-5
    M.F.: C12H13NO6
    M.W.: 267.24
  • QT201628
    Tiotropium bromide Impurity 28
    CAS# NA
    M.F.: C18H19NO4S2
    M.W.: 377.47
  • QK201846
    Ketorolac Impurity 46
    CAS# 144710-35-0
    M.F.: C18H19NO5
    M.W.: 329.35
  • QF022496
    Febuxostat Impurity 96
    CAS# NA
    M.F.: C29H26N2O8S2
    M.W.: 594.65
  • QA131263
    Amlodipine Impurity 63
    CAS# NA
    M.F.: C32H45ClN2O15
    M.W.: 733.16
  • QP050312
    Penicillamine Impurity 12
    CAS# NA
    M.F.: C8H15N3O2S
    M.W.: 217.29
  • QF120372
    Folic Acid Impurity 72
    CAS# 1182291-60-6
    M.F.: C7H7N5O3
    M.W.: 209.17
  • QP090333
    Sodium Picosulfate Impurity 33
    CAS# NA
    M.F.: C24H27NO8S2
    M.W.: 521.60
  • QT1406195
    Tenofovir Disoproxil Fumarate Impurity 195
    CAS# NA
    M.F.: C58H88N15O30P3
    M.W.: 1568.34
  • QL091680
    Lipoic Acid Impurity 80
    CAS# 120476-62-2
    M.F.: C8H13ClO2
    M.W.: 176.64
  • QL091679
    Lipoic Acid Impurity 79
    CAS# NA
    M.F.: C10H17ClO2
    M.W.: 204.69
  • QS200793
    Sitagliptin Impurity 93
    CAS# 1246961-45-4
    M.F.: C19H26F3NO4
    M.W.: 389.42
  • QM092209
    Mivacurium chloride Impurity 9
    CAS# NA
    M.F.: C25H36ClNO6
    M.W.: 482.01
  • QC061444
    Cefdinir Impurity 44
    CAS# NA
    M.F.: C13H15N5O4S2
    M.W.: 369.41
  • QC042034
    Cefditoren pivoxil Impurity 34
    CAS# NA
    M.F.: C50H56N12O14S6
    M.W.: 1241.43
  • QF132044
    Formoterol Impurity 44
    CAS# NA
    M.F.: C14H19NO5
    M.W.: 281.31
  • QT0603171
    Tofacitinib Impurity 171
    CAS# NA
    M.F.: C4H5N3O2
    M.W.: 127.10
  • QF122123
    Fluorouracil Impurity 23
    CAS# NA
    M.F.: C5H6N2O3
    M.W.: 142.11
  • QC151309
    Clomifene citrate EP Impurity GH
    CAS# 1795130-17-4;1795130-18-5(citrate salt)
    M.F.: C26H27Cl2NO
    M.W.: 440.41
  • QC192050
    Candesartan Cilexetil Impurity 50
    CAS# NA
    M.F.: C10H8N2O5
    M.W.: 236.18
  • QC192049
    Candesartan Cilexetil Impurity 49
    CAS# NA
    M.F.: C12H14N2O6
    M.W.: 282.25
  • QL090635
    Lifitegrast Impurity 35
    CAS# NA
    M.F.: C29H26Cl2N2O9S
    M.W.: 649.49
  • QP090332
    Sodium Picosulfate Impurity 32
    CAS# NA
    M.F.: C18H12NNa3O11S3
    M.W.: 583.44
  • QP090331
    Sodium Picosulfate Impurity 31
    CAS# 105745-58-2
    M.F.: C18H15NO2
    M.W.: 277.32
  • QP090330
    Sodium Picosulfate Impurity 30
    CAS# NA
    M.F.: C12H11NO2
    M.W.: 201.23
  • QK201844
    Ketorolac Impurity 44
    CAS# 66635-89-0
    M.F.: C15H12ClNO3
    M.W.: 289.72
  • QG121914
    Granisetron Impurity 14
    CAS# NA
    M.F.: C18H24N4O2
    M.W.: 328.42
  • QP180353
    Piperacillin Impurity 53
    CAS# NA
    M.F.: C23H29N5O8S
    M.W.: 535.57
  • QI161600
    Iptacopan hydrochloride
    CAS# 1646321-63-2
    M.F.: C25H30N2O4.HCl
    M.W.: 422.53 36.46
  • QL091678
    Lipoic Acid Impurity 78
    CAS# NA
    M.F.: C24H44O6S6
    M.W.: 620.97
  • QL091677
    Lipoic Acid Impurity 77
    CAS# NA
    M.F.: C26H48O6S6
    M.W.: 649.02
  • QL091676
    Lipoic Acid Impurity 76
    CAS# NA
    M.F.: C16H30O4S4
    M.W.: 414.65
  • QL091675
    Lipoic Acid Impurity 75
    CAS# 108841-56-1
    M.F.: C16H30O4S4
    M.W.: 414.65
  • QC121920
    Cilastatin Impurity 20
    CAS# NA
    M.F.: C16H26N2O5S
    M.W.: 358.45
  • QU181600
    Uroporphyrin I dihydrochloride
    CAS# 68929-06-6
    M.F.: C40H38N4O16.2HCl
    M.W.: 830.76 72.92
  • QZ151214
    Zoledronic acid Impurity 14
    CAS# 131468-90-1
    M.F.: C4H6N2O
    M.W.: 98.11
  • QZ151213
    Zoledronic acid Impurity 13
    CAS# NA
    M.F.: C5H11N3O7P2
    M.W.: 287.10
  • QZ151212
    Zoledronic acid Impurity 12
    CAS# NA
    M.F.: C6H12N2O7P2
    M.W.: 286.12
  • QB051330
    Bempedoic acid Impurity 30
    CAS# NA
    M.F.: C29H45NO6S
    M.W.: 535.74
  • QB051329
    Bempedoic acid Impurity 29
    CAS# NA
    M.F.: C27H41NO6S
    M.W.: 507.69
  • QC181949
    Crisaborole Impurity 49
    CAS# 2227126-09-0
    M.F.: C16H12BrNO3
    M.W.: 346.18
  • QI142506
    Indocyanine Green Impurity 6
    CAS# NA
    M.F.: C18H20NNaO4S
    M.W.: 369.41
  • QV1416147
    Vonoprazan Impurity 147
    CAS# NA
    M.F.: C18H18FN3O3S
    M.W.: 375.42
  • QD151632
    Dopamine Impurity 32
    CAS# NA
    M.F.: C16H20N2O4.HCl
    M.W.: 304.35 36.46
  • QB152003
    Isobornyl Acetate
    CAS# 125-12-2
    M.F.: C12H20O2
    M.W.: 196.29
  • QR052003
    Retinoic acid Impurity 3
    CAS# 53282-28-3
    M.F.: C33H38ClP
    M.W.: 501.09
  • QP181919
    Prasugrel Metabolite R-138727
    CAS# 204204-73-9
    M.F.: C18H20FNO3S
    M.W.: 349.42
  • QA661232
    Ampicillin Impurity 32
    CAS# NA
    M.F.: C32H40N6O9S2
    M.W.: 716.83
  • QA123800
    Alflutinib mesylate
    CAS# 2130958-55-1
    M.F.: C28H31F3N8O2.CH4O3S
    M.W.: 568.61 96.10
  • QC031261
    Cefaclor Impurity 61
    CAS# NA
    M.F.: C29H28Cl2N6O6S2
    M.W.: 691.60
  • QR051254
    Relugolix Impurity 54
    CAS# NA
    M.F.: C32H35F2N7O6S
    M.W.: 683.73
  • QM041510
    Medroxyprogesterone Acetate Impurity 10
    CAS# 984-46-3
    M.F.: C24H34O5
    M.W.: 402.53
  • QP081846
    Phloroglucinol Impurity 46
    CAS# 531-02-2
    M.F.: C12H10O4
    M.W.: 218.21
  • QP180352
    Piperacillin Impurity 52
    CAS# NA
    M.F.: C25H33N5O8S
    M.W.: 563.63
  • QA261967
    Azilsartan Impurity 67
    CAS# NA
    M.F.: C29H28N4O5
    M.W.: 512.57
  • QB140444
    Benidipine Impurity 44
    CAS# NA
    M.F.: C16H22N2O2.HCl
    M.W.: 274.36 36.46
  • QB140443
    Benidipine Impurity 43
    CAS# NA
    M.F.: C23H24N2O5.HCl
    M.W.: 408.45 36.46
  • QT691527
    Testosterone octanoate
    CAS# NA
    M.F.: C27H42O3
    M.W.: 414.63
  • QB011524
    Baloxavir Impurity 24
    CAS# 1985607-69-9
    M.F.: C22H23N3O6
    M.W.: 425.44
  • QM031641
    Mycophenolate Mofetil Impurity 41
    CAS# NA
    M.F.: C17H24O8
    M.W.: 356.37
  • QS150403
    Alendronic Acid-d6
    CAS# 1035437-39-8
    M.F.: C4H7D6NO7P2
    M.W.: 255.13
  • QM092200
    Mivacurium chloride
    CAS# 106861-44-3;133814-19-4(cation)
    M.F.: C58H80Cl2N2O14
    M.W.: 1100.18
  • QC620915
    Colchicine Impurity 15
    CAS# NA
    M.F.: C23H27NO6S
    M.W.: 445.53
  • QR131908
    Ramosetron Impurity 8
    CAS# 603-76-9
    M.F.: C9H9N
    M.W.: 131.18
  • QS023390
    SCH 23390 maleate
    CAS# 87134-87-0
    M.F.: C17H18ClNO.C4H4O4
    M.W.: 287.79 116.07
  • QP1824112
    Parecoxib Sodium Impurity 112
    CAS# NA
    M.F.: C19H16N2O3S
    M.W.: 352.41
  • QB011519
    Baloxavir Impurity 19
    CAS# 2365472-39-3
    M.F.: C17H15N3O4
    M.W.: 325.32
  • QM154268
    Mirabegron Impurity 68
    CAS# NA
    M.F.: C32H36N4O3
    M.W.: 524.67
  • QE191333
    Esmolol Impurity 33
    CAS# 17449-03-5
    M.F.: C10H8O5
    M.W.: 208.17
  • QI142505
    Indocyanine Green Impurity 5
    CAS# NA
    M.F.: C45H52N2O6S2
    M.W.: 781.04
  • QD152611
    Deoxycholic acid Impurity 11
    CAS# NA
    M.F.: C25H36O2
    M.W.: 368.56
  • QD152610
    Deoxycholic acid Impurity 10
    CAS# NA
    M.F.: C25H36O3
    M.W.: 384.56
  • QD152609
    Deoxycholic acid Impurity 9
    CAS# NA
    M.F.: C25H38O2
    M.W.: 370.58
  • QD152608
    Deoxycholic acid Impurity 8
    CAS# NA
    M.F.: C24H36O2
    M.W.: 356.55
  • QD152607
    Deoxycholic acid Impurity 7
    CAS# NA
    M.F.: C24H36O3
    M.W.: 372.55
  • QD152606
    Deoxycholic acid Impurity 6
    CAS# 3318-71-6
    M.F.: C24H34O2
    M.W.: 354.53
  • QM571813
    Megestrol Acetate-d3
    CAS# 162462-72-8
    M.F.: C24H29D3O4
    M.W.: 387.53
  • QN012106
    Nalfurafine Impurity 6
    CAS# NA
    M.F.: C28H32N2O5
    M.W.: 476.57
  • QC121919
    Cilastatin Impurity 19
    CAS# NA
    M.F.: C17H26N2O5S
    M.W.: 370.46
  • QR051252
    Relugolix Impurity 52
    CAS# NA
    M.F.: C25H25F2N3O6S
    M.W.: 533.55
  • QS011236
    Salmeterol Impurity 36
    CAS# NA
    M.F.: C29H45NO2
    M.W.: 439.68
  • QB011510
    Baloxavir marboxil Impurity 10
    CAS# 2954948-28-6
    M.F.: C27H24FN3O7S
    M.W.: 553.56
  • QF120371
    Folic Acid Impurity 71
    CAS# NA
    M.F.: C19H17N7O7
    M.W.: 455.39
  • QC080310
    Cholic Acid Impurity 10
    CAS# 10538-66-6
    M.F.: C25H38O5
    M.W.: 418.57
  • QC080309
    Cholic Acid Impurity 9
    CAS# 10538-64-4
    M.F.: C25H40O5
    M.W.: 420.59
  • QC080308
    Cholic Acid Impurity 8
    CAS# 14772-99-7
    M.F.: C25H40O5
    M.W.: 420.59
  • QI040153
    Indacaterol Impurity 53
    CAS# NA
    M.F.: C31H34N2O3
    M.W.: 482.62
  • QA031604
    Acipimox Impurity 4
    CAS# 98502-96-6
    M.F.: C6H6N2O3
    M.W.: 154.13
  • QA031602
    Acipimox Impurity 2
    CAS# 51037-31-1
    M.F.: C6H6N2O3
    M.W.: 154.13
  • QB051328
    Bempedoic acid Impurity 28
    CAS# 50592-83-1
    M.F.: C9H16O2
    M.W.: 156.23
  • QB051327
    Bempedoic acid Impurity 27
    CAS# 143958-75-2
    M.F.: C11H20O2
    M.W.: 184.28
  • QB051326
    Bempedoic acid Impurity 26
    CAS# NA
    M.F.: C11H22O3
    M.W.: 202.29
  • QB051325
    Bempedoic acid Impurity 25
    CAS# NA
    M.F.: C16H24O4S
    M.W.: 312.42
  • QB051324
    Bempedoic acid Impurity 24
    CAS# NA
    M.F.: C16H24O5S
    M.W.: 328.42
  • QB051323
    Bempedoic acid Impurity 23
    CAS# NA
    M.F.: C18H28O5S
    M.W.: 356.48
  • QB051322
    Bempedoic acid Impurity 22
    CAS# 1529323-27-0
    M.F.: C9H18O3
    M.W.: 174.24
  • QA020307
    Abacavir sulfate Impurity 7
    CAS# NA
    M.F.: C14H18N6O
    M.W.: 286.34
  • QX050400
    XE 991 dihydrochloride
    CAS# 122955-13-9
    M.F.: C26H20N2O.2HCl
    M.W.: 376.46 72.92
  • QF124001
    Flavine Adenine Dinucleotide-13C5 Ammonium Salt
    CAS# NA
    M.F.: C2213C5H33N9O15P2.xNH3
    M.W.: 790.52+x(17.03)
  • QC151307
    Clomifene citrate Impurity 7
    CAS# NA
    M.F.: C33H34ClNO.HCl
    M.W.: 496.09 36.46
  • QO242013
    Oxytocin Impurity 13
    CAS# NA
    M.F.: C43H67N13O12S2
    M.W.: 1022.20
  • QG121810
    Glycyrrhizic Acid Impurity 10
    CAS# NA
    M.F.: C45H68O17
    M.W.: 881.01
  • QL011413
    Landiolol Impurity 13
    CAS# NA
    M.F.: C21H33N3O6
    M.W.: 423.50
  • QL011412
    Landiolol Impurity 12
    CAS# NA
    M.F.: C22H35N3O6
    M.W.: 437.53
  • QR122007
    Raltegravir potassium EP Impurity G
    CAS# NA
    M.F.: C22H27FN6O6
    M.W.: 490.48
  • QR122006
    Raltegravir potassium EP Impurity F
    CAS# NA
    M.F.: C22H27FN6O6
    M.W.: 490.48
  • QR122005
    Raltegravir potassium EP Impurity E
    CAS# NA
    M.F.: C20H22N6O5
    M.W.: 426.43
  • QR122003
    Raltegravir potassium EP Impurity C
    CAS# 1391918-17-4
    M.F.: C20H23FN6O6
    M.W.: 462.43
  • QM050700
    Melengestrol acetate
    CAS# 2919-66-6
    M.F.: C25H32O4
    M.W.: 396.52
  • QR122000
    Raltegravir potassium
    CAS# 871038-72-1;518048-05-0(free base)
    M.F.: C20H20FKN6O5
    M.W.: 482.51
  • QI091637
    Ipratropium Bromide Impurity 37
    CAS# NA
    M.F.: C19H25NO3
    M.W.: 315.41
  • QC061239
    Cephalexin Impurity 39
    CAS# 1323247-65-9
    M.F.: C16H19N3O5S
    M.W.: 365.40
  • QC205915
    Cytidine Impurity 15
    CAS# 77172-20-4
    M.F.: C9H13N3O5
    M.W.: 243.22
  • QC-A131447
    (S)-2-amino-3-(3-nitrophenyl)propanoic acid
    CAS# 19883-74-0
    M.F.: C9H10N2O4
    M.W.: 210.19
  • QB200110
    Betamethasone Dipropionate Impurity 10
    CAS# NA
    M.F.: C32H39FO8S
    M.W.: 602.71
  • QT130612
    Tamoxifen Citrate Impurity 12
    CAS# NA
    M.F.: C18H20
    M.W.: 236.35
  • QM053900
    Methylthioninium chloride hydrate
    CAS# 122965-43-9
    M.F.: C16H18ClN3S.xH2O
    M.W.: 319.85+x(18.02)
  • QN140418
    Nintedanib Impurity 18
    CAS# 676326-36-6
    M.F.: C12H11NO4
    M.W.: 233.22
  • QM052601
    Methylrosanilinium chloride EP Impurity B
    CAS# NA
    M.F.: C24H28ClN3
    M.W.: 393.95
  • QS120305
    Methyl salicylate EP Impurity L
    CAS# 33528-09-5
    M.F.: C9H10O3
    M.W.: 166.17
  • QS120304
    Methyl salicylate EP Impurity K
    CAS# 4670-56-8
    M.F.: C9H10O3
    M.W.: 166.17
  • QS120303
    Methyl salicylate EP Impurity J
    CAS# 22717-57-3
    M.F.: C9H10O3
    M.W.: 166.17
  • QS120302
    Methyl salicylate EP Impurity I
    CAS# 23287-26-5
    M.F.: C9H10O3
    M.W.: 166.17
  • QC120104
    Clavulanic Acid Impurity 4
    CAS# 762-84-5
    M.F.: C6H13NO
    M.W.: 115.17
  • QC010303
    Calcitonin (Salmon) EP Impurity C;
    Des-22-tyrosine-calcitonin (salmon)

    CAS# NA
    M.F.: C136H231N43O46S2
    M.W.: 3268.68
  • QI091636
    Ipratropium Bromide Impurity 36
    CAS# NA
    M.F.: C19H28BrNO2
    M.W.: 382.34
  • QR092000
    Ritalinic acid
    CAS# 19395-41-6
    M.F.: C13H17NO2
    M.W.: 219.28
  • QP140831
    Penehyclidine Impurity 5
    CAS# 4397-01-7
    M.F.: C12H16O
    M.W.: 176.25
  • QD030468
    Diclofenac sodium Impurity 68
    CAS# NA
    M.F.: C14H11NO2
    M.W.: 225.24
  • QD030467
    Diclofenac sodium Impurity 67
    CAS# NA
    M.F.: C14H11NO3
    M.W.: 241.24
  • QT081538
    Theophylline Impurity 38
    CAS# NA
    M.F.: C17H22N8O5
    M.W.: 418.41
  • QE201827
    Emtricitabine Impurity 27
    CAS# 64282-88-8
    M.F.: C10H20O
    M.W.: 156.27
  • QA152409
    Amphotericin B Impurity 9
    CAS# NA
    M.F.: C47H73NO16
    M.W.: 908.08
  • QT182003
    Tropisetron hydrochloride Impurity 3
    CAS# NA
    M.F.: C26H25N3O3
    M.W.: 427.50
  • QC042033
    Cefditoren pivoxil Impurity 33
    CAS# NA
    M.F.: C50H56N12O14S6
    M.W.: 1241.44
  • QC042032
    Cefditoren pivoxil Impurity 32
    CAS# NA
    M.F.: C27H32N6O8S3
    M.W.: 664.77
  • QZ151211
    Zoledronic acid Impurity 11
    CAS# NA
    M.F.: C5H10N2O8P2
    M.W.: 288.09
  • QI120119
    Ilaprazole Impurity 19
    CAS# NA
    M.F.: C20H20N4O2S
    M.W.: 380.46
  • QD152605
    Deoxycholic acid Impurity 5
    CAS# 3245-38-3
    M.F.: C25H42O4
    M.W.: 406.60
  • QR051242
    Relugolix Impurity 42
    CAS# NA
    M.F.: C54H44F4N12O6S2
    M.W.: 1097.13
  • QR051234
    Relugolix Impurity 34
    CAS# NA
    M.F.: C24H22F2N2O7S
    M.W.: 520.50
  • QR051231
    Relugolix Impurity 31
    CAS# NA
    M.F.: C10H11N5O2
    M.W.: 233.23
  • QV307797
    cis-Vitamin K1-d7
    CAS# NA
    M.F.: C31H39D7O2
    M.W.: 457.74
  • QL052602
    Levomepromazine Maleate EP Impurity B
    CAS# NA
    M.F.: C19H24N2O2S
    M.W.: 344.47
  • QL052601
    Levomepromazine Maleate EP Impurity A
    CAS# 1771-18-2
    M.F.: C13H11NOS
    M.W.: 229.30
  • QJ150104
    Josamycin Propionate EP Impurity D
    CAS# NA
    M.F.: C48H77NO17
    M.W.: 940.12
  • QM191232
    Mesalazine Impurity 32
    CAS# NA
    M.F.: C19H14N4O3
    M.W.: 346.34
  • QA161213
    Apalutamide Impurity 13
    CAS# NA
    M.F.: C22H8F9N9
    M.W.: 569.34
  • QJ150103
    Josamycin Propionate EP Impurity C
    CAS# NA
    M.F.: C46H75NO16
    M.W.: 898.08
  • QJ150102
    Josamycin Propionate EP Impurity B
    CAS# NA
    M.F.: C42H69NO15
    M.W.: 827.99
  • QJ150101
    Josamycin Propionate EP Impurity A
    CAS# NA
    M.F.: C42H67NO16
    M.W.: 841.98
  • QG121503
    Glycocholic Acid Impurity 1
    CAS# NA
    M.F.: C52H84N2O11
    M.W.: 913.23
  • QI130903
    Imiquimod Impurity 3
    CAS# NA
    M.F.: C13H15N3O2
    M.W.: 245.28
  • QI142504
    Indocyanine Green Impurity 4
    CAS# 63149-24-6;788111-66-0(cation form);2279162-22-8(Br-)
    M.F.: C19H23NO3S
    M.W.: 345.46
  • QG042416
    Gadoxetate Disodium Impurity O
    CAS# NA
    M.F.: C23H33N3O11
    M.W.: 527.52
  • QG042415
    Gadoxetate Disodium Impurity N
    CAS# NA
    M.F.: C21H29N3O8
    M.W.: 451.47
  • QG042414
    Gadoxetate Disodium Impurity M
    CAS# NA
    M.F.: C21H29N3O8
    M.W.: 451.47
  • QG042413
    Gadoxetate Disodium Impurity L
    CAS# NA
    M.F.: C19H26N2O9
    M.W.: 426.42
  • QG042412
    Gadoxetate Disodium Impurity K
    CAS# NA
    M.F.: C18H29N3O4
    M.W.: 351.44
  • QG042411
    Gadoxetate Disodium Impurity J
    CAS# NA
    M.F.: C24H38N4O2.2HCl
    M.W.: 414.58 72.92
  • QC030701
    Alanyl Glutamine Impurity 1
    CAS# NA
    M.F.: C8H12N2O4
    M.W.: 200.19
  • QF140608
    Fenofibric acid-d6
    CAS# 1092484-69-9
    M.F.: C17H9D6ClO4
    M.W.: 324.79
  • QT012801
    Taurocholic acid 3-sulfate
    CAS# 67030-62-0;71781-33-4(2Na salt)
    M.F.: C26H45NO10S2
    M.W.: 595.77
  • QC080307
    Cholic acid 7-sulfate
    CAS# 60320-05-0
    M.F.: C24H40O8S
    M.W.: 488.63
  • QQ211500
    Quinoline Yellow
    CAS# 8004-92-0
    M.F.: C18H9NNa2O8S2
    M.W.: 477.38
  • QP184600
    Proadifen Hydrochloride
    CAS# 62-68-0
    M.F.: C23H31NO2.HCl
    M.W.: 353.50 36.46
  • QM010400
    Madecassic acid
    CAS# 18449-41-7
    M.F.: C30H48O6
    M.W.: 504.70
  • QR1922149
    Rosuvastatin Impurity 149
    CAS# NA
    M.F.: C20H28FN3O3S
    M.W.: 409.52
  • QL011404
    Landiolol Impurity 4
    CAS# 1253907-81-1;133242-29-2(free base)
    M.F.: C25H39N3O8.HCl
    M.W.: 509.59 36.46
  • QE201608
    Ertapenem Impurity 8
    CAS# NA
    M.F.: C12H14N2O4
    M.W.: 250.25
  • QD152604
    Deoxycholic Acid 3-O-β-D-Glucuronide Disodium Salt
    CAS# 59274-67-8
    M.F.: C30H46Na2O10
    M.W.: 612.66
  • QP090329
    Sodium Picosulfate Impurity 29
    CAS# 158839-52-2
    M.F.: C12H11NO2
    M.W.: 201.22
  • QP090328
    Sodium Picosulfate Impurity 28
    CAS# 33455-95-7
    M.F.: C12H11NO2
    M.W.: 201.22
  • QP090327
    Sodium Picosulfate Impurity 27
    CAS# NA
    M.F.: C18H14NNaO5S
    M.W.: 379.36
  • QP090326
    Sodium Picosulfate Impurity 26
    CAS# NA
    M.F.: C18H14NNaO5S
    M.W.: 379.36
  • QP090325
    Sodium Picosulfate Impurity 25
    CAS# NA
    M.F.: C18H14NNaO5S
    M.W.: 379.36
  • QC-M011206
    Maleopimaric acid
    CAS# 510-39-4
    M.F.: C24H32O5
    M.W.: 400.51
  • QP010300
    Pachymic acid
    CAS# 29070-92-6
    M.F.: C33H52O5
    M.W.: 528.76
  • QC-M251804
    Myristic acid
    CAS# 544-63-8
    M.F.: C14H28O2
    M.W.: 228.37
  • QH250700
    Hydrogenated lecithin
    CAS# 92128-87-5
    M.F.: C42H84NO8P
    M.W.: 762.09
  • QE261240
    Enzalutamide Impurity 40
    CAS# NA
    M.F.: C18H10F6N4O
    M.W.: 412.29
  • QP180463
    Perindopril Impurity 63
    CAS# NA
    M.F.: C10H19NO4
    M.W.: 217.26
  • QH042508
    Hydrocortisone acetate EP Impurity G
    CAS# 81968-66-3
    M.F.: C25H34O7
    M.W.: 446.53
  • QH042507
    Hydrocortisone acetate EP Impurity E
    CAS# 7753-60-8
    M.F.: C23H30O5
    M.W.: 386.48
  • QH152002
    Homatropine methylbromide EP Impurity F;Methyl mandelate
    CAS# 4358-87-6
    M.F.: C9H10O3
    M.W.: 166.17
  • QC042031
    Cefditoren pivoxil Impurity 31
    CAS# NA
    M.F.: C27H32N6O8S3
    M.W.: 664.77
  • QT1406193
    Tenofovir Impurity 193
    CAS# NA
    M.F.: C31H50N5O20P
    M.W.: 843.72
  • QL090306
    10,11-Dihydro-10-Hydroxy Carbamazepine-d4
    CAS# 1188265-49-7
    M.F.: C15H10D4N2O2
    M.W.: 258.31
  • QA161910
    Acetylsalicylic Acid-d4 (Aspirin-d4)
    CAS# 97781-16-3
    M.F.: C9H4D4O4
    M.W.: 184.18
  • QM031634
    Mycophenolate Mofetil-d4
    CAS# 1132748-21-0
    M.F.: C23H27D4NO7
    M.W.: 437.52
  • QG121809
    Glycyrrhizic Acid Impurity E
    CAS# NA
    M.F.: C44H66O16
    M.W.: 850.99
  • QG121808
    Licoricesaponin C2
    CAS# 118525-49-8
    M.F.: C42H62O15
    M.W.: 806.93
  • QG121807
    Glycyrrhizic Acid Impurity D
    CAS# NA
    M.F.: C44H67NO16
    M.W.: 866.00
  • QG121806
    Glycyrrhizic Acid Impurity C
    CAS# 138268-00-5
    M.F.: C42H62O16
    M.W.: 822.93
  • QG121805
    Glycyrrhizic Acid Impurity B
    CAS# 134250-15-0
    M.F.: C42H64O15
    M.W.: 808.95
  • QG121804
    Licoricesaponin E2
    CAS# 119417-96-8
    M.F.: C42H60O16
    M.W.: 820.92
  • QG121803
    Licoricesaponin A3
    CAS# 118325-22-7
    M.F.: C48H72O21
    M.W.: 985.07
  • QC120910
    Calcipotriol Impurity 10
    CAS# NA
    M.F.: C30H46O3
    M.W.: 454.68
  • QH152001
    Homatropine methylbromide EP Impurity A
    CAS# NA
    M.F.: C17H22BrNO3
    M.W.: 368.27
  • QH152000
    Homatropine methylbromide
    CAS# 80-49-9
    M.F.: C17H24BrNO3
    M.W.: 370.28
  • QS150402
    Alendronic Acid Impurity 2
    CAS# NA
    M.F.: C4H12NO8P3
    M.W.: 295.06
  • QS150401
    Alendronic Acid Dimeric Anhydride
    CAS# 165043-20-9
    M.F.: C8H22N2O12P4
    M.W.: 462.16
  • QL091674
    rac α-Lipoic Acid-d5
    CAS# 1189471-66-6
    M.F.: C8H9D5O2S2
    M.W.: 211.36
  • QB050323
    Beclometasone Dipropionate-d6
    CAS# NA
    M.F.: C28H31D6ClO7
    M.W.: 527.08
  • QP032019
    Procaterol Impurity 19
    CAS# NA
    M.F.: C15H20N2O3
    M.W.: 276.33
  • QC080306
    Cholic Acid Impurity 6
    CAS# NA
    M.F.: C24H38O4
    M.W.: 390.56
  • QC080305
    Cholic Acid Impurity 5
    CAS# 105227-28-9
    M.F.: C24H40O4
    M.W.: 392.57
  • QM031633
    Mycophenolic Acid Impurity 33
    CAS# NA
    M.F.: C21H28O6
    M.W.: 376.44
  • QG051903
    Gestodene EP Impurity C;2-isopropanol-gestodene
    CAS# NA
    M.F.: C24H32O3
    M.W.: 368.51
  • QI132070
    Imatinib Impurity 70
    CAS# NA
    M.F.: C30H33Cl2N7O
    M.W.: 578.54
  • QC191901
    (E)-Cinnamyl alcohol
    CAS# 4407-36-7
    M.F.: C9H10O
    M.W.: 134.18
  • QC191900
    Cinnamyl alcohol
    CAS# 104-54-1
    M.F.: C9H10O
    M.W.: 134.18
  • QE160405
    Eptifibatide Impurity 5
    CAS# NA
    M.F.: C35H49N11O9S2
    M.W.: 831.96
  • QB180501
    Brevianamide F
    CAS# 38136-70-8
    M.F.: C16H17N3O2
    M.W.: 283.33
  • QC-P251834
    Pyrophosphoric acid
    CAS# 2466-09-3
    M.F.: H4O7P2
    M.W.: 177.98
  • QN150400
    Nordeoxycholic acid
    CAS# 53608-86-9
    M.F.: C23H38O4
    M.W.: 378.55
  • QT012100
    Taurohyocholic acid
    CAS# 32747-07-2;117997-17-8(Na salt)
    M.F.: C26H45NO7S
    M.W.: 515.70
  • QG123500
    Glycohyocholic acid
    CAS# 32747-08-3
    M.F.: C26H43NO6
    M.W.: 465.62
  • QE2620110
    Ezetimibe Impurity 110
    CAS# NA
    M.F.: C26H27F2NO4
    M.W.: 455.49
  • QL131102
    Malic Acid Impurity 2
    CAS# NA
    M.F.: C8H8O8
    M.W.: 232.14
  • QR131220
    Ramelteon Impurity T
    CAS# 896736-21-3
    M.F.: C16H21NO3
    M.W.: 275.34
  • QA164826
    Axitinib Impurity 26
    CAS# NA
    M.F.: C15H12IN3O3S
    M.W.: 441.24
  • QN140415
    Nintedanib Impurity 15
    CAS# 1168152-07-5
    M.F.: C20H17NO5
    M.W.: 351.35
  • QF211704
    Fluphenazine dihydrochloride EP Impurity F
    CAS# NA
    M.F.: C31H44F3N5O3S
    M.W.: 623.77
  • QF211703
    Fluphenazine dihydrochloride EP Impurity D
    CAS# NA
    M.F.: C36H34F6N4S2
    M.W.: 700.80
  • QF211702
    Fluphenazine dihydrochloride EP Impurity C
    CAS# NA
    M.F.: C35H32F6N4OS2
    M.W.: 702.78
  • QC-M151404
    Monooctyl Maleate
    CAS# 2370-71-0
    M.F.: C12H20O4
    M.W.: 228.28
  • QF211701
    Fluphenazine dihydrochloride EP Impurity B;
    Fluphenazine S,S-dioxide

    CAS# 1476-79-5
    M.F.: C22H26F3N3O3S
    M.W.: 469.52
  • QB051321
    Bempedoic acid Impurity 21
    CAS# NA
    M.F.: C21H40O5
    M.W.: 372.54
  • QB051320
    Bempedoic acid Impurity 20
    CAS# NA
    M.F.: C21H38O6
    M.W.: 386.52
  • QB051319
    Bempedoic acid Impurity 19
    CAS# 738606-64-9
    M.F.: C23H44O5
    M.W.: 400.59
  • QE202703
    Ethionamide EP Impurity D
    CAS# 1531-18-6
    M.F.: C8H8N2
    M.W.: 132.16
  • QE191907
    Estradiol benzoate EP Impurity H
    CAS# NA
    M.F.: C27H30O4
    M.W.: 418.52
  • QE191906
    Estradiol benzoate EP Impurity G;Estrone benzoate
    CAS# NA
    M.F.: C25H26O3
    M.W.: 374.47
  • QE191905
    Estradiol benzoate EP Impurity F
    CAS# NA
    M.F.: C25H26O3
    M.W.: 374.47
  • QE191904
    Estradiol benzoate EP Impurity E
    CAS# NA
    M.F.: C25H28O3
    M.W.: 376.49
  • QE191903
    Estradiol benzoate EP Impurity D
    CAS# NA
    M.F.: C25H28O3
    M.W.: 376.49
  • QE191902
    Estradiol benzoate EP Impurity C
    CAS# NA
    M.F.: C32H32O4
    M.W.: 480.59
  • QE191901
    Estradiol benzoate EP Impurity B
    CAS# NA
    M.F.: C26H30O3
    M.W.: 390.51
  • QE191900
    Estradiol benzoate
    CAS# 50-50-0
    M.F.: C25H28O3
    M.W.: 376.49
  • QE182051
    Erythromycin estolate EP Impurity G
    CAS# 147702-49-6
    M.F.: C39H69NO14
    M.W.: 775.96
  • QA261962
    Azilsartan Impurity 62
    CAS# NA
    M.F.: C32H28N4O8
    M.W.: 596.59
  • QT142428
    Tranexamic Acid Impurity 28
    CAS# NA
    M.F.: C24H41N3O4
    M.W.: 435.60
  • QC083100
    Chlorophyll a
    CAS# 479-61-8
    M.F.: C55H72MgN4O5
    M.W.: 893.50
  • QG042410
    Gadoxetate Disodium Impurity I
    CAS# NA
    M.F.: C23H28GdN3Na2O11
    M.W.: 725.71
  • QG042409
    Gadoxetate Disodium Impurity H
    CAS# NA
    M.F.: C23H28GdN3Na2O11
    M.W.: 725.71
  • QG011209
    Galantamine hydrobromide Impurity 9
    CAS# 134332-50-6
    M.F.: C17H21NO4
    M.W.: 303.35
  • QI191646
    Isoproterenol Impurity 46
    CAS# NA
    M.F.: C11H15NO3
    M.W.: 209.24
  • QI191645
    Isoproterenol Impurity 45
    CAS# NA
    M.F.: C12H16O4
    M.W.: 224.25
  • QI182066
    Ibrutinib Impurity 66
    CAS# NA
    M.F.: C16H13NO5
    M.W.: 299.28
  • QI182064
    Ibrutinib Impurity 64
    CAS# NA
    M.F.: C16H11NO4
    M.W.: 281.26
  • QI150201
    Isochlorogenic acid C
    CAS# 57378-72-0
    M.F.: C25H24O12
    M.W.: 516.45
  • QB041437
    Budesonide Impurity 37
    CAS# 3949-79-9
    M.F.: C23H28O7
    M.W.: 416.46
  • QS052500
    Senkyunolide A
    CAS# 63038-10-8
    M.F.: C12H16O2
    M.W.: 192.25
  • QG052700
    Genipin 1-gentiobioside
    CAS# 29307-60-6
    M.F.: C23H34O15
    M.W.: 550.51
  • QD161503
    Dipotassium clorazepate EP Impurity C
    CAS# NA
    M.F.: C18H15ClN2O3
    M.W.: 342.78
  • QN051519
    Neostigmine bromide Impurity 19
    CAS# NA
    M.F.: C6H7NO2
    M.W.: 125.13
  • QD061400
    Controlled Substance
    (Diphenoxylate hydrochloride)

    CAS# 3810-80-8
    M.F.: C30H32N2O2.HCl
    M.W.: 452.59 36.46
  • QI132068
    Imatinib Impurity 68
    CAS# NA
    M.F.: C16H13N5O2
    M.W.: 307.31
  • QD162476
    Dapoxetine Impurity 76
    CAS# NA
    M.F.: C18H17ClO2
    M.W.: 300.78
  • QP812556
    Paclitaxel Impurity 56
    CAS# NA
    M.F.: C58H58Cl3NO17
    M.W.: 1147.44
  • QD091006
    Dicloxacillin sodium Impurity 6
    CAS# NA
    M.F.: C27H27Cl2N5O7S2
    M.W.: 668.57
  • QD098107
    Difloxacin hydrochloride trihydrate EP Impurity G
    CAS# NA
    M.F.: C16H8ClF2NO3
    M.W.: 335.69
  • QD098105
    Difloxacin hydrochloride trihydrate EP Impurity F
    CAS# NA
    M.F.: C27H23F3N4O2
    M.W.: 492.49
  • QD098104
    Difloxacin hydrochloride trihydrate EP Impurity E
    CAS# NA
    M.F.: C21H19ClFN3O3
    M.W.: 415.85
  • QS0602104
    Sofosbuvir Impurity 104
    CAS# 874638-98-9
    M.F.: C17H18FN3O5
    M.W.: 363.34
  • QU130505
    Umeclidinium bromide Impurity 5
    CAS# NA
    M.F.: C44H54Br2N2O3
    M.W.: 818.72
  • QV307795
    Vitamin K1 Impurity 95
    CAS# NA
    M.F.: C31H46O3
    M.W.: 466.70
  • QV307794
    Vitamin K1 Impurity 94
    CAS# 85955-78-8
    M.F.: C31H46O3
    M.W.: 466.70
  • QD091005
    Dicloxacillin sodium Impurity 5
    CAS# NA
    M.F.: C32H27Cl4N5O9S
    M.W.: 799.46
  • QO240209
    Oxybutynin hydrochloride Impurity 9
    CAS# NA
    M.F.: C11H14O3
    M.W.: 194.23
  • QO240208
    Oxybutynin hydrochloride Impurity 8
    CAS# NA
    M.F.: C26H38O
    M.W.: 366.58
  • QO240207
    Oxybutynin hydrochloride Impurity 7
    CAS# NA
    M.F.: C26H40O2
    M.W.: 384.59
  • QC016100
    Caronic anhydride
    CAS# 67911-21-1
    M.F.: C7H8O3
    M.W.: 140.14
  • QV091220
    Vilanterol Impurity 20
    CAS# 2762285-55-0
    M.F.: C48H64Cl4N2O9
    M.W.: 954.84
  • QV091215
    Vilanterol Impurity 15
    CAS# NA
    M.F.: C24H33Cl2NO5
    M.W.: 486.43
  • QV091212
    Vilanterol Impurity 12
    CAS# NA
    M.F.: C36H53Cl2NO15
    M.W.: 810.71
  • QC052001
    Cetrorelix Impurity 1
    CAS# NA
    M.F.: C69H91ClN16O13
    M.W.: 1388.01
  • QD098103
    Difloxacin hydrochloride trihydrate EP Impurity D
    CAS# NA
    M.F.: C21H19ClFN3O3
    M.W.: 415.85
  • QE201937
    Sacubitril Impurity 37
    CAS# NA
    M.F.: C25H31NO4
    M.W.: 409.52
  • QV307793
    Vitamin K1 Impurity 93
    CAS# NA
    M.F.: C31H46O3
    M.W.: 466.70
  • QA182003
    Arotinolol Impurity 3
    CAS# 52560-88-0
    M.F.: C15H20N2O3S3
    M.W.: 372.53
  • QO121509
    Olodaterol Impurity 9
    CAS# NA
    M.F.: C17H16ClNO4
    M.W.: 333.77
  • QO121508
    Olodaterol Impurity 8
    CAS# 869478-13-7
    M.F.: C28H32N2O5
    M.W.: 476.56
  • QL051926
    Levosimendan Impurity 26
    CAS# NA
    M.F.: C11H14N2O2
    M.W.: 206.24
  • QD030466
    Diclofenac sodium Impurity 66
    CAS# NA
    M.F.: C14H9Cl3NNaO2
    M.W.: 352.58
  • QD030465
    Diclofenac sodium Impurity 65
    CAS# NA
    M.F.: C14H8Cl3NO
    M.W.: 312.58
  • QD152603
    Deoxycholic acid Impurity 3
    CAS# NA
    M.F.: C26H44O5
    M.W.: 436.62
  • QD152602
    Deoxycholic acid Impurity 2
    CAS# NA
    M.F.: C24H40O5
    M.W.: 408.57
  • QD152601
    Deoxycholic acid Impurity 1
    CAS# 24637-46-5
    M.F.: C24H38O4
    M.W.: 390.56
  • QF140607
    2-Chloro Fenofibric Acid
    CAS# 61024-31-5
    M.F.: C17H15ClO4
    M.W.: 318.75
  • QC132666
    Cefmetazole sodium Impurity 66
    CAS# NA
    M.F.: C13H16N6O5S3
    M.W.: 432.50
  • QC132665
    Cefmetazole sodium Impurity 65
    CAS# NA
    M.F.: C26H25ClN6O5S2
    M.W.: 601.10
  • QC132664
    Cefmetazole sodium Impurity 64
    CAS# NA
    M.F.: C26H26N6O5S3
    M.W.: 598.72
  • QC132663
    Cefmetazole sodium Impurity 63
    CAS# NA
    M.F.: C28H27N7O5S3
    M.W.: 637.75
  • QC132662
    Cefmetazole sodium Impurity 62
    CAS# NA
    M.F.: C24H22N6O3S3
    M.W.: 538.66
  • QE1316173
    Empagliflozin Impurity 173
    CAS# NA
    M.F.: C17H17ClO4
    M.W.: 320.77
  • QA060307
    Alfacalcidol Impurity 7
    CAS# 160796-62-3
    M.F.: C27H44O4S
    M.W.: 464.70
  • QF181952
    Furosemide Impurity 52
    CAS# NA
    M.F.: C16H18ClNO6S
    M.W.: 387.84
  • QS040688
    Sildenafil Impurity 88
    CAS# NA
    M.F.: C5H12N2O
    M.W.: 116.16
  • QC152900
    Cortisone acetate;
    Hydrocortisone acetate EP Impurity D

    CAS# 50-04-4
    M.F.: C23H30O6
    M.W.: 402.48
  • QB011223
    Baclofen Impurity 23
    CAS# 114703-75-2
    M.F.: C9H13ClN2
    M.W.: 184.67
  • QC123602
    Clodronate disodium EP Impurity D
    CAS# 87591-00-2
    M.F.: CH5ClO6P2
    M.W.: 210.45
  • QC123601
    Clodronate disodium EP Impurity A
    CAS# 134757-52-1
    M.F.: C4H10Cl2O6P2
    M.W.: 286.97
  • QC123600
    Clodronate disodium tetrahydrate
    CAS# NA
    M.F.: CH2Cl2Na2O6P2.4H2O
    M.W.: 288.86 72.06
  • QS061431
    Safinamide Impurity 5
    CAS# NA
    M.F.: C17H17FN2O2
    M.W.: 300.33
  • QD030464
    Diclofenac sodium Impurity 64
    CAS# NA
    M.F.: C28H16Cl4N2O2
    M.W.: 554.25
  • QR0718100
    Regorafenib Impurity 100
    CAS# NA
    M.F.: C8H8FNO2
    M.W.: 169.15
  • QR071891
    Regorafenib Impurity 91
    CAS# NA
    M.F.: C20H19N5O4
    M.W.: 393.40
  • QR071887
    Regorafenib Impurity 87
    CAS# NA
    M.F.: C12H8ClFN2O2
    M.W.: 266.66
  • QR071882
    Regorafenib Impurity 82
    CAS# NA
    M.F.: C13H13N3O3
    M.W.: 259.26
  • QR071881
    Regorafenib Impurity 81
    CAS# NA
    M.F.: C12H11FN2O2
    M.W.: 234.23
  • QA130242
    Ambroxol Impurity 42
    CAS# NA
    M.F.: C19H22Br2N2O3
    M.W.: 486.20
  • QC050514
    Ceftibuten Impurity 14
    CAS# 36923-21-4
    M.F.: C20H18N2O3S
    M.W.: 366.43
  • QC050504
    Ceftibuten Impurity 4
    CAS# NA
    M.F.: C20H22N2O4S
    M.W.: 386.46
  • QB211309
    Bumetanide Impurity 9
    CAS# NA
    M.F.: C7H5ClN2O6S
    M.W.: 280.64
  • QC082811
    Chlormadinone acetate EP Impurity L
    CAS# NA
    M.F.: C23H31ClO4
    M.W.: 406.94
  • QC082810
    Chlormadinone acetate EP Impurity K
    CAS# NA
    M.F.: C23H30O4
    M.W.: 370.48
  • QC082809
    Chlormadinone acetate EP Impurity J;
    Chlormadinone

    CAS# 1961-77-9
    M.F.: C21H27ClO3
    M.W.: 362.89
  • QC082808
    Chlormadinone acetate EP Impurity I
    CAS# NA
    M.F.: C25H35ClO4
    M.W.: 435.00
  • QC082807
    Chlormadinone acetate EP Impurity H
    CAS# 1054-64-4
    M.F.: C24H34O4
    M.W.: 386.52
  • QC082806
    Chlormadinone acetate EP Impurity F
    CAS# 1172-82-3
    M.F.: C24H34O4
    M.W.: 386.52
  • QC082805
    Chlormadinone acetate EP Impurity E
    CAS# 15251-04-4
    M.F.: C23H29BrO4
    M.W.: 449.38
  • QC050503
    Ceftibuten Impurity 3
    CAS# NA
    M.F.: C13H12N2O4S
    M.W.: 292.31
  • QC082803
    Chlormadinone acetate EP Impurity C
    CAS# NA
    M.F.: C24H33ClO4
    M.W.: 420.97
  • QC082802
    Chlormadinone acetate EP Impurity B
    CAS# NA
    M.F.: C23H26BrClO4
    M.W.: 481.81
  • QO131909
    Olmesartan Medoxomil Impurity 9
    CAS# NA
    M.F.: C53H54N12O8
    M.W.: 987.07
  • QR242227
    Roxatidine Impurity 27
    CAS# NA
    M.F.: C10H19ClN2O3
    M.W.: 250.72
  • QF210660
    Flurbiprofen Impurity 60
    CAS# NA
    M.F.: C9H9FN2O4
    M.W.: 228.18
  • QF210659
    Flurbiprofen Impurity 59
    CAS# NA
    M.F.: C14H17FN2O6
    M.W.: 328.29
  • QF210657
    Flurbiprofen Impurity 57
    CAS# NA
    M.F.: C19H20O5
    M.W.: 328.36
  • QT1406191
    Tenofovir Impurity 191
    CAS# NA
    M.F.: C53H80N15O26P3
    M.W.: 1436.21
  • QP092707
    Pinaverium Bromide Impurity 7
    CAS# 38284-47-8;53330-19-1(HCl salt)
    M.F.: C17H31NO2
    M.W.: 281.43
  • QD161408
    Dexpanthenol Impurity 8
    CAS# 18679-90-8
    M.F.: C10H19NO5
    M.W.: 233.26
  • QD161407
    L-Panthenol
    CAS# 74561-18-5
    M.F.: C9H19NO4
    M.W.: 205.25
  • QC082902
    Chloramphenicol palmitate EP Impurity B
    CAS# NA
    M.F.: C43H72Cl2N2O7
    M.W.: 799.95
  • QC082901
    Chloramphenicol palmitate EP Impurity A
    CAS# NA
    M.F.: C27H42Cl2N2O6
    M.W.: 561.54
  • QC082900
    Chloramphenicol palmitate
    CAS# 530-43-8
    M.F.: C27H42Cl2N2O6
    M.W.: 561.54
  • QC052903
    Cefapirin sodium EP Impurity C
    CAS# NA
    M.F.: C15H15N3O4S2
    M.W.: 365.43
  • QC052902
    Cefapirin sodium EP Impurity B
    CAS# 104557-24-6(Na salt)
    M.F.: C15H15N3O5S2
    M.W.: 381.43
  • QC052901
    Cefapirin sodium EP Impurity A
    CAS# NA
    M.F.: C15H13N3O4S2
    M.W.: 363.41
  • QD150423
    Dronedarone Impurity 23
    CAS# NA
    M.F.: C19H16ClNO5
    M.W.: 373.79
  • QC180200
    Carbasalate calcium
    CAS# 5749-67-7
    M.F.: C18H14CaO8.CH4N2O
    M.W.: 398.38 60.06
  • QH042506
    Hydrocortisone Acetate EP Impurity F;
    epi-Hydrocortisone Acetate

    CAS# 1250-97-1
    M.F.: C23H32O6
    M.W.: 404.50
  • QP0203100
    Palbociclib Impurity 100
    CAS# NA
    M.F.: C13H13Cl2N3O
    M.W.: 298.17
  • QP020398
    Palbociclib Impurity 98
    CAS# 119285-07-3
    M.F.: C14H22N4O2
    M.W.: 278.35
  • QI071837
    Iguratimod Impurity 37
    CAS# NA
    M.F.: C18H19NO6S
    M.W.: 377.41
  • QF150901
    Calcium Folinate Hydrate EP Impurity E
    CAS# 4349-43-3
    M.F.: C15H16N6O4
    M.W.: 344.33
  • QP081844
    Phloroglucinol Impurity 44
    CAS# 23957-21-3
    M.F.: C8H10BrNO2
    M.W.: 232.07
  • QI192271
    Isavuconazole Impurity 71
    CAS# NA
    M.F.: C50H55ClF2N10O10S
    M.W.: 1061.55
  • QB200109
    Betamethasone Dipropionate EP Impurity I
    CAS# 80163-83-3
    M.F.: C28H39FO7
    M.W.: 506.60
  • QD0207102
    Dabigatran Etexilate Impurity 102
    CAS# 1900865-84-0
    M.F.: C16H12N4O
    M.W.: 276.29
  • QD0207101
    Dabigatran Etexilate Impurity 101
    CAS# 18358-63-9
    M.F.: C9H11NO2
    M.W.: 165.19
  • QS0102106
    Salbutamol Impurity 106
    CAS# NA
    M.F.: C22H31NO6
    M.W.: 405.48
  • QS0102105
    Salbutamol Impurity 105
    CAS# 1888806-75-4
    M.F.: C8H9BrO2
    M.W.: 217.06
  • QS010298
    Salbutamol Impurity 98
    CAS# 1044764-21-7
    M.F.: C9H11NO3
    M.W.: 181.19
  • QM200315
    Metoclopramide Impurity 15
    CAS# 3761-48-6;52423-58-2(HCl salt)
    M.F.: C14H23N3O2
    M.W.: 265.35
  • QT011415
    Tandospirone Impurity 15
    CAS# NA
    M.F.: C13H18BrNO2
    M.W.: 300.19
  • QM131931
    21-Acetyloxy Deschloromometasone Furoate
    CAS# 83897-05-6
    M.F.: C29H33ClO8
    M.W.: 545.02
  • QI091635
    Ipratropium Bromide Impurity 35
    CAS# NA
    M.F.: C11H19NO2
    M.W.: 197.27
  • QF130427
    Famotidine Impurity 27
    CAS# NA
    M.F.: C9H15N7O2S3
    M.W.: 349.46
  • QI192901
    Gambogic acid
    CAS# 2752-65-0
    M.F.: C38H44O8
    M.W.: 628.75
  • QI192267
    Isavuconazole Impurity 67
    CAS# NA
    M.F.: C15H23N3O4
    M.W.: 309.36
  • QD0207100
    Dabigatran Etexilate Impurity 100
    CAS# NA
    M.F.: C18H22N4O3
    M.W.: 342.39
  • QD020799
    Dabigatran Etexilate Impurity 99
    CAS# NA
    M.F.: C18H22N4O3
    M.W.: 342.39
  • QD020798
    Dabigatran Etexilate Impurity 98
    CAS# NA
    M.F.: C27H28N6O4
    M.W.: 500.55
  • QI191643
    Isoproterenol Impurity 43
    CAS# 3868-81-3
    M.F.: C12H19NO3.HCl
    M.W.: 225.28 36.46
  • QC-C250351
    cyclohexylmethanol;Benzyl alcohol EP Impurity B
    CAS# 100-49-2
    M.F.: C7H14O
    M.W.: 114.19
  • QP053100
    Pelargonidin chloride
    CAS# 134-04-3
    M.F.: C15H11ClO5
    M.W.: 306.70
  • QT130611
    Tamoxifen Citrate Impurity 11
    CAS# NA
    M.F.: C28H35NO2
    M.W.: 417.58
  • QA260406
    Ricinoleic acid
    CAS# 141-22-0
    M.F.: C18H34O3
    M.W.: 298.46
  • QR457048
    Rocuronium bromide Impurity 48;Androsterone
    CAS# 53-41-8
    M.F.: C19H30O2
    M.W.: 290.44
  • QB053406
    Benzydamine Hydrochloride EP Impurity F
    CAS# 87453-75-6
    M.F.: C12H18N2O2
    M.W.: 222.28
  • QB053405
    Benzydamine Hydrochloride EP Impurity E
    CAS# 52413-42-0;85284-06-6(HCl salt)
    M.F.: C19H23N3O
    M.W.: 309.41
  • QB053404
    Benzydamine Hydrochloride EP Impurity D
    CAS# 1337966-15-0
    M.F.: C23H32N4O
    M.W.: 380.53
  • QB053403
    Benzydamine Hydrochloride EP Impurity C
    CAS# 2215-63-6
    M.F.: C14H12N2O
    M.W.: 224.26
  • QB053402
    Benzydamine Hydrochloride EP Impurity B
    CAS# 1797879-37-8;2196183-71-6(HCl salt)
    M.F.: C26H29N3O
    M.W.: 399.53
  • QB053401
    Benzydamine Hydrochloride EP Impurity A
    CAS# 87453-76-7;2196185-65-4(HCl salt)
    M.F.: C19H24N2O2
    M.W.: 312.41
  • QB053400
    Benzydamine Hydrochloride
    CAS# 132-69-4
    M.F.: C19H23N3O.HCl
    M.W.: 309.41 36.46
  • QC065303
    1-Caffeoylquinic acid
    CAS# 1241-87-8
    M.F.: C16H18O9
    M.W.: 354.31
  • QI142503
    Indocyanine Green Impurity 3
    CAS# NA
    M.F.: C44H50N2O6S2
    M.W.: 767.01
  • QI142502
    Indocyanine Green Impurity 2
    CAS# NA
    M.F.: C44H50N2O6S2
    M.W.: 767.01
  • QI142501
    Indocyanine Green N-Oxide
    CAS# NA
    M.F.: C43H47N2NaO7S2
    M.W.: 790.96
  • QI142500
    Indocyanine Green
    CAS# 3599-32-4
    M.F.: C43H47N2NaO6S2
    M.W.: 774.96
  • QP090324
    Sodium Picosulfate Impurity 24
    CAS# NA
    M.F.: C19H17NO3
    M.W.: 307.34
  • QL010320
    L-Alanine Isopropyl Ester Lactose Adduct
    CAS# NA
    M.F.: C18H33NO12
    M.W.: 455.45
  • QL091673
    Lipoic Acid Impurity 73
    CAS# NA
    M.F.: C10H18O2S3
    M.W.: 266.44
  • QZ151210
    Zoledronic acid Impurity 10
    CAS# 239065-60-2
    M.F.: C8H12N2O2
    M.W.: 168.19
  • QI192900
    Isogambogic acid
    CAS# 149655-52-7
    M.F.: C38H44O8
    M.W.: 628.75
  • QE161700
    Epigambogic acid
    CAS# 887606-04-4
    M.F.: C38H44O8
    M.W.: 628.75
  • QG010200
    Gambogenic acid
    CAS# 173932-75-7
    M.F.: C38H46O8
    M.W.: 630.77
  • QM154300
    Morellic acid
    CAS# 5304-71-2
    M.F.: C33H36O8
    M.W.: 560.63
  • QF123702
    Florfenicol Impurity 2
    CAS# NA
    M.F.: C12H14Cl2FNO4S
    M.W.: 358.21
  • QT161894
    Topiroxostat Impurity 94
    CAS# NA
    M.F.: C8H5N5O
    M.W.: 187.16
  • QP160533
    Prednisone EP Impurity K
    CAS# 7738-93-4
    M.F.: C19H22O3
    M.W.: 298.38
  • QI192265
    Isavuconazole Impurity 65
    CAS# NA
    M.F.: C40H43ClF2N8O7S
    M.W.: 853.33
  • QA261960
    Azilsartan Impurity 60
    CAS# 91526-16-8
    M.F.: C12H12O6S
    M.W.: 284.29
  • QD242615
    Doxazosin Impurity 15
    CAS# 60547-96-8
    M.F.: C10H12N4O2
    M.W.: 220.23
  • QS040687
    Sildenafil Impurity 87
    CAS# 501120-38-3
    M.F.: C17H22N4O3
    M.W.: 330.38
  • QD141647
    Donepezil Impurity 47
    CAS# NA
    M.F.: C24H29NO3.HCl
    M.W.: 379.49 36.46
  • QC150900
    Colistin sulfate
    CAS# 1264-72-8
    M.F.: C53H100N16O13.5/2H2SO4+C52H98N16O13.5/2H2SO4
    M.W.: 1169.46 245.20+1155.43 245.20
  • QP090323
    Sodium Picosulfate Impurity 23
    CAS# NA
    M.F.: C22H19NO4
    M.W.: 361.39
  • QP090322
    Sodium Picosulfate Impurity 22
    CAS# NA
    M.F.: C22H19NO4
    M.W.: 361.39
  • QV011232
    Valproic Acid Impurity 32
    CAS# NA
    M.F.: C15H28O4
    M.W.: 272.38
  • QV011231
    Valproic Acid Impurity 31
    CAS# NA
    M.F.: C14H26O4
    M.W.: 258.35
  • QC-H042405
    Butyl parahydroxybenzoate;
    Propyl Parahydroxybenzoate EP Impurity D;
    Sodium ethyl parahydroxybenzoate EP Impurity D

    CAS# 94-26-8
    M.F.: C11H14O3
    M.W.: 194.23
  • QG011208
    N-Nitroso Galantamine EP Impurity E
    CAS# NA
    M.F.: C16H18N2O4
    M.W.: 302.33
  • QO131908
    Olmesartan Medoxomil Impurity 8
    CAS# NA
    M.F.: C49H53ClN8O10
    M.W.: 949.45
  • QM122507
    Melatonin Impurity 7
    CAS# 188397-16-2 (keton form), 229018-17-1 (enol form)
    M.F.: C13H16N2O3
    M.W.: 248.28
  • QO260765
    Ozagrel Impurity 65
    CAS# 67688-89-5(HCl salt)
    M.F.: C10H11NO2
    M.W.: 177.20
  • QA0702108
    Argatroban Impurity 108
    CAS# NA
    M.F.: C15H28N6O5
    M.W.: 372.42
  • QS041920
    Sodium Valproate Impurity 20
    CAS# 258264-00-5
    M.F.: C11H20O4
    M.W.: 216.27
  • QI091634
    Ipratropium Bromide Impurity 34
    CAS# NA
    M.F.: C20H28BrNO2
    M.W.: 394.35
  • QP182712
    Piribedil Impurity 12
    CAS# 1580471-72-2
    M.F.: C8H8Cl2O2
    M.W.: 207.05
  • QP182707
    Piribedil Impurity 7
    CAS# 55436-41-4
    M.F.: C20H22N2O4
    M.W.: 354.40
  • QP182706
    Piribedil Impurity 6
    CAS# 443694-35-7
    M.F.: C12H18N2O2
    M.W.: 222.28
  • QP182704
    Piribedil Impurity 4
    CAS# NA
    M.F.: C7H7ClO2
    M.W.: 158.58
  • QR210601
    Rufinamide USP Related Compound A
    CAS# 106308-41-2
    M.F.: C10H9FN4O
    M.W.: 220.20
  • QB010437
    Bazedoxifene Acetate Impurity 37
    CAS# NA
    M.F.: C44H46N2O3
    M.W.: 650.85
  • QR152439
    Roxadustat Impurity 39
    CAS# NA
    M.F.: C22H22N2O5
    M.W.: 394.42
  • QI192251
    Isavuconazole Impurity 51
    CAS# 2069200-13-9
    M.F.: C13H12F2N4O
    M.W.: 278.26
  • QO121828
    Olprinone Impurity 28
    CAS# NA
    M.F.: C12H14N2O
    M.W.: 202.25
  • QM031632
    Mycophenolic Acid Impurity 32
    CAS# NA
    M.F.: C23H32O11
    M.W.: 484.49
  • QV200107
    Vitamin A Impurity 7
    CAS# 34356-30-4
    M.F.: C36H60O2
    M.W.: 524.86
  • QV041424
    Vardenafil Impurity 24
    CAS# NA
    M.F.: C17H19ClN4O2
    M.W.: 346.81
  • QT260400
    Trazodone hydrochloride
    CAS# 25332-39-2
    M.F.: C19H22ClN5O.HCl
    M.W.: 371.86 36.46
  • QT1406183
    Tenofovir Impurity 183
    CAS# NA
    M.F.: C33H49N6O15P
    M.W.: 800.75
  • QU190449
    Deoxycholic Acid Ethyl Ester
    CAS# 69519-35-3
    M.F.: C26H44O4
    M.W.: 420.63
  • QD150211
    Dobutamine Impurity 11
    CAS# 69617-84-1
    M.F.: C10H14O2
    M.W.: 166.22
  • QC-H052419
    Hexadecanedioic acid
    CAS# 505-54-4
    M.F.: C16H30O4
    M.W.: 286.41
  • QP092706
    Pinaverium Bromide Impurity 6
    CAS# 135964-95-3
    M.F.: C26H41Br2NO4
    M.W.: 591.42
  • QP092705
    Pinaverium Bromide Impurity 5
    CAS# 1970218-70-2
    M.F.: C26H41Br2NO4
    M.W.: 591.42
  • QC061914
    Ceftaroline Fosamil Impurity N
    CAS# 1286218-68-5
    M.F.: C44H40N16O15P2S8
    M.W.: 1351.35
  • QC061913
    Ceftaroline Fosamil Impurity M
    CAS# 1277090-04-6
    M.F.: C28H35N12O10PS4
    M.W.: 858.89
  • QC061912
    Ceftaroline Fosamil
    CAS# 229016-73-3
    M.F.: C22H21N8O8PS4
    M.W.: 684.68
  • QC061911
    Ceftaroline Fosamil Impurity K
    CAS# 1286218-64-1
    M.F.: C22H22N8O11P2S4
    M.W.: 764.66
  • QE161249
    Epalrestat Impurity 23
    CAS# 15289-56-2
    M.F.: C13H11NOS2
    M.W.: 261.36
  • QL252028
    Lysine Impurity 28;
    DL-Lysine acetylsalicylate EP Impurity C

    CAS# NA
    M.F.: C12H26N4O3
    M.W.: 274.36
  • QZ121623
    Zolpidem tartrate Impurity 23
    CAS# NA
    M.F.: C19H25N3O
    M.W.: 311.42
  • QG211205
    Sodium Gualenate Impurity 5
    CAS# 111631-17-5
    M.F.: C5H8N2O2
    M.W.: 128.13
  • QD020797
    Dabigatran Etexilate Impurity 97
    CAS# 1307233-94-8
    M.F.: C20H21ClN4O3
    M.W.: 400.86
  • QD241358
    Dexamethasone Impurity 58
    CAS# 6762-51-2
    M.F.: C22H27FO4
    M.W.: 374.45
  • QI591816
    Imidacloprid Impurity 16
    CAS# 380912-09-4
    M.F.: C9H10ClN5O3
    M.W.: 271.66
  • QC-M052504
    methyl 2-amino-3-bromobenzoate
    CAS# 104670-74-8
    M.F.: C8H8BrNO2
    M.W.: 230.06
  • QL032002
    Lactitol monohydrate EP Impurity B;Lactulitol
    CAS# 53796-37-5
    M.F.: C12H24O11
    M.W.: 344.31
  • QA163003
    Apremilast Impurity W
    CAS# 253168-94-4
    M.F.: C12H19NO4S
    M.W.: 273.35
  • QL091672
    Lipoic Acid Impurity 46
    CAS# NA
    M.F.: C8H14O3S2
    M.W.: 222.32
  • QN151863
    Noradrenaline (Norepinephrine) Impurity 63
    CAS# NA
    M.F.: C9H13NO6S
    M.W.: 263.27
  • QD160701
    Dapagliflozin Impurity A
    CAS# 1807632-95-6
    M.F.: C21H25BrO6
    M.W.: 453.32
  • QP091326
    Pimavanserin Impurity 26
    CAS# NA
    M.F.: C25H34FN3O2
    M.W.: 427.55
  • QP180458
    Perindopril EP Impurity X
    CAS# NA
    M.F.: C19H32N2O5
    M.W.: 368.47
  • QP180453
    Perindopril EP Impurity Q
    CAS# NA
    M.F.: C19H32N2O5
    M.W.: 368.47
  • QD090710
    Diclazuril Impurity 10
    CAS# 103317-59-5
    M.F.: C14H7Cl3N2O2
    M.W.: 341.58
  • QP261639
    Pazopanib Impurity 39
    CAS# NA
    M.F.: C34H34N12O2S
    M.W.: 674.78
  • QP181679
    Pramipexole Impurity 79
    CAS# 106006-83-1
    M.F.: C7H11N3S
    M.W.: 169.25
  • QC120453
    Clindamycin Pentadecanoate
    CAS# 1123211-67-5
    M.F.: C33H61ClN2O6S
    M.W.: 649.37
  • QG270101
    GCTA Impurity 1
    CAS# NA
    M.F.: C29H27N3O5S2
    M.W.: 561.67
  • QC042024
    Cefditoren pivoxil Impurity 24
    CAS# NA
    M.F.: C19H17N6NaO5S3
    M.W.: 528.56
  • QT180126
    Travoprost Impurity 26
    CAS# NA
    M.F.: C24H30O4Si
    M.W.: 410.58
  • QC012311
    Carteolol Impurity 11
    CAS# NA
    M.F.: C9H8BrNO2
    M.W.: 242.07
  • QC042023
    Cefditoren pivoxil Impurity 23
    CAS# NA
    M.F.: C50H56N12O14S6
    M.W.: 1241.44
  • QC042022
    Cefditoren pivoxil Impurity 22
    CAS# 878002-85-8
    M.F.: C51H56N12O14S6
    M.W.: 1253.45
  • QI191641
    Isoproterenol Impurity 15
    CAS# NA
    M.F.: C11H17NO3
    M.W.: 211.26
  • QR152436
    Roxadustat Impurity 36
    CAS# 1455091-04-9
    M.F.: C15H13ClO3
    M.W.: 276.71
  • QT031241
    Tacrolimus Impurity 41
    CAS# NA
    M.F.: C46H75NO13
    M.W.: 850.09
  • QH251400
    Sodium Hyaluronate
    CAS# 9067-32-7
    M.F.: (C14H20NNaO11)n
    M.W.: NA
  • QK201841
    Ketorolac Impurity 41
    CAS# NA
    M.F.: C17H17NO3
    M.W.: 283.32
  • QA200118
    Atazanavir EP Impurity H
    CAS# NA
    M.F.: C38H52N6O7
    M.W.: 704.86
  • QH150918
    Hyoscine Butylbromide EP Impurity H
    CAS# NA
    M.F.: C21H32BrNO3
    M.W.: 426.39
  • QA200116
    Atazanavir EP Impurity F
    CAS# 1332981-14-2
    M.F.: C38H52N6O7
    M.W.: 704.86
  • QV091208
    Vilanterol Impurity 8
    CAS# 452340-96-4
    M.F.: C13H15NO4
    M.W.: 249.26
  • QP090321
    Sodium Picosulfate Impurity 21
    CAS# NA
    M.F.: C18H13NNa2O8S2
    M.W.: 481.41
  • QA164183
    Avanafil Impurity 57
    CAS# NA
    M.F.: C40H43Cl2N11O6
    M.W.: 844.75
  • QF122046
    Fluticasone Furoate EP Impurity I
    CAS# NA
    M.F.: C27H29F3O6S
    M.W.: 538.58
  • QB051318
    Bempedoic acid Impurity 18
    CAS# NA
    M.F.: C38H70O9
    M.W.: 670.96
  • QT201625
    Tiotropium bromide Impurity 25
    CAS# 3141-26-2
    M.F.: C4H2Br2S
    M.W.: 241.93
  • QT201624
    Tiotropium bromide Impurity 24
    CAS# 3140-93-0
    M.F.: C4H2Br2S
    M.W.: 241.93
  • QT201623
    Tiotropium bromide Impurity 23
    CAS# 3141-27-3
    M.F.: C4H2Br2S
    M.W.: 241.93
  • QT201622
    Tiotropium bromide Impurity 22
    CAS# 3140-92-9
    M.F.: C4H2Br2S
    M.W.: 241.93
  • QU190447
    Ursodeoxycholic Acid Impurity 47
    CAS# 2393-61-5
    M.F.: C24H38O4
    M.W.: 390.56
  • QR051224
    Relugolix Impurity 24
    CAS# NA
    M.F.: C30H28F2N6O5S
    M.W.: 622.64
  • QF121936
    Fulvestrant Impurity 36
    CAS# NA
    M.F.: C5H5F5I2O3S
    M.W.: 493.96
  • QO162023
    Olopatadine Impurity 23
    CAS# NA
    M.F.: C20H21NO2 HCl
    M.W.: 307.39 36.46
  • QU190446
    Ursodeoxycholic Acid Impurity 46
    CAS# 71883-64-2
    M.F.: C24H40O5
    M.W.: 408.57
  • QU190445
    Ursodeoxycholic Acid Impurity 45
    CAS# 14772-92-0
    M.F.: C25H40O5
    M.W.: 420.58
  • QB211400
    Butenafine
    CAS# 101828-21-1
    M.F.: C23H27N
    M.W.: 317.47
  • QU190443
    Ursodeoxycholic Acid Impurity 43
    CAS# 108266-90-6
    M.F.: C24H40O5
    M.W.: 408.57
  • QU190442
    Ursodeoxycholic Acid Impurity 42
    CAS# 67008-26-8
    M.F.: C24H38O4
    M.W.: 390.56
  • QU190441
    Ursodeoxycholic Acid Impurity 41
    CAS# 110107-03-4
    M.F.: C24H38O4
    M.W.: 390.56
  • QD030459
    Diclofenac sodium Impurity 59
    CAS# NA
    M.F.: C15H11Cl2NO
    M.W.: 292.16
  • QC061357
    Cefotiam Impurity 57
    CAS# NA
    M.F.: C36H44N18O7S6
    M.W.: 1033.24
  • QU190438
    12-Ketolithocholic acid
    CAS# 5130-29-0
    M.F.: C24H38O4
    M.W.: 390.56
  • QU190437
    3-Hydroxy-7,12-diketocholanoic acid
    CAS# 517-33-9
    M.F.: C24H36O5
    M.W.: 404.54
  • QS067647
    Salicylic Acid Impurity 47
    CAS# NA
    M.F.: C7H4NNaO4
    M.W.: 189.10
  • QS067646
    Salicylic Acid Impurity 46
    CAS# 1172605-63-8(free base)
    M.F.: C7H4NNaO4
    M.W.: 189.10
  • QA131255
    Amlodipine Impurity 55
    CAS# 140171-49-9
    M.F.: C29H29ClN2O7
    M.W.: 553.00
  • QO022033
    Obeticholic Acid Impurity 33
    CAS# NA
    M.F.: C35H52O5Si
    M.W.: 580.87
  • QN051819
    Neratinib Impurity 19
    CAS# 20629-35-0
    M.F.: C4H5BrO2
    M.W.: 164.99
  • QD053401
    Delfaprazine Impurity 1
    CAS# 791026-42-1
    M.F.: C17H19ClN2
    M.W.: 286.80
  • QR1922137
    Rosuvastatin Impurity 137
    CAS# NA
    M.F.: C13H15NO5S2
    M.W.: 329.39
  • QR1922134
    Rosuvastatin Impurity 134
    CAS# NA
    M.F.: C20H27NO5S2
    M.W.: 425.56
  • QR1922133
    Rosuvastatin Impurity 133
    CAS# 325471-28-1
    M.F.: C10H19ClO4
    M.W.: 238.71
  • QR1922131
    Rosuvastatin Impurity 131
    CAS# NA
    M.F.: C13H15NO4S2
    M.W.: 313.39
  • QR1922130
    Rosuvastatin Impurity 130
    CAS# NA
    M.F.: C16H19NO4S2
    M.W.: 353.46
  • QC022655
    Cabozantinib Impurity 55
    CAS# 1355031-15-0
    M.F.: C16H14N2O3
    M.W.: 282.29
  • QT011409
    Tandospirone Impurity 9
    CAS# NA
    M.F.: C21H27N5O3
    M.W.: 397.47
  • QG122201
    Glutamic Acid Impurity 1
    CAS# 3929-61-1
    M.F.: C10H16N2O7
    M.W.: 276.24
  • QT180685
    Tirofiban Impurity 85
    CAS# NA
    M.F.: C12H17Cl2N
    M.W.: 246.18
  • QO242801
    Oxonic Acid Impurity 1
    CAS# 60301-55-5
    M.F.: C3H3N3O2
    M.W.: 113.07
  • QP1903174
    Posaconazole Impurity 174
    CAS# NA
    M.F.: C24H31N5O3
    M.W.: 437.53
  • QA261950
    Azilsartan Impurity 50
    CAS# NA
    M.F.: C29H23N3O6
    M.W.: 509.51
  • QA261949
    Azilsartan Impurity 49
    CAS# NA
    M.F.: C27H22N4O7
    M.W.: 514.49
  • QZ010600
    Zafirlukast
    CAS# 107753-78-6
    M.F.: C31H33N3O6S
    M.W.: 575.68
  • QB011216
    Baclofen Impurity 16
    CAS# NA
    M.F.: C20H20Cl2N2O2
    M.W.: 391.29
  • QB011212
    Baclofen Impurity 12
    CAS# NA
    M.F.: C20H22Cl2N2O3
    M.W.: 409.31
  • QS212600
    Sulfadimethoxine
    CAS# 122-11-2
    M.F.: C12H14N4O4S
    M.W.: 310.33
  • QM201826
    Metaraminol Impurity 26
    CAS# 1075-61-2;54779-56-5(HCl salt)
    M.F.: C9H13NO
    M.W.: 151.21
  • QL091671
    Lipoic Acid Impurity 45
    CAS# NA
    M.F.: C12H20N2OS2
    M.W.: 272.43
  • QA161884
    Aprepitant Impurity 84
    CAS# NA
    M.F.: C21H19F6NO3
    M.W.: 447.37
  • QP160628
    Propofol Impurity 28
    CAS# NA
    M.F.: C13H18O3
    M.W.: 222.28
  • QT0307195
    Ticagrelor Impurity 195
    CAS# 1345413-20-8(free base)
    M.F.: C9H9F2N C8H8O3
    M.W.: 169.17 152.15
  • QV011230
    Valproic Acid Impurity 4
    CAS# NA
    M.F.: C6H12O2
    M.W.: 116.16
  • QL091670
    Lipoic Acid Impurity 44
    CAS# NA
    M.F.: C10H18O2S
    M.W.: 202.31
  • QF120322
    Folic Acid Impurity 22
    CAS# 1148179-25-2
    M.F.: C21H25N7O7
    M.W.: 487.47
  • QP160625
    Propofol Impurity 25
    CAS# NA
    M.F.: C26H34O5
    M.W.: 426.55
  • QE2003111
    Entecavir Impurity 111
    CAS# NA
    M.F.: C51H47N5O4
    M.W.: 793.95
  • QE1316157
    Empagliflozin Impurity 157
    CAS# NA
    M.F.: C17H17BrO2
    M.W.: 333.22
  • QM142414
    Minoxidil Impurity 14
    CAS# NA
    M.F.: C4H5ClN4O
    M.W.: 160.56
  • QO1920129
    Oseltamivir Impurity 129
    CAS# NA
    M.F.: C24H42N2O3
    M.W.: 406.60
  • QO1920128
    Oseltamivir Impurity 128
    CAS# NA
    M.F.: C24H42N2O3
    M.W.: 406.60
  • QT142427
    Tranexamic Acid Impurity 27
    CAS# NA
    M.F.: C8H7Cl2NO
    M.W.: 204.05
  • QO201567
    Vortioxetine Impurity 41
    CAS# 1025895-66-2
    M.F.: C17H19NS
    M.W.: 269.40
  • QO201566
    Vortioxetine Impurity 40
    CAS# 62755-64-0
    M.F.: C16H18N2O
    M.W.: 254.33
  • QO022026
    Obeticholic Acid Impurity 26
    CAS# 4185-00-6
    M.F.: C24H38O4
    M.W.: 390.56
  • QU190436
    Ursodeoxycholic Acid Impurity 36
    CAS# 77059-13-3
    M.F.: C24H38O4
    M.W.: 390.56
  • QM200508
    Methylene Blue Impurity 8
    CAS# 823802-43-3
    M.F.: C12H7N3O4S
    M.W.: 289.27
  • QM200507
    Methylene Blue Impurity 7
    CAS# 860443-88-5
    M.F.: C12H5N5O8S
    M.W.: 379.26
  • QM200506
    Methylene Blue Impurity 6
    CAS# 1747-87-1
    M.F.: C12H8N2O2S
    M.W.: 244.27
  • QM200505
    Methylene Blue Impurity 5
    CAS# 1628-76-8
    M.F.: C12H8N2O2S
    M.W.: 244.27
  • QM200504
    Methylene Blue Impurity 4
    CAS# 1628-77-9
    M.F.: C12H8N2O2S
    M.W.: 244.27
  • QM200503
    Methylene Blue Impurity 3
    CAS# 77529-65-8
    M.F.: C12H6N4O6S
    M.W.: 334.26
  • QM200502
    Methylene Blue Impurity 2
    CAS# NA
    M.F.: C12H7N3O4S
    M.W.: 289.27
  • QM200501
    Methylene Blue Impurity 1
    CAS# 1628-78-0
    M.F.: C12H7N3O4S
    M.W.: 289.27
  • QR152434
    Roxadustat Impurity 34
    CAS# 1421312-34-6
    M.F.: C18H15NO4
    M.W.: 309.32
  • QP160622
    Propofol Impurity 22
    CAS# 2005-09-6
    M.F.: C19H22O2
    M.W.: 282.38
  • QS040675
    Sildenafil Impurity 75
    CAS# 17243-13-9
    M.F.: C7H5ClO5S
    M.W.: 236.63
  • QM092609
    Mizolastine Impurity 9
    CAS# 935860-12-1
    M.F.: C25H27FN6O
    M.W.: 446.52
  • QC182585
    Canagliflozin Impurity 85
    CAS# NA
    M.F.: C24H25FO7S
    M.W.: 476.51
  • QP011408
    Calcium Pantothenate Impurity 8
    CAS# NA
    M.F.: C18H32CaN2O10
    M.W.: 476.53
  • QP011407
    Pantothenic acid calcium Impurity 7
    CAS# NA
    M.F.: C10H17NO5
    M.W.: 231.25
  • QA220139
    Avatrombopag Impurity 39
    CAS# NA
    M.F.: C29H34Cl2N6O4S2
    M.W.: 665.65
  • QT082000
    L-Threonic Acid
    CAS# 7306-96-9;70753-61-6(Ca salt)
    M.F.: C4H8O5
    M.W.: 136.10
  • QT201621
    Tiotropium bromide Impurity 21
    CAS# NA
    M.F.: C19H21ClINO3S2
    M.W.: 537.86
  • QE2620104
    Ezetimibe Impurity 104
    CAS# 2280081-72-1
    M.F.: C39H47FN2O5Si2
    M.W.: 698.97
  • QP182254
    Peramivir Impurity 54
    CAS# NA
    M.F.: C16H28N2O5
    M.W.: 328.40
  • QR1922123
    Rosuvastatin Impurity 123
    CAS# NA
    M.F.: C22H28FN3O6S
    M.W.: 481.54
  • QM071204
    Miglitol Impurity 4
    CAS# NA
    M.F.: C8H11NO2
    M.W.: 153.18
  • QP1903161
    Posaconazole Impurity 161
    CAS# 1185745-03-2
    M.F.: C34H45N5O5
    M.W.: 603.75
  • QP1903158
    Posaconazole Impurity 158
    CAS# NA
    M.F.: C16H19N3O
    M.W.: 269.34
  • QN022228
    Nebivolol Impurity 28
    CAS# NA
    M.F.: C20H37N
    M.W.: 291.51
  • QD241355
    Dexamethasone Impurity 55
    CAS# 1188271-71-7(aldehyde form)
    M.F.: C22H29FO5.C22H27FO4
    M.W.: 392.47 374.45
  • QB051317
    Bempedoic acid Impurity 17
    CAS# 2570179-40-5
    M.F.: C25H48O6
    M.W.: 444.65
  • QE191330
    Esmolol Impurity 30
    CAS# 495-78-3
    M.F.: C9H10O3
    M.W.: 166.17
  • QE191328
    Esmolol Impurity 28
    CAS# 22367-76-6
    M.F.: C9H11NO2
    M.W.: 165.19
  • QE191325
    Esmolol Impurity 25
    CAS# NA
    M.F.: C28H39NO8
    M.W.: 517.61
  • QL091669
    Lipoic Acid Impurity 43
    CAS# NA
    M.F.: C10H20O2S2
    M.W.: 236.39
  • QL091668
    Lipoic Acid Impurity 42
    CAS# NA
    M.F.: C10H18O2S
    M.W.: 202.31
  • QL091667
    Lipoic Acid Impurity 41
    CAS# NA
    M.F.: C16H26O5S4
    M.W.: 426.63
  • QV091206
    Vilanterol Impurity 6
    CAS# NA
    M.F.: C24H31Cl2NO5
    M.W.: 484.41
  • QP051207
    Penicillin Impurity 7
    CAS# NA
    M.F.: C16H18N2O6S
    M.W.: 366.39
  • QA661222
    Ampicillin Impurity 22
    CAS# NA
    M.F.: C24H33N3O5S
    M.W.: 475.60
  • QI131200
    Imiprothrin
    CAS# 72963-72-5
    M.F.: C17H22N2O4
    M.W.: 318.37
  • QN022225
    Nebivolol Impurity 25
    CAS# 1346562-35-3
    M.F.: C22H21F2NO4
    M.W.: 401.40
  • QL051301
    Folinic Acid Impurity 1
    CAS# 4349-41-1
    M.F.: C15H18N6O3
    M.W.: 330.34
  • QB180961
    Brivaracetam Impurity 35
    CAS# NA
    M.F.: C11H21BrN2O2
    M.W.: 293.20
  • QV180395
    Voriconazole Impurity 69
    CAS# NA
    M.F.: C16H13BrF3N5O
    M.W.: 428.21
  • QV180394
    Voriconazole Impurity 68
    CAS# NA
    M.F.: C16H14F3N5O2
    M.W.: 365.31
  • QT0307194
    Ticagrelor Impurity 194
    CAS# 2204313-65-3
    M.F.: C17H27ClN4O6S
    M.W.: 450.94
  • QM151700
    Metopimazine Acid
    CAS# 18182-00-8
    M.F.: C22H26N2O4S2
    M.W.: 446.58
  • QL241688
    Loxoprofen Impurity 62
    CAS# NA
    M.F.: C22H26O5
    M.W.: 370.44
  • QD050128
    Dexrazoxane Impurity 28
    CAS# NA
    M.F.: C11H15N4O4
    M.W.: 267.26
  • QS111677
    Sitafloxacin Impurity 51
    CAS# 185225-84-7;149404-98-8(free base)
    M.F.: C3H6FN.C7H8O3S
    M.W.: 75.09 172.20
  • QP140303
    Pancuronium bromide EP Impurity C
    CAS# 15500-65-9
    M.F.: C31H56Br2N2O2
    M.W.: 648.60
  • QP140302
    Pancuronium bromide EP Impurity B
    CAS# 41261-71-6;43021-44-9(cation form)
    M.F.: C33H58Br2N2O3
    M.W.: 690.63
  • QP140301
    Pancuronium bromide EP Impurity A
    CAS# 27115-86-2
    M.F.: C33H58Br2N2O3
    M.W.: 690.63
  • QI192108
    Isoflurane Impurity 8
    CAS# NA
    M.F.: C5H5F7O2
    M.W.: 230.08
  • QZ151209
    Zoledronic acid Impurity 9
    CAS# 1313885-85-6
    M.F.: C6H12N2O7P2
    M.W.: 286.12
  • QZ151208
    Zoledronic acid Impurity 8
    CAS# 118054-52-7
    M.F.: C6H12N2O7P2
    M.W.: 286.12
  • QL091666
    Lipoic Acid Impurity 40
    CAS# 100386-08-1
    M.F.: C12H24O2S2
    M.W.: 264.45
  • QT202001
    Tetrahydrobiopterin Impurity 1
    CAS# NA
    M.F.: C813CH15N215N3O3 2C2HF3O2
    M.W.: 245.22 228.04
  • QF151600
    Fosphenytoin Disodium Salt
    CAS# 92134-98-0;93390-81-9 (free base)
    M.F.: C16H13N2Na2O6P
    M.W.: 406.24
  • QD121842
    Desloratadine Impurity 42
    CAS# 119410-05-8
    M.F.: C19H19ClN2O
    M.W.: 326.82
  • QV180393
    Voriconazole Impurity 67
    CAS# NA
    M.F.: C22H18ClF4N7O
    M.W.: 507.87
  • QL252024
    DL-Lysine acetylsalicylate EP Impurity K
    CAS# NA
    M.F.: C15H20N2O5
    M.W.: 308.33
  • QL252023
    DL-Lysine acetylsalicylate EP Impurity I
    CAS# NA
    M.F.: C15H20N2O5
    M.W.: 308.33
  • QL252022
    Lysine aspirin Impurity 22
    CAS# NA
    M.F.: C15H20N2O5
    M.W.: 308.33
  • QL252021
    DL-Lysine acetylsalicylate EP Impurity J
    CAS# NA
    M.F.: C13H18N2O4
    M.W.: 266.29
  • QT120217
    Tulobuterol Impurity 17
    CAS# 69240-90-0
    M.F.: C12H18ClNO
    M.W.: 227.73
  • QT120207
    Tulobuterol Impurity 7
    CAS# 133662-20-1
    M.F.: C8H7ClO2
    M.W.: 170.59
  • QD030457
    Diclofenac sodium Impurity 57
    CAS# 304884-75-1
    M.F.: C14H11Cl2NO
    M.W.: 280.15
  • QE262097
    Ezetimibe Impurity 97
    CAS# NA
    M.F.: C39H46F2N2O5Si2
    M.W.: 716.96
  • QT031884
    Vitamin E Impurity 84
    CAS# NA
    M.F.: C32H54O3
    M.W.: 486.77
  • QT031882
    Vitamin E Impurity 82
    CAS# NA
    M.F.: C31H52O3
    M.W.: 472.74
  • QP051304
    Perampanel Impurity 4
    CAS# 380918-51-4
    M.F.: C22H16N2O
    M.W.: 324.38
  • QE262090
    Ezetimibe Impurity 90
    CAS# NA
    M.F.: C39H46F2N2O5Si2
    M.W.: 716.96
  • QA162978
    Apremilast Impurity 78
    CAS# NA
    M.F.: C16H10N2O7
    M.W.: 342.26
  • QA162975
    Apremilast Impurity 75
    CAS# NA
    M.F.: C16H12N2O8
    M.W.: 360.28
  • QI182053
    Ibrutinib Impurity 53
    CAS# NA
    M.F.: C27H28N6O3
    M.W.: 484.55
  • QR201422
    Ritonavir EP Impurity S
    CAS# NA
    M.F.: C52H61N7O8S2
    M.W.: 976.21
  • QF122922
    Fluocinolone acetonide Impurity 22
    CAS# NA
    M.F.: C26H32ClFO7
    M.W.: 510.98
  • QP156534
    Progesterone Impurity 34
    CAS# 88128-62-5
    M.F.: C23H36O4
    M.W.: 376.53
  • QR1922118
    Rosuvastatin Impurity 118
    CAS# 122549-26-2
    M.F.: C14H15FO3
    M.W.: 250.27
  • QN152710
    Norethindrone Impurity 10
    CAS# 1670-34-4
    M.F.: C20H26O2
    M.W.: 298.42
  • QM202425
    Methotrexate Impurity 25
    CAS# NA
    M.F.: C4H5N6
    M.W.: 137.12
  • QA200370
    Atracurium besilate EP Impurity K
    CAS# NA
    M.F.: C54H74N2O12
    M.W.: 943.17
  • QA200369
    Atracurium besilate EP Impurity I
    CAS# NA
    M.F.: C54H74N2O12
    M.W.: 943.17
  • QA200368
    Atracurium besilate EP Impurity H
    CAS# NA
    M.F.: C54H74N2O12
    M.W.: 943.17
  • QA200366
    Atracurium besilate EP Impurity F
    CAS# 24948-17-2
    M.F.: C22H30INO4
    M.W.: 499.39
  • QA200365
    Atracurium besilate EP Impurity E
    CAS# NA
    M.F.: C24H32NO6
    M.W.: 430.51
  • QA200364
    Atracurium besilate EP Impurity D
    CAS# NA
    M.F.: C29H42NO7
    M.W.: 516.65
  • QA200363
    Atracurium besilate EP Impurity C
    CAS# NA
    M.F.: C32H44NO8
    M.W.: 570.69
  • QA200362
    Atracurium besilate EP Impurity B
    CAS# NA
    M.F.: C51H66N2O12
    M.W.: 899.08
  • QA200361
    Atracurium besilate EP Impurity A
    CAS# NA
    M.F.: C52H69N2O12
    M.W.: 914.11
  • QS011234
    Salmeterol Impurity 8
    CAS# 934842-69-0
    M.F.: C32H43NO4
    M.W.: 505.69
  • QT0307192
    Ticagrelor Impurity 192
    CAS# NA
    M.F.: C14H14Cl2N6O5S2
    M.W.: 481.33
  • QP090320
    Sodium Picosulfate Impurity 20
    CAS# NA
    M.F.: C20H19NO8S2
    M.W.: 465.50
  • QA060306
    Alfacalcidol Impurity 6
    CAS# NA
    M.F.: C33H58O2Si
    M.W.: 514.90
  • QI091633
    Ipratropium Bromide Impurity 33
    CAS# 3967-53-1
    M.F.: C10H12O3
    M.W.: 180.20
  • QI091632
    Ipratropium Bromide Impurity 32
    CAS# 59216-85-2
    M.F.: C9H8O3
    M.W.: 164.16
  • QI091631
    Ipratropium Bromide Impurity 31
    CAS# 54108-62-2
    M.F.: C16H14O3
    M.W.: 254.28
  • QS200779
    Sitagliptin Impurity 79
    CAS# NA
    M.F.: C16H13F6N5O2
    M.W.: 421.30
  • QA011538
    Anastrozole Impurity 38
    CAS# 1301724-97-9
    M.F.: C19H21N3O2
    M.W.: 323.39
  • QE1316132
    Empagliflozin Impurity 132
    CAS# NA
    M.F.: C23H27BrO7
    M.W.: 495.36
  • QL130629
    Lamivudine Impurity 29
    CAS# NA
    M.F.: C23H33N8O10PS
    M.W.: 644.59
  • QI151621
    R-Iopamidol
    CAS# 88375-91-1
    M.F.: C17H22I3N3O8
    M.W.: 777.09
  • QA1624202
    Apixaban Impurity 202
    CAS# NA
    M.F.: C27H30N4O5
    M.W.: 490.55
  • QF181944
    Furosemide Impurity 44
    CAS# NA
    M.F.: C15H16ClNO6S
    M.W.: 373.81
  • QN151856
    Noradrenaline (Norepinephrine) Impurity 56
    CAS# 14309-96-7
    M.F.: C8H9NO3
    M.W.: 167.16
  • QP012100
    Pasireotide
    CAS# 396091-73-9
    M.F.: C58H66N10O9
    M.W.: 1047.21
  • QA1624197
    Apixaban Impurity 197
    CAS# NA
    M.F.: C25H28N6O4
    M.W.: 476.53
  • QA1624196
    Apixaban Impurity 196
    CAS# NA
    M.F.: C27H31N5O5
    M.W.: 505.57
  • QA1624194
    Apixaban Impurity 194
    CAS# NA
    M.F.: C38H38N6O6
    M.W.: 674.74
  • QA1624193
    Apixaban Impurity 193
    CAS# NA
    M.F.: C29H34N6O5
    M.W.: 546.62
  • QL201554
    Letrozole Impurity 54
    CAS# NA
    M.F.: C17H11N5O
    M.W.: 301.30
  • QL201553
    Letrozole Impurity 53
    CAS# NA
    M.F.: C17H11N5O2
    M.W.: 317.30
  • QI131800
    Imidapril
    CAS# 89371-37-9
    M.F.: C20H27N3O6
    M.W.: 405.44
  • QR457047
    Rocuronium bromide Impurity 47
    CAS# NA
    M.F.: C32H53BrN2O4
    M.W.: 609.68
  • QE191817
    Estradiol Valerate EP Impurity G
    CAS# 1313382-25-0
    M.F.: C23H30O3
    M.W.: 354.48
  • QF122043
    Fluticasone Impurity 43
    CAS# NA
    M.F.: C52H54F4O12S3
    M.W.: 1043.17
  • QT161890
    Topiroxostat Impurity 64
    CAS# NA
    M.F.: C13H8N6O2
    M.W.: 280.24
  • QM031631
    Mycophenolic Acid Impurity 31
    CAS# 344562-78-3
    M.F.: C23H30O11
    M.W.: 482.48
  • QL151433
    Lornoxicam Impurity 33
    CAS# NA
    M.F.: C9H12ClNO6S2
    M.W.: 329.78
  • QM132040
    Memantine Impurity 40
    CAS# NA
    M.F.: C16H26N2O2
    M.W.: 278.39
  • QF022490
    Febuxostat Impurity 64
    CAS# 923942-36-3
    M.F.: C20H24N2O3S
    M.W.: 372.48
  • QF022489
    Febuxostat Impurity 63
    CAS# 1312815-36-3
    M.F.: C20H25NO4S
    M.W.: 375.48
  • QI192022
    Irbesartan Impurity 22
    CAS# NA
    M.F.: C25H27N3O
    M.W.: 385.50
  • QM154258
    Mirabegron Impurity 32
    CAS# NA
    M.F.: C24H22N2O6
    M.W.: 434.44
  • QG122538
    Glycopyrrolate Impurity 38
    CAS# NA
    M.F.: C5H13NO2
    M.W.: 119.16
  • QG122535
    Glycopyrrolate Impurity 35
    CAS# NA
    M.F.: C5H9NO2
    M.W.: 115.13
  • QG122533
    Glycopyrrolate Impurity 33
    CAS# NA
    M.F.: C5H7NO3
    M.W.: 129.11
  • QF120320
    Folic Acid Impurity 20
    CAS# 5959-18-2
    M.F.: C12H14N2O5
    M.W.: 266.25
  • QK201837
    Ketorolac Impurity 37
    CAS# 111930-01-9
    M.F.: C15H13NO4
    M.W.: 271.27
  • QF132033
    Formoterol Impurity 33
    CAS# NA
    M.F.: C20H26N2O4
    M.W.: 358.43
  • QS060295
    Sofosbuvir Impurity 95
    CAS# NA
    M.F.: C10H13FN2O5
    M.W.: 260.22
  • QS060294
    Sofosbuvir Impurity 94
    CAS# NA
    M.F.: C24H21FN2O7
    M.W.: 468.43
  • QD012010
    Daprodustat Impurity 10
    CAS# NA
    M.F.: C18H27N3O4
    M.W.: 349.42
  • QD053300
    Doxacurium chloride
    CAS# 106819-53-8
    M.F.: C56H78Cl2N2O16
    M.W.: 1106.13
  • QO240111
    Oxacillin sodium Impurity 11
    CAS# NA
    M.F.: C19H19N3O5S
    M.W.: 401.44
  • QE1316129
    Empagliflozin Impurity 129
    CAS# NA
    M.F.: C20H25ClO3Si
    M.W.: 376.95
  • QE120134
    Elagolix Impurity 34
    CAS# 7143-01-3
    M.F.: C2H6O5S2
    M.W.: 174.20
  • QE120133
    Elagolix Impurity 33
    CAS# 117049-14-6
    M.F.: C13H19NO3
    M.W.: 237.29
  • QE120131
    Elagolix Impurity 31
    CAS# 20989-17-7
    M.F.: C8H11NO
    M.W.: 137.18
  • QE120127
    Elagolix Impurity 27
    CAS# 830346-47-9
    M.F.: C13H10F4N2O2
    M.W.: 302.22
  • QP180450
    Perindopril Impurity 50
    CAS# 145513-33-3(free base)
    M.F.: C19H32N2O5 C4H11N
    M.W.: 368.47 73.14
  • QS200777
    Sitagliptin Impurity 77
    CAS# 1253056-01-7
    M.F.: C16H14F6N4O2
    M.W.: 408.30
  • QR182452
    Brexpiprazole Impurity 52
    CAS# 15116-41-3
    M.F.: C16H15NO2
    M.W.: 253.30
  • QA200105
    Atazanavir Impurity 5
    CAS# 156474-21-4
    M.F.: C15H21NO3
    M.W.: 263.33
  • QT183200
    Triclabendazole
    CAS# 68786-66-3
    M.F.: C14H9Cl3N2OS
    M.W.: 359.66
  • QT092401
    Tixocortol pivalate
    CAS# 55560-96-8
    M.F.: C26H38O5S
    M.W.: 462.64
  • QF122430
    Fluoxetine Impurity 30
    CAS# NA
    M.F.: C9H9IO
    M.W.: 260.07
  • QF122429
    Fluoxetine Impurity 29
    CAS# 62872-58-6
    M.F.: C9H11IO
    M.W.: 262.09
  • QA132449
    Amoxicillin Impurity 23
    CAS# NA
    M.F.: C31H40N6O9S2
    M.W.: 704.81
  • QA1624179
    Apixaban Impurity 179
    CAS# NA
    M.F.: C27H29ClN4O5
    M.W.: 525.00
  • QC551819
    Clenbuterol Impurity 19
    CAS# 37159-31-2
    M.F.: C12H19ClN2O
    M.W.: 242.75
  • QT0307191
    Ticagrelor Impurity 191
    CAS# NA
    M.F.: C7H10N2O3S
    M.W.: 202.23
  • QO022025
    Obeticholic Acid Impurity 25
    CAS# 1516887-33-4
    M.F.: C26H40O4
    M.W.: 416.59
  • QP092700
    Pinaverium Bromide
    CAS# 53251-94-8
    M.F.: C26H41Br2NO4
    M.W.: 591.42
  • QP092704
    Pinaverium Bromide Impurity 4
    CAS# 1235355-01-7
    M.F.: C26H39Br2NO4
    M.W.: 589.40
  • QP092703
    Pinaverium Bromide Impurity 3
    CAS# 1126385-20-3
    M.F.: C9H11BrO
    M.W.: 215.09
  • QP092702
    Pinaverium Bromide Impurity 2
    CAS# 53207-00-4
    M.F.: C9H10Br2O2
    M.W.: 309.98
  • QP092701
    Pinaverium Bromide Impurity 1
    CAS# 54370-00-2
    M.F.: C9H11BrO3
    M.W.: 247.09
  • QO1920112
    Oseltamivir Impurity 112
    CAS# NA
    M.F.: C11H17N3O5
    M.W.: 271.27
  • QO1920110
    Oseltamivir Impurity 110
    CAS# NA
    M.F.: C11H16N4O4
    M.W.: 268.27
  • QA1624171
    Apixaban Impurity 171
    CAS# NA
    M.F.: C25H33Cl2N3O4
    M.W.: 510.45
  • QA1624168
    Apixaban Impurity 168
    CAS# NA
    M.F.: C19H28N4O3
    M.W.: 360.45
  • QA1624166
    Apixaban Impurity 166
    CAS# NA
    M.F.: C19H26N4O5
    M.W.: 390.43
  • QR152425
    Roxadustat Impurity 25
    CAS# 1455091-10-7
    M.F.: C17H13NO4
    M.W.: 295.29
  • QG140957
    Ganciclovir Impurity 57
    CAS# NA
    M.F.: C15H21N5O8
    M.W.: 399.36
  • QT142426
    Tranexamic Acid Impurity 26
    CAS# 2375016-71-8
    M.F.: C8H13ClO2
    M.W.: 176.64
  • QA022600
    Abeprazan
    CAS# 1902954-60-2
    M.F.: C19H17F3N2O3S
    M.W.: 410.41
  • QS011232
    Salmeterol Impurity 6
    CAS# 2262385-84-0
    M.F.: C9H9BrO3
    M.W.: 245.07
  • QT012000
    Tartronic acid
    CAS# 80-69-3
    M.F.: C3H4O5
    M.W.: 120.06
  • QI162000
    Isomaltohexaonic acid
    CAS# 534-74-7
    M.F.: C12H22O12
    M.W.: 358.30
  • QM120200
    Maltobionic acid
    CAS# 534-42-9
    M.F.: C12H22O12
    M.W.: 358.30
  • QT0307190
    Ticagrelor Impurity 190
    CAS# NA
    M.F.: C26H31F2N7O5S
    M.W.: 591.63
  • QI120114
    Ilaprazole Impurity 14
    CAS# 1018229-53-2
    M.F.: C11H9N3O
    M.W.: 199.21
  • QF132032
    Formoterol Impurity 32
    CAS# NA
    M.F.: C20H26N2O4
    M.W.: 358.43
  • QG140954
    Ganciclovir Impurity 54
    CAS# 108436-61-9
    M.F.: C18H21N5O5
    M.W.: 387.39
  • QI120113
    Ilaprazole Impurity 13
    CAS# 86604-74-2;124473-12-7(free base)
    M.F.: C8H10ClNO.HCl
    M.W.: 171.62 36.46
  • QI210658
    Ibuprofen Impurity 32
    CAS# 4397-53-9
    M.F.: C14H12O2
    M.W.: 212.24
  • QI222040
    Itraconazole Impurity 40
    CAS# 219923-93-0
    M.F.: C18H22N4O2
    M.W.: 326.39
  • QI041553
    Indobufen Impurity 27
    CAS# NA
    M.F.: C18H17NO5
    M.W.: 327.33
  • QI041551
    Indobufen Impurity 25
    CAS# 1093759-05-7
    M.F.: C14H13NO4
    M.W.: 259.26
  • QS091106
    Shikimic Acid Impurity 6
    CAS# 171963-37-4
    M.F.: C7H10O5
    M.W.: 174.15
  • QS091105
    Shikimic Acid Impurity 5
    CAS# NA
    M.F.: C7H10O5
    M.W.: 174.15
  • QS091104
    Shikimic Acid Impurity 4
    CAS# 21967-35-1
    M.F.: C7H10O5
    M.W.: 174.15
  • QS091103
    Shikimic Acid Impurity 3
    CAS# 10191-00-1
    M.F.: C7H10O5
    M.W.: 174.15
  • QA220370
    Avibactam Impurity 44
    CAS# NA
    M.F.: C17H19N
    M.W.: 237.34
  • QA220368
    Avibactam Impurity 42
    CAS# NA
    M.F.: C27H36N6O5
    M.W.: 524.61
  • QC061738
    Cefoperazone Impurity 12
    CAS# NA
    M.F.: C24H25N9O8S2
    M.W.: 631.64
  • QR182450
    Brexpiprazole Impurity 50
    CAS# NA
    M.F.: C33H31N3O2S2
    M.W.: 565.75
  • QD261615
    Diazepam Impurity 15
    CAS# 25759-97-1
    M.F.: C20H14Cl2N2O
    M.W.: 369.24
  • QD030451
    Diclofenac sodium Impurity 51
    CAS# 95093-56-4
    M.F.: C17H17Cl2NO3
    M.W.: 354.23
  • QC022649
    Cabozantinib Impurity 49
    CAS# NA
    M.F.: C28H24FN3O5
    M.W.: 501.51
  • QC022648
    Cabozantinib Impurity 48
    CAS# NA
    M.F.: C28H26FN3O6
    M.W.: 519.52
  • QA130240
    Ambroxol Impurity 40
    CAS# NA
    M.F.: C13H16Br2N2O3
    M.W.: 408.09
  • QA260501
    Dehydro Azelnidipine
    CAS# 918659-10-6
    M.F.: C33H32N4O6
    M.W.: 580.63
  • QI071800
    Iguratimod
    CAS# 123663-49-0
    M.F.: C17H14N2O6S
    M.W.: 374.37
  • QN202112
    Netupitant Impurity 12
    CAS# 289686-73-3
    M.F.: C11H8F6O2
    M.W.: 286.17
  • QC080304
    Cholic Acid Impurity 4
    CAS# NA
    M.F.: C25H40O5
    M.W.: 420.58
  • QC080303
    Cholic Acid Impurity 3
    CAS# 1448-36-8
    M.F.: C25H42O5
    M.W.: 422.60
  • QR021649
    Rabeprazole Impurity 49
    CAS# 117977-19-2
    M.F.: C13H19NO4
    M.W.: 253.29
  • QL201548
    Letrozole Impurity 48
    CAS# 143030-54-0
    M.F.: C16H11BrN4
    M.W.: 339.19
  • QA161908
    Acetylsalicylic Acid Impurity 8
    CAS# 15540-79-1
    M.F.: C8H7NO5
    M.W.: 197.14
  • QS041919
    Sodium Valproate Impurity 19
    CAS# 3274-28-0
    M.F.: C9H18O2
    M.W.: 158.24
  • QR457046
    Rocuronium bromide Impurity 46
    CAS# NA
    M.F.: C23H37NO2
    M.W.: 359.55
  • QR457045
    Rocuronium bromide Impurity 45
    CAS# NA
    M.F.: C23H37NO2
    M.W.: 359.55
  • QR457044
    Rocuronium bromide Impurity 44
    CAS# 2102929-98-4
    M.F.: C23H37NO2
    M.W.: 359.55
  • QR457043
    Rocuronium bromide Impurity 43
    CAS# NA
    M.F.: C21H30O3
    M.W.: 330.46
  • QR457042
    Rocuronium bromide Impurity 42
    CAS# 212505-49-2
    M.F.: C21H30O3
    M.W.: 330.46
  • QR457041
    Rocuronium bromide Impurity 41
    CAS# NA
    M.F.: C21H30O4
    M.W.: 346.46
  • QR457040
    Rocuronium bromide Impurity 40
    CAS# NA
    M.F.: C21H30O4
    M.W.: 346.46
  • QR457039
    Rocuronium bromide Impurity 39
    CAS# NA
    M.F.: C21H30O2
    M.W.: 314.46
  • QG123301
    Glycodeoxycholic Acid Ethyl Ester
    CAS# 70779-06-5
    M.F.: C28H47NO5
    M.W.: 477.68
  • QG121502
    Glycocholic Acid Ethyl Ester
    CAS# 517904-33-5
    M.F.: C28H47NO6
    M.W.: 493.68
  • QV180388
    Voriconazole Nitroso Impurity 4
    CAS# NA
    M.F.: C10H9F2N5O2
    M.W.: 269.21
  • QV180386
    Voriconazole Nitroso Impurity 3
    CAS# NA
    M.F.: C2H3N5O
    M.W.: 113.08
  • QO1920101
    Oseltamivir Impurity 101
    CAS# NA
    M.F.: C13H18N4O5
    M.W.: 310.31
  • QV307786
    Vitamin K1 Impurity 86
    CAS# NA
    M.F.: C31H46O3
    M.W.: 466.70
  • QP082902
    Calcium Phenylpyruvate Impurity 2
    CAS# NA
    M.F.: C17H14N2O3
    M.W.: 294.30
  • QP082901
    Calcium Phenylpyruvate Impurity 1
    CAS# NA
    M.F.: C18H13NO4
    M.W.: 307.30
  • QD030444
    Diclofenac sodium Impurity 44
    CAS# NA
    M.F.: C28H23NO4
    M.W.: 437.49
  • QL151427
    Lornoxicam Impurity 27
    CAS# NA
    M.F.: C10H11Cl2NO6S2
    M.W.: 376.23
  • QL151425
    Lornoxicam Impurity 25
    CAS# NA
    M.F.: C7H7Cl2NO4S2
    M.W.: 304.17
  • QT1406175
    Tenofovir Impurity 175
    CAS# 50615-40-2
    M.F.: C8H10ClN5
    M.W.: 211.65
  • QF122602
    Flutrimazole EP Impurity B
    CAS# 128092-72-8
    M.F.: C19H14F2O
    M.W.: 296.31
  • QM092208
    Mivacurium chloride Impurity 8
    CAS# 38561-68-1
    M.F.: C8H12O4
    M.W.: 172.18
  • QD122041
    Dolutegravir Impurity 41
    CAS# 1309560-49-3;1309575-43-6(Na salt)
    M.F.: C20H19F2N3O5
    M.W.: 419.38
  • QC082801
    Chlormadinone acetate EP Impurity A
    CAS# 2477-73-8
    M.F.: C23H31ClO4
    M.W.: 406.94
  • QN131129
    Nifuratel impurity 29
    CAS# NA
    M.F.: C5H10N2O2S
    M.W.: 162.21
  • QC120103
    Clavulanic Acid Impurity 3
    CAS# 92632-79-6
    M.F.: C4H9NO2 HCl
    M.W.: 103.12 36.46
  • QA262011
    Azathioprine Impurity 11;
    Mercaptopurine EP Impurity C

    CAS# 90947-51-6
    M.F.: C10H6N8S
    M.W.: 270.27
  • QV122220
    Valaciclovir Impurity 20;Adenine;
    Mercaptopurine EP Impurity B

    CAS# 73-24-5
    M.F.: C5H5N5
    M.W.: 135.13
  • QE1316124
    Empagliflozin Impurity 124
    CAS# 915095-90-8
    M.F.: C17H16BrClO2
    M.W.: 367.66
  • QG123400
    Glycolithocholic acid
    CAS# 474-74-8
    M.F.: C26H43NO4
    M.W.: 433.62
  • QR182448
    Brexpiprazole Impurity 48
    CAS# 6855-48-7
    M.F.: C8H7NO2
    M.W.: 149.15
  • QR182447
    Brexpiprazole Impurity 47
    CAS# 22246-84-0
    M.F.: C10H11NO2
    M.W.: 177.20
  • QR182446
    Brexpiprazole Impurity 46
    CAS# NA
    M.F.: C26H28ClN3O2S
    M.W.: 482.04
  • QD030440
    Diclofenac sodium Impurity 40
    CAS# 320777-08-0
    M.F.: C14H12ClNO2
    M.W.: 261.70
  • QM202421
    Methotrexate Impurity 21
    CAS# 82778-08-3
    M.F.: C7H7ClN6 HCl
    M.W.: 210.62 36.46
  • QB052512
    Benzylpenicillin sodium CP Impurity L
    CAS# NA
    M.F.: C26H29N3O7S
    M.W.: 527.59
  • QB052510
    Benzylpenicillin sodium CP Impurity J
    CAS# NA
    M.F.: C17H20N2O6S
    M.W.: 380.42
  • QB052509
    Benzylpenicillin sodium CP Impurity I
    CAS# NA
    M.F.: C16H18N2O4S
    M.W.: 334.39
  • QB052508
    Benzylpenicillin sodium CP Impurity H
    CAS# 500-98-1
    M.F.: C10H11NO3
    M.W.: 193.20
  • QK200318
    Ketoconazole Impurity 18
    CAS# 2234-16-4
    M.F.: C8H6Cl2O
    M.W.: 189.04
  • QG131815
    Gimeracil Impurity 15
    CAS# 1379260-15-7
    M.F.: C6H6ClNO2
    M.W.: 159.57
  • QH041815
    Cholesterol Impurity 15
    CAS# 15073-00-4
    M.F.: C28H48O
    M.W.: 400.68
  • QE042245
    Edaravone Impurity 19
    CAS# NA
    M.F.: C27H30N4O4
    M.W.: 474.55
  • QC042020
    Cefditoren pivoxil Impurity 20
    CAS# NA
    M.F.: C31H40N6O10S3
    M.W.: 752.88
  • QC042018
    Cefditoren pivoxil Impurity 18
    CAS# NA
    M.F.: C33H36N6O8S3
    M.W.: 740.87
  • QC042017
    Cefditoren pivoxil Impurity 17
    CAS# 145904-68-3
    M.F.: C19H18N6O5S3
    M.W.: 506.58
  • QR052002
    9-cis-4-Hydroxyretinoic acid
    CAS# 150737-17-0
    M.F.: C20H28O3
    M.W.: 316.43
  • QM031630
    Mycophenolic Acid Impurity 30
    CAS# 27979-57-3
    M.F.: C9H8O4
    M.W.: 180.16
  • QR022238
    Ribavirin Impurity 12
    CAS# 61849-90-9
    M.F.: C13H18O9
    M.W.: 318.28
  • QG211202
    Sodium Gualenate Impurity 2
    CAS# 6223-36-5
    M.F.: C17H22O3S
    M.W.: 306.42
  • QG211201
    Sodium Gualenate Impurity 1
    CAS# 93914-28-4
    M.F.: C15H17NaO3S
    M.W.: 300.35
  • QG211200
    Sodium Gualenate
    CAS# 6223-35-4
    M.F.: C15H17NaO3S
    M.W.: 300.35
  • QV307785
    Vitamin B6 Impurity 85
    CAS# 90005-85-9
    M.F.: C8H9NO3 HCl
    M.W.: 167.16 36.46
  • QV307784
    Vitamin B6 Impurity 84
    CAS# NA
    M.F.: C16H20N2O5
    M.W.: 320.34
  • QV307783
    Vitamin B6 Impurity 83
    CAS# 2726926-28-7
    M.F.: C16H20N2O5
    M.W.: 320.34
  • QV307782
    Vitamin B6 Impurity 82
    CAS# NA
    M.F.: C16H20N2O5
    M.W.: 320.34
  • QV307781
    Vitamin B6 Impurity 81
    CAS# NA
    M.F.: C8H11NO3
    M.W.: 169.18
  • QV307780
    Vitamin B6 Impurity 80
    CAS# NA
    M.F.: C12H17NO3
    M.W.: 223.27
  • QV307779
    Vitamin B6 Impurity 79
    CAS# 1385767-86-1
    M.F.: C12H17NO3
    M.W.: 223.27
  • QV307778
    Vitamin B6 Impurity 78
    CAS# NA
    M.F.: C14H21NO3
    M.W.: 251.32
  • QC065302
    Chlorogenic acid Impurity 2
    CAS# NA
    M.F.: C16H16O9
    M.W.: 352.29
  • QV307777
    Vitamin K1 Impurity 77
    CAS# NA
    M.F.: C31H46O2
    M.W.: 450.71
  • QO022024
    Obeticholic Acid Impurity 24
    CAS# 1831863-02-5
    M.F.: C26H44O4
    M.W.: 420.63
  • QO022023
    Tauro-Obeticholic Acid-d5
    CAS# NA
    M.F.: C28H44D5NO6S
    M.W.: 532.79
  • QO022022
    Tauro-Obeticholic Acid
    CAS# 863239-61-6
    M.F.: C28H49NO6S
    M.W.: 527.76
  • QO022021
    Glyco-Obeticholic Acid-d5
    CAS# NA
    M.F.: C28H42D5NO5
    M.W.: 482.71
  • QO022020
    Glyco-Obeticholic Acid
    CAS# 863239-60-5
    M.F.: C28H47NO5
    M.W.: 477.68
  • QO022019
    Obeticholic Acid-d5
    CAS# 1992000-80-2
    M.F.: C26H39D5O4
    M.W.: 425.66
  • QA056342
    Agomelatine Impurity 42
    CAS# 178677-39-9
    M.F.: C15H19NO2
    M.W.: 245.32
  • QT131212
    Timolol Maleate Impurity 12
    CAS# 158636-96-5
    M.F.: C13H24N4O3S
    M.W.: 316.42
  • QW011820
    Warfarin sodium Impurity 20
    CAS# NA
    M.F.: C18H18O3
    M.W.: 282.33
  • QA131245
    Amlodipine Impurity 45
    CAS# 130161-00-1
    M.F.: C18H18ClNO4
    M.W.: 347.79
  • QI091630
    Ipratropium Bromide Impurity 30
    CAS# NA
    M.F.: C19H25NO3
    M.W.: 315.41
  • QP180449
    Perindopril Impurity 49
    CAS# 145513-93-5
    M.F.: C9H15NO2
    M.W.: 169.22
  • QM201820
    Metaraminol Impurity 20
    CAS# NA
    M.F.: C24H25NO4
    M.W.: 391.46
  • QR122411
    Raloxifene Impurity 11
    CAS# 2008-75-5
    M.F.: C7H14ClN HCl
    M.W.: 147.65 36.46
  • QP1903129
    Posaconazole Impurity 129
    CAS# NA
    M.F.: C22H20F2INO4
    M.W.: 527.30
  • QA020415
    Albendazole Impurity 15
    CAS# 95384-59-1
    M.F.: C14H14N2O
    M.W.: 226.27
  • QR051209
    Relugolix Impurity 9
    CAS# NA
    M.F.: C31H30F2N8O7S
    M.W.: 696.68
  • QR051208
    Relugolix Impurity 8
    CAS# NA
    M.F.: C54H46F4N12O6S2
    M.W.: 1099.14
  • QP082202
    Phenprocoumon, (S)-
    CAS# 3770-63-6
    M.F.: C18H16O3
    M.W.: 280.32
  • QS211704
    Sulindac Impurity 4
    CAS# 61849-35-2
    M.F.: C20H17FO3S
    M.W.: 356.41
  • QZ151207
    Zoledronic acid Impurity 7
    CAS# NA
    M.F.: C5H8N2O6P2
    M.W.: 254.07
  • QC160765
    Clopidogrel Impurity 39
    CAS# NA
    M.F.: C15H14O5S
    M.W.: 306.33
  • QP180787
    Pregabalin Impurity 87
    CAS# NA
    M.F.: C8H17NO3
    M.W.: 175.23
  • QS040669
    Sildenafil Impurity 69
    CAS# 1446089-83-3
    M.F.: C32H38N6O3
    M.W.: 554.68
  • QP160520
    Prednisolone Acetate EP Impurity E
    CAS# 4380-55-6
    M.F.: C23H28O5
    M.W.: 384.47
  • QP160519
    Prednisolone Acetate EP Impurity D
    CAS# 20423-99-8
    M.F.: C21H28O4
    M.W.: 344.44
  • QP160518
    Prednisolone Acetate EP Impurity C
    CAS# 98523-85-4
    M.F.: C25H32O7
    M.W.: 444.52
  • QT050704
    Tegafur Impurity 4
    CAS# NA
    M.F.: C10H14N2O4
    M.W.: 226.23
  • QE201515
    Etodolac Impurity 15
    CAS# 101901-08-0
    M.F.: C17H21NO4
    M.W.: 303.35
  • QR021644
    Rabeprazole Impurity 44
    CAS# 1173655-69-0
    M.F.: C11H17NO4
    M.W.: 227.26
  • QF120319
    Folic Acid Impurity 19
    CAS# NA
    M.F.: C20H22ClN7O6
    M.W.: 491.88
  • QV307775
    Vitamin K1 Impurity 75
    CAS# 64236-23-3
    M.F.: C31H48O2
    M.W.: 452.71
  • QS075488
    Sugammadex Impurity 88
    CAS# 131105-41-4
    M.F.: C36H54I6O24
    M.W.: 1632.23
  • QP1903120
    Posaconazole Impurity 120
    CAS# NA
    M.F.: C44H48F2N8O4
    M.W.: 790.90
  • QV041415
    Vardenafil Impurity 15
    CAS# NA
    M.F.: C18H22N4O5S
    M.W.: 406.46
  • QS200774
    Sitagliptin Impurity 74
    CAS# NA
    M.F.: C10H8F3NO2
    M.W.: 231.17
  • QS200773
    Sitagliptin Impurity 73
    CAS# 1256815-03-8
    M.F.: C10H7F3O3
    M.W.: 232.16
  • QS200772
    Sitagliptin Impurity 72
    CAS# 1151240-88-8
    M.F.: C12H11F3O3
    M.W.: 260.21
  • QP131243
    Pomalidomide Impurity 17
    CAS# NA
    M.F.: C15H10N2O4
    M.W.: 282.25
  • QP090319
    Sodium Picosulfate Impurity 19
    CAS# NA
    M.F.: C26H31NO8S2
    M.W.: 549.66
  • QP090318
    Sodium Picosulfate Impurity 18
    CAS# NA
    M.F.: C22H23NO8S2
    M.W.: 493.55
  • QC010100
    Controlled Substance
    (Cannabidiolic acid)

    CAS# 1244-58-2
    M.F.: C22H30O4
    M.W.: 358.47
  • QT142425
    Tranexamic Acid Impurity 25
    CAS# 861518-79-8
    M.F.: C16H13ClO4
    M.W.: 304.73
  • QB121432
    Blonanserin Impurity 6
    CAS# NA
    M.F.: C25H35N3O
    M.W.: 393.56
  • QM1602121
    Moxifloxacin Impurity 121
    CAS# 1797982-51-4
    M.F.: C16H16FNO5
    M.W.: 321.30
  • QT052402
    Tenoxicam Impurity 2
    CAS# 59337-92-7
    M.F.: C6H5ClO4S2
    M.W.: 240.68
  • QI140414
    Indometacin Impurity 14
    CAS# 73301-01-6
    M.F.: C10H11ClO4
    M.W.: 230.64
  • QS132249
    Simvastatin EP Impurity M
    CAS# 864357-87-9
    M.F.: C27H44O6
    M.W.: 464.63
  • QD030439
    Diclofenac sodium Impurity 39
    CAS# 172494-87-0
    M.F.: C13H11Cl2N
    M.W.: 252.14
  • QD030438
    Diclofenac sodium Impurity 38
    CAS# 127792-34-1
    M.F.: C14H12ClNO2
    M.W.: 261.70
  • QD030437
    Diclofenac sodium Impurity 37
    CAS# NA
    M.F.: C18H20Cl2N2O2
    M.W.: 367.27
  • QS061426
    Safinamide Impurity Z
    CAS# 1827614-91-4
    M.F.: C18H20FNO3
    M.W.: 317.35
  • QF122113
    Fluorouracil Impurity 13
    CAS# 155-16-8
    M.F.: C5H5FN2O2
    M.W.: 144.10
  • QA150925
    Atomoxetine Impurity 25
    CAS# 881995-46-6
    M.F.: C16H19NO HCl
    M.W.: 241.33 36.46
  • QP181674
    Pramipexole Impurity 74
    CAS# 1001648-75-4
    M.F.: C7H11N3OS
    M.W.: 185.25
  • QS010262
    Salbutamol Impurity 36
    CAS# NA
    M.F.: C17H23NO4
    M.W.: 305.37
  • QF130421
    Famotidine Impurity 21
    CAS# 95853-46-6
    M.F.: C3H7N3O2S
    M.W.: 149.17
  • QP180784
    Pregabalin Impurity 84
    CAS# 313651-25-1
    M.F.: C9H19NO2
    M.W.: 173.25
  • QV307774
    Vitamin K1 Impurity 74
    CAS# 107759-10-4
    M.F.: C31H48O4
    M.W.: 484.71
  • QA190213
    Ascorbic Acid Impurity 13
    CAS# NA
    M.F.: C6H6O7
    M.W.: 190.11
  • QD162006
    Daptomycin Impurity F
    CAS# NA
    M.F.: C72H103N17O27
    M.W.: 1638.69
  • QM031629
    Mycophenolic Acid-13C-d3
    CAS# NA
    M.F.: C1613CH17D3O6
    M.W.: 324.35
  • QM040140
    Midazolam Impurity 14
    CAS# NA
    M.F.: C23H18ClFN2O4
    M.W.: 440.85
  • QB191626
    Bisoprolol Impurity 26
    CAS# NA
    M.F.: C19H33NO4
    M.W.: 339.47
  • QB191625
    Bisoprolol Impurity 25
    CAS# 2226263-67-6
    M.F.: C15H22O4
    M.W.: 266.33
  • QB191624
    Bisoprolol Impurity 24
    CAS# NA
    M.F.: C27H40O7
    M.W.: 476.60
  • QA220362
    Avibactam Impurity 36
    CAS# NA
    M.F.: C9H21O3P
    M.W.: 208.24
  • QA220361
    Avibactam Impurity 35
    CAS# 18812-51-6
    M.F.: C7H17O3P
    M.W.: 180.18
  • QA220359
    Avibactam Impurity 33
    CAS# NA
    M.F.: C11H25O3P
    M.W.: 236.29
  • QA220358
    Avibactam Impurity 32
    CAS# NA
    M.F.: C17H21O3P
    M.W.: 304.32
  • QV180382
    Voriconazole Impurity 56
    CAS# 2094735-34-7
    M.F.: C10H10BrFN4O
    M.W.: 301.12
  • QC180821
    Chlorphenamine Impurity 21
    CAS# NA
    M.F.: C17H20ClN3O
    M.W.: 317.81
  • QA180607
    ArforMoterol Tartrate Impurity 7
    CAS# NA
    M.F.: C20H26N2O4
    M.W.: 358.43
  • QG040238
    Gadobutrol Impurity 38
    CAS# 112193-75-6
    M.F.: C12H24N4O4
    M.W.: 288.34
  • QG040237
    Gadobutrol Impurity 37
    CAS# 170454-90-7
    M.F.: C10H22N4O2
    M.W.: 230.31
  • QF022487
    Febuxostat Impurity 61
    CAS# 25984-63-8
    M.F.: C7H7NOS
    M.W.: 153.20
  • QP090317
    Sodium Picosulfate Impurity 17
    CAS# 22945-62-6
    M.F.: C12H9NO2
    M.W.: 199.21
  • QP090316
    Sodium Picosulfate Impurity 16
    CAS# 33077-70-2
    M.F.: C12H9NO2
    M.W.: 199.21
  • QB082440
    Bromhexine Impurity 14
    CAS# NA
    M.F.: C20H30Br2N2O5
    M.W.: 538.27
  • QP052700
    Pemirolast
    CAS# 69372-19-6
    M.F.: C10H8N6O
    M.W.: 228.21
  • QP132075
    Pemetrexed Impurity 49
    CAS# 883553-87-5
    M.F.: C25H28N6O9
    M.W.: 556.52
  • QP1824108
    Parecoxib Sodium Impurity 82
    CAS# 1448355-87-0
    M.F.: C16H12ClNO
    M.W.: 269.73
  • QF120210
    Flubendazole Impurity 10
    CAS# NA
    M.F.: C13H7ClFNO3
    M.W.: 279.65
  • QF120209
    Flubendazole Impurity 9
    CAS# NA
    M.F.: C12H8F2OS
    M.W.: 238.25
  • QS201223
    Sertraline Impurity 23
    CAS# NA
    M.F.: C17H17Cl2N
    M.W.: 306.23
  • QP012200
    Parvine
    CAS# 57103-51-2
    M.F.: C18H13N3O
    M.W.: 287.32
  • QI221800
    Ivermectin B1a
    CAS# 71827-03-7
    M.F.: C48H74O14
    M.W.: 875.11
  • QM041849
    Minodronic Acid Impurity 23
    CAS# 22418-77-5
    M.F.: C4H4O3
    M.W.: 100.07
  • QT180678
    Tirofiban Impurity 78
    CAS# NA
    M.F.: C21H34N2O5S
    M.W.: 426.57
  • QT180676
    Tirofiban Impurity 76
    CAS# NA
    M.F.: C20H26N2O5S
    M.W.: 406.50
  • QM041848
    Minodronic Acid Impurity 22
    CAS# 1575-59-3
    M.F.: C4H4O3
    M.W.: 100.07
  • QD030435
    Diclofenac sodium Impurity 35
    CAS# 69002-84-2
    M.F.: C14H11Cl2NO3
    M.W.: 312.15
  • QL091665
    Lipoic Acid Impurity39
    CAS# 6718-96-3
    M.F.: C16H28O4S4
    M.W.: 412.65
  • QL091664
    Lipoic Acid Impurity 38
    CAS# NA
    M.F.: C16H28O4S4
    M.W.: 412.65
  • QP081833
    Phloroglucinol Impurity 33
    CAS# NA
    M.F.: C18H14O9
    M.W.: 374.30
  • QL053000
    Leucovorin
    CAS# 58-05-9
    M.F.: C20H23N7O7
    M.W.: 473.44
  • QI200341
    Irinotecan-d10 HCl
    CAS# 718612-62-5
    M.F.: C33H28D10N4O6 HCl
    M.W.: 596.74 36.46
  • QC162011
    Camptothecin Impurity 11
    CAS# 718612-49-8
    M.F.: C22H17D3N2O5
    M.W.: 395.42
  • QA164180
    Avanafil Impurity 54
    CAS# NA
    M.F.: C28H30ClN9O3
    M.W.: 576.05
  • QA164179
    Avanafil Impurity 53
    CAS# 2520113-98-6
    M.F.: C24H24ClN7O4
    M.W.: 509.94
  • QA164173
    Avanafil Impurity 47
    CAS# NA
    M.F.: C18H19ClN4O5
    M.W.: 406.82
  • QA164172
    Avanafil Impurity 46
    CAS# NA
    M.F.: C20H23ClN4O5
    M.W.: 434.87
  • QA164170
    Avanafil Impurity 44
    CAS# NA
    M.F.: C18H19ClN4O5
    M.W.: 406.82
  • QA164167
    Avanafil Impurity 41
    CAS# 56633-75-1
    M.F.: C6H11NO2
    M.W.: 129.16
  • QA164165
    Avanafil Impurity 39
    CAS# 1624833-89-1
    M.F.: C19H19ClN6O4S
    M.W.: 462.91
  • QA164164
    Avanafil Impurity 38
    CAS# NA
    M.F.: C14H14ClN3O5S
    M.W.: 371.80
  • QA164163
    Avanafil Impurity 37
    CAS# NA
    M.F.: C14H14ClN3O4S
    M.W.: 355.80
  • QA164160
    Avanafil Impurity 34
    CAS# NA
    M.F.: C26H22Cl2N6O7
    M.W.: 601.39
  • QA164159
    Avanafil Impurity 33
    CAS# NA
    M.F.: C30H30Cl2N6O7
    M.W.: 657.50
  • QA164158
    Avanafil Impurity 32
    CAS# 330786-34-0
    M.F.: C14H14ClN3O3S
    M.W.: 339.80
  • QA164156
    Avanafil Impurity 30
    CAS# NA
    M.F.: C16H17Cl2N3O3S
    M.W.: 402.30
  • QN151852
    Noradrenaline (Norepinephrine) Impurity 52
    CAS# NA
    M.F.: C8H11NO3
    M.W.: 169.18
  • QN151851
    Noradrenaline (Norepinephrine) Impurity 51
    CAS# 536-21-0;4779-94-6(HCl salt)
    M.F.: C8H11NO2
    M.W.: 153.18
  • QN151850
    Noradrenaline (Norepinephrine) Impurity 50
    CAS# NA
    M.F.: C8H11NO4
    M.W.: 185.18
  • QN151849
    Noradrenaline (Norepinephrine) Impurity 49
    CAS# NA
    M.F.: C8H11NO4
    M.W.: 185.18
  • QN151848
    Noradrenaline (Norepinephrine) Impurity 48
    CAS# NA
    M.F.: C8H11NO4
    M.W.: 185.18
  • QN151847
    Noradrenaline (Norepinephrine) Impurity 47
    CAS# NA
    M.F.: C8H11NO3
    M.W.: 169.18
  • QN151846
    Noradrenaline (Norepinephrine) Impurity 46
    CAS# 94593-04-1
    M.F.: C8H9NO3
    M.W.: 167.16
  • QN151845
    Noradrenaline (Norepinephrine) Impurity 45
    CAS# 117883-03-1
    M.F.: C8H7NO3
    M.W.: 165.15
  • QN151844
    Noradrenaline (Norepinephrine) Impurity 44
    CAS# 1416018-20-6
    M.F.: C8H7NO3
    M.W.: 165.15
  • QN151843
    Noradrenaline (Norepinephrine) Impurity 43
    CAS# NA
    M.F.: C10H8Cl2O4
    M.W.: 263.07
  • QN151842
    Noradrenaline (Norepinephrine) Impurity 42
    CAS# NA
    M.F.: C8H5ClO3
    M.W.: 184.58
  • QS201218
    Sertraline Impurity 18
    CAS# NA
    M.F.: C17H17Cl2NO
    M.W.: 322.23
  • QR052213
    Revefenacin Impurity 13
    CAS# 90-41-5
    M.F.: C12H11N
    M.W.: 169.22
  • QB051316
    Bempedoic acid Impurity 16
    CAS# 36635-61-7
    M.F.: C9H9NO2S
    M.W.: 195.24
  • QB051315
    Bempedoic acid Impurity 15
    CAS# NA
    M.F.: C18H18N2O4S2
    M.W.: 390.48
  • QB051314
    Bempedoic acid Impurity 14
    CAS# 36635-56-0
    M.F.: C9H11NO3S
    M.W.: 213.25
  • QB051313
    Bempedoic acid Impurity 13
    CAS# NA
    M.F.: C21H38O5
    M.W.: 370.52
  • QB051312
    Bempedoic acid Impurity 12
    CAS# NA
    M.F.: C20H36O5
    M.W.: 356.50
  • QB051311
    Bempedoic acid Impurity 11
    CAS# NA
    M.F.: C21H38O5
    M.W.: 370.52
  • QB051310
    Bempedoic acid Impurity 10
    CAS# 123469-92-1
    M.F.: C11H21BrO2
    M.W.: 265.19
  • QB051309
    Bempedoic acid Impurity 9
    CAS# NA
    M.F.: C12H22O3
    M.W.: 214.30
  • QB051308
    Bempedoic acid Impurity 8
    CAS# NA
    M.F.: C20H29NO4S
    M.W.: 379.51
  • QB051307
    Bempedoic acid Impurity 7
    CAS# NA
    M.F.: C17H32O4
    M.W.: 300.43
  • QB051306
    Bempedoic acid Impurity 6
    CAS# NA
    M.F.: C11H21BrO2
    M.W.: 265.19
  • QB051305
    Bempedoic acid Impurity 5
    CAS# 413624-71-2
    M.F.: C19H34O5
    M.W.: 342.47
  • QB051304
    Bempedoic acid Impurity 4
    CAS# 738606-43-4
    M.F.: C23H42O5
    M.W.: 398.58
  • QB051303
    Bempedoic acid Impurity 3
    CAS# NA
    M.F.: C31H49NO6S
    M.W.: 563.79
  • QB051302
    Bempedoic acid Impurity 2
    CAS# 2280838-78-8
    M.F.: C11H22O3
    M.W.: 202.29
  • QB051301
    Bempedoic acid Impurity 1
    CAS# 7443-29-0
    M.F.: C9H17BrO2
    M.W.: 237.13
  • QV307772
    Vitamin K1 Impurity 72
    CAS# NA
    M.F.: C31H46O4
    M.W.: 482.69
  • QV307770
    Vitamin K1 Impurity 70
    CAS# 22399-39-9
    M.F.: C13H10O3
    M.W.: 214.22
  • QL151413
    Lornoxicam Impurity 13
    CAS# 59804-27-2
    M.F.: C7H9NO4S2
    M.W.: 235.28
  • QL151412
    Lornoxicam Impurity 12
    CAS# 1030422-51-5
    M.F.: C6H5ClO5S2
    M.W.: 256.68
  • QI191918
    Isosorbide Impurity 18
    CAS# 100402-56-0;27299-12-3(free base)
    M.F.: C6H12O5 C6H12O6
    M.W.: 164.16 180.16
  • QI191917
    Isosorbide Impurity 17
    CAS# 13042-38-1
    M.F.: C10H14O6
    M.W.: 230.21
  • QI191916
    Isosorbide Impurity 16
    CAS# 65940-93-4
    M.F.: C8H12O5
    M.W.: 188.18
  • QL051510
    Calcium Levofolinate Impurity 10;
    Calcium Folinate Hydrate EP Impurity B

    CAS# 98814-60-9
    M.F.: C21H23N7O8
    M.W.: 501.45
  • QT0307174
    Ticagrelor Impurity 174
    CAS# 3721-26-4
    M.F.: C9H11N
    M.W.: 133.19
  • QT1406157
    Tenofovir Impurity 157
    CAS# NA
    M.F.: C21H29N6O5P
    M.W.: 476.47
  • QE200376
    Entacapone Impurity 76
    CAS# 158693-01-7
    M.F.: C10H7N3O5
    M.W.: 249.18
  • QE200375
    Entacapone Impurity 75
    CAS# NA
    M.F.: C14H16N2O7
    M.W.: 324.29
  • QP090315
    Sodium Picosulfate Impurity 15
    CAS# NA
    M.F.: C18H13NNa2O8S2
    M.W.: 481.41
  • QA202298
    Atorvastatin EP Impurity J
    CAS# NA
    M.F.: C33H33FN2O4
    M.W.: 540.62
  • QF012226
    Favipiravir Impurity 26
    CAS# NA
    M.F.: C5H2FN3O
    M.W.: 139.09
  • QL162031
    Lapatinib Impurity 31
    CAS# 202196-46-1
    M.F.: C26H19N3O3
    M.W.: 421.45
  • QI091629
    Ipratropium Bromide Impurity 29
    CAS# 3423-23-2;94217-34-2(HCl salt)
    M.F.: C10H19NO
    M.W.: 169.26
  • QV200104
    Vitamin A epoxide
    CAS# 512-39-0
    M.F.: C20H30O2
    M.W.: 302.45
  • QA122613
    Alprazolam Impurity 13
    CAS# NA
    M.F.: C15H13ClN4
    M.W.: 284.74
  • QA122612
    Alprazolam Impurity 12
    CAS# 5220-83-7
    M.F.: C15H11ClN2O
    M.W.: 270.71
  • QM031626
    Mycophenolate Impurity 26
    CAS# NA
    M.F.: C17H20O7
    M.W.: 336.34
  • QT012800
    Taurocholic Acid Sodium Salt Hydrate
    CAS# 345909-26-4; 81-24-3(free base);145-42-6(Na salt)
    M.F.: C26H44NNaO7S XH2O
    M.W.: 537.68 X18.02
  • QF120318
    Folic Acid Impurity 18
    CAS# NA
    M.F.: C7H7N5O2
    M.W.: 193.16
  • QF120317
    Folic Acid Impurity 17
    CAS# 948-60-7
    M.F.: C7H5N5O3
    M.W.: 207.15
  • QF120316
    Folic Acid Impurity 16
    CAS# 708-75-8
    M.F.: C7H7N5O
    M.W.: 177.16
  • QD050120
    Dexrazoxane Impurity 20
    CAS# NA
    M.F.: C14H24N2O8
    M.W.: 348.35
  • QE042849
    Edoxaban Impurity 49
    CAS# NA
    M.F.: C8H11IN2OS2
    M.W.: 342.22
  • QT183100
    Trihydroxycoprostanic Acid
    CAS# 547-98-8
    M.F.: C27H46O5
    M.W.: 450.65
  • QP020382
    Palbociclib Impurity 82
    CAS# 1023594-50-4
    M.F.: C14H22N4O2
    M.W.: 278.35
  • QA1624147
    Apixaban Impurity 147
    CAS# NA
    M.F.: C27H28N4O5
    M.W.: 488.54
  • QA1624146
    Apixaban Impurity 146
    CAS# NA
    M.F.: C25H25N5O4
    M.W.: 459.50
  • QD160768
    Dapagliflozin Impurity 68
    CAS# NA
    M.F.: C10H20O6
    M.W.: 236.26
  • QD160766
    Dapagliflozin Impurity 66
    CAS# NA
    M.F.: C15H14ClIO2
    M.W.: 388.63
  • QS060287
    Sofosbuvir Impurity 87
    CAS# NA
    M.F.: C31H26FN3O7
    M.W.: 571.55
  • QC242034
    Cefoxitin Impurity 34
    CAS# NA
    M.F.: C10H14N2O3S
    M.W.: 242.29
  • QA142703
    Androstenediol Impurity 3
    CAS# 68539-12-8
    M.F.: C19H24O2
    M.W.: 284.39
  • QF051805
    Ferulic acid Impurity 5
    CAS# 32263-14-2
    M.F.: C9H10O3
    M.W.: 166.17
  • QF051804
    Ferulic acid Impurity 4
    CAS# 2931-90-0
    M.F.: C9H8O4
    M.W.: 180.16
  • QP184001
    Pregnanediol-3alpha-glucuronide
    CAS# 1852-49-9
    M.F.: C27H44O8
    M.W.: 496.63
  • QO192071
    Oseltamivir Impurity 71
    CAS# NA
    M.F.: C22H32N2O6
    M.W.: 420.50
  • QV050308
    Vecuronium Bromide Impurity 8
    CAS# 13522-16-2
    M.F.: C29H50N2O2
    M.W.: 458.72
  • QV050307
    Vecuronium Bromide Impurity 7
    CAS# 13522-14-0
    M.F.: C29H48N2O2
    M.W.: 456.70
  • QL091663
    Lipoic Acid Impurity 37
    CAS# NA
    M.F.: C8H14O3S2
    M.W.: 222.32
  • QT180673
    Tirofiban Impurity 73
    CAS# 10147-36-1
    M.F.: C3H7ClO2S
    M.W.: 142.60
  • QV010714
    Valganciclovir EP Impurity P
    CAS# 897937-73-4
    M.F.: C19H31N7O6
    M.W.: 453.49
  • QP180781
    Pregabalin Impurity 81
    CAS# NA
    M.F.: C8H14N2O
    M.W.: 154.21
  • QL091662
    Lipoic Acid Impurity 36
    CAS# 188783-96-2
    M.F.: C8H14O3S2
    M.W.: 222.32
  • QL091661
    Lipoic Acid Impurity 35
    CAS# NA
    M.F.: C8H14O3S2
    M.W.: 222.32
  • QL091660
    Lipoic Acid Impurity 34
    CAS# NA
    M.F.: C8H14O3S2
    M.W.: 222.32
  • QL091659
    Lipoic Acid Impurity 33
    CAS# 188745-24-6
    M.F.: C8H14O3S2
    M.W.: 222.32
  • QL091658
    Lipoic Acid Impurity 32
    CAS# 119365-69-4
    M.F.: C8H16O2S2
    M.W.: 208.34
  • QK201632
    Ketoprofen Impurity 32
    CAS# 1853132-06-5
    M.F.: C26H32O3
    M.W.: 392.53
  • QC0303106
    Cinacalcet Impurity 106
    CAS# 217483-10-8
    M.F.: C17H20O3S
    M.W.: 304.40
  • QD182400
    Droxidopa
    CAS# 23651-95-8
    M.F.: C9H11NO5
    M.W.: 213.19
  • QD050400
    Dehydrocholic acid
    CAS# 81-23-2
    M.F.: C24H34O5
    M.W.: 402.52
  • QE161242
    Epalrestat Impurity 16
    CAS# 1151944-57-8
    M.F.: C12H9NO3S2
    M.W.: 279.33
  • QC022023
    Cabazitaxel Impurity 23
    CAS# NA
    M.F.: C44H55NO14
    M.W.: 821.91
  • QI201511
    Itopride Impurity K
    CAS# 3943-77-9
    M.F.: C11H14O4
    M.W.: 210.23
  • QT180624
    Tirofiban Impurity X
    CAS# NA
    M.F.: C22H35ClN2O5S HCl
    M.W.: 475.04 36.46
  • QU190432
    Ursodeoxycholic Acid Impurity 32
    CAS# 108179-87-9
    M.F.: C24H40O5
    M.W.: 408.57
  • QU190431
    Ursodeoxycholic Acid Impurity 31
    CAS# 80434-32-8
    M.F.: C24H40O5
    M.W.: 408.57
  • QU190430
    Ursodeoxycholic Acid Impurity 30
    CAS# 2393-59-1
    M.F.: C24H40O5
    M.W.: 408.57
  • QU190429
    Ursodeoxycholic Acid Impurity 29
    CAS# 2393-58-0
    M.F.: C24H40O5
    M.W.: 408.57
  • QU190428
    Ursodeoxycholic Acid Impurity 28
    CAS# 6830-03-1
    M.F.: C24H40O5
    M.W.: 408.57
  • QU190427
    Ursodeoxycholic Acid Impurity 27
    CAS# 3338-16-7
    M.F.: C24H40O5
    M.W.: 408.57
  • QU190426
    Ursodeoxycholic Acid Impurity 26
    CAS# 570-62-7
    M.F.: C24H40O4
    M.W.: 392.57
  • QC080302
    Cholic Acid Impurity 2
    CAS# 566-24-5
    M.F.: C24H40O4
    M.W.: 392.57
  • QC080301
    Cholic Acid Impurity 1
    CAS# 89238-74-4
    M.F.: C24H40O4
    M.W.: 392.57
  • QE201933
    Sacubitril Impurity 33
    CAS# NA
    M.F.: C25H33NO5
    M.W.: 427.53
  • QS212500
    Suxamethonium chloride
    CAS# 6101-15-1
    M.F.: C14H34Cl2N2O6
    M.W.: 397.34
  • QV307761
    Vitamin B6 Impurity 61
    CAS# 58947-70-9
    M.F.: C8H9NO3
    M.W.: 167.16
  • QF051803
    Ferulic acid Impurity 3
    CAS# 4475-29-0
    M.F.: C11H10O6
    M.W.: 238.19
  • QF051802
    trans-Ferulic acid
    CAS# 537-98-4
    M.F.: C10H10O4
    M.W.: 194.18
  • QF051801
    cis-Ferulic acid;
    Ferulic acid (cis)

    CAS# 1014-83-1
    M.F.: C10H10O4
    M.W.: 194.18
  • QB131602
    Bimatoprost Impurity B
    CAS# NA
    M.F.: C25H37NO5
    M.W.: 431.56
  • QB131601
    Bimatoprost
    CAS# 155206-00-1
    M.F.: C25H37NO4
    M.W.: 415.57
  • QP1824106
    Parecoxib Sodium Impurity 80
    CAS# 198470-82-5
    M.F.: C20H20N2O4S
    M.W.: 384.45
  • QL050325
    Lercanidipine Impurity 25
    CAS# NA
    M.F.: C23H35NOSi
    M.W.: 369.62
  • QV220504
    Vedaprofen EP Impurity D
    CAS# NA
    M.F.: C19H22O2
    M.W.: 282.38
  • QP261633
    Pazopanib Impurity 33
    CAS# 1226500-00-0
    M.F.: C28H30N4O2S
    M.W.: 486.63
  • QP261630
    Pazopanib Impurity 30
    CAS# 1036585-24-6
    M.F.: C7H10N2O2S
    M.W.: 186.23
  • QI091628
    Ipratropium Bromide Impurity 28
    CAS# 30833-12-6
    M.F.: C10H17NO3
    M.W.: 199.25
  • QV220501
    Vedaprofen EP Impurity A
    CAS# NA
    M.F.: C20H24O2
    M.W.: 296.40
  • QV220103
    Valnemulin hydrochloride EP Impurity C
    CAS# NA
    M.F.: C36H61N3O6S
    M.W.: 663.95
  • QV220102
    Valnemulin hydrochloride EP Impurity B
    CAS# NA
    M.F.: C26H43NO4S
    M.W.: 465.69
  • QV220101
    Valnemulin hydrochloride EP Impurity A
    CAS# NA
    M.F.: C31H52N2O6S
    M.W.: 580.82
  • QV220100
    Valnemulin hydrochloride
    CAS# 133868-46-9;101312-92-9(free base)
    M.F.: C31H52N2O5S.HCl
    M.W.: 564.83 36.46
  • QU140400
    Undecylenic acid
    CAS# 112-38-9
    M.F.: C11H20O2
    M.W.: 184.28
  • QT181007
    Trimipramine maleate EP Impurity G
    CAS# NA
    M.F.: C15H15N
    M.W.: 209.29
  • QT181005
    Trimipramine maleate EP Impurity E
    CAS# NA
    M.F.: C25H37N3
    M.W.: 379.58
  • QT181003
    Trimipramine maleate EP Impurity C
    CAS# NA
    M.F.: C20H24N2
    M.W.: 292.42
  • QT181002
    Trimipramine maleate EP Impurity B
    CAS# 2293-21-2;10464-24-1(HCl salt)
    M.F.: C19H24N2
    M.W.: 280.41
  • QT181001
    Trimipramine maleate EP Impurity A
    CAS# NA
    M.F.: C20H26N2O
    M.W.: 310.43
  • QT181000
    Trimipramine maleate
    CAS# 521-78-8
    M.F.: C24H30N2O4
    M.W.: 410.51
  • QT011302
    Tramazoline hydrochloride monohydrate EP Impurity B
    CAS# NA
    M.F.: C30H38N6O2
    M.W.: 514.66
  • QT011301
    Tramazoline hydrochloride monohydrate EP Impurity A
    CAS# NA
    M.F.: C13H13N3
    M.W.: 211.26
  • QT011300
    Tramazoline hydrochloride monohydrate
    CAS# 74195-73-6
    M.F.: C13H20ClN3O
    M.W.: 269.77
  • QT151700
    Tosylchloramide sodium
    CAS# NA
    M.F.: C7H13ClNNaO5S
    M.W.: 281.69
  • QT151504
    Tolnaftate EP Impurity D
    CAS# NA
    M.F.: C8H11N
    M.W.: 121.18
  • QT151502
    Tolnaftate EP Impurity B
    CAS# 127084-74-6
    M.F.: C21H14O2S
    M.W.: 330.40
  • QT151403
    Tolfenamic acid EP Impurity C
    CAS# NA
    M.F.: C14H10ClNO
    M.W.: 243.69
  • QT151402
    Tolfenamic acid EP Impurity B
    CAS# 87-60-5
    M.F.: C7H8ClN
    M.W.: 141.60
  • QT151400
    Tolfenamic acid
    CAS# 13710-19-5
    M.F.: C14H12ClNO2
    M.W.: 261.70
  • QT151303
    Tolbutamide EP Impurity C
    CAS# NA
    M.F.: C14H21N3O3S
    M.W.: 311.40
  • QT090803
    Tioconazole EP Impurity C
    CAS# 119386-76-4
    M.F.: C16H12BrCl3N2OS
    M.W.: 466.61
  • QT090801
    Tioconazole EP Impurity A
    CAS# 119386-74-2
    M.F.: C16H14Cl2N2OS
    M.W.: 353.27
  • QT090706
    Tiaprofenic acid EP Impurity F
    CAS# NA
    M.F.: C11H7BrOS
    M.W.: 267.14
  • QT090705
    Tiaprofenic acid EP Impurity E
    CAS# NA
    M.F.: C7H8O2S
    M.W.: 156.20
  • QT090703
    Tiaprofenic acid EP Impurity C
    CAS# NA
    M.F.: C14H12O3S
    M.W.: 260.31
  • QT090702
    Tiaprofenic acid EP Impurity B
    CAS# NA
    M.F.: C13H10O2S
    M.W.: 230.28
  • QT090701
    Tiaprofenic acid EP Impurity A
    CAS# NA
    M.F.: C13H12OS
    M.W.: 216.30
  • QT090700
    Tiaprofenic acid
    CAS# 33005-95-7
    M.F.: C14H12O3S
    M.W.: 260.31
  • QT090505
    Tianeptine sodium EP Impurity E
    CAS# NA
    M.F.: C28H37ClN2O6S
    M.W.: 565.12
  • QT090504
    Tianeptine sodium EP Impurity D
    CAS# NA
    M.F.: C21H23ClN2O4S
    M.W.: 434.94
  • QT090503
    Tianeptine sodium EP Impurity C
    CAS# NA
    M.F.: C14H10ClNO3S
    M.W.: 307.75
  • QT090502
    Tianeptine sodium EP Impurity B
    CAS# NA
    M.F.: C23H29ClN2O4S
    M.W.: 465.01
  • QT090501
    Tianeptine sodium EP Impurity A
    CAS# NA
    M.F.: C9H17BrO2
    M.W.: 237.13
  • QT090500
    Tianeptine sodium
    CAS# 30123-17-2;66981-73-5(free base)
    M.F.: C21H24ClN2NaO4S
    M.W.: 458.93
  • QA070278
    Argatroban Impurity 52
    CAS# NA
    M.F.: C24H38N6O5S
    M.W.: 522.66
  • QT081604
    Thiopental sodium and sodium carbonate EP Impurity D
    CAS# NA
    M.F.: C11H20N2O3S
    M.W.: 260.35
  • QT081603
    Thiopental sodium and sodium carbonate EP Impurity C
    CAS# NA
    M.F.: C11H18N2O2S
    M.W.: 242.34
  • QT081601
    Thiopental sodium and sodium carbonate EP Impurity A
    CAS# NA
    M.F.: C9H14N2O2S
    M.W.: 214.28
  • QT081600
    Thiopental sodium and sodium carbonate
    CAS# NA
    M.F.: C11H17N2NaO2S
    M.W.: 264.32
  • QT052301
    Tetryzoline hydrochloride EP Impurity A
    CAS# NA
    M.F.: C11H11N
    M.W.: 157.21
  • QT052300
    Tetryzoline hydrochloride
    CAS# 522-48-5
    M.F.: C13H17ClN2
    M.W.: 236.74
  • QT052203
    Tetracaine hydrochloride EP Impurity C
    CAS# 71839-12-8
    M.F.: C12H17NO2
    M.W.: 207.27
  • QT052202
    Tetracaine hydrochloride EP Impurity B
    CAS# 4740-24-3
    M.F.: C11H15NO2
    M.W.: 193.24
  • QT052200
    Tetracaine hydrochloride
    CAS# 136-47-0;94-24-6(free base)
    M.F.: C15H24N2O2.HCl
    M.W.: 264.37 36.46
  • QT052110
    Terfenadine EP Impurity J
    CAS# NA
    M.F.: C22H35NO3
    M.W.: 361.52
  • QT052108
    Terfenadine EP Impurity H
    CAS# NA
    M.F.: C32H41NO
    M.W.: 455.67
  • QT052104
    Terfenadine EP Impurity D
    CAS# NA
    M.F.: C32H39NO
    M.W.: 453.66
  • QT052103
    Terfenadine EP Impurity C
    CAS# NA
    M.F.: C32H41NO3
    M.W.: 487.67
  • QT052102
    Terfenadine EP Impurity B
    CAS# NA
    M.F.: C32H41NO
    M.W.: 455.67
  • QM050610
    Mefenamic Acid Impurity 10
    CAS# NA
    M.F.: C13H8Cl2O2
    M.W.: 267.11
  • QT052101
    Terfenadine EP Impurity A
    CAS# NA
    M.F.: C32H39NO2
    M.W.: 469.66
  • QT130107
    Temazepam EP Impurity G
    CAS# 93329-92-1
    M.F.: C17H15ClN2O2
    M.W.: 314.77
  • QT130106
    Temazepam EP Impurity F
    CAS# 3294-96-0
    M.F.: C16H13ClN2O2
    M.W.: 300.74
  • QT130105
    Controlled Substance
    (Temazepam EP Impurity E)

    CAS# 2888-64-4
    M.F.: C16H13ClN2O2
    M.W.: 300.74
  • QT130104
    Temazepam EP Impurity D
    CAS# 17191-70-7
    M.F.: C17H15ClN2O2
    M.W.: 314.77
  • QT130102
    Controlled Substance
    (Temazepam EP Impurity B;Oxazepam)

    CAS# 604-75-1
    M.F.: C15H11ClN2O2
    M.W.: 286.71
  • QS211703
    Sulindac EP Impurity C
    CAS# 49627-27-2
    M.F.: C20H17FO2S
    M.W.: 340.41
  • QS211702
    Sulindac EP Impurity B
    CAS# 59973-80-7
    M.F.: C20H17FO4S
    M.W.: 372.41
  • QS211701
    Sulindac EP Impurity A
    CAS# 53933-60-1
    M.F.: C20H17FO3S
    M.W.: 356.41
  • QI192222
    Isavuconazole Impurity 22
    CAS# NA
    M.F.: C29H35ClF2N8O5S
    M.W.: 681.15
  • QS211601
    Sulfinpyrazone EP Impurity A
    CAS# NA
    M.F.: C23H20N2O4S
    M.W.: 420.48
  • QS211405
    Sulfadimidine EP Impurity E
    CAS# 144-80-9
    M.F.: C8H10N2O3S
    M.W.: 214.24
  • QS211400
    Sulfadimidine
    CAS# 57-68-1
    M.F.: C12H14N4O2S
    M.W.: 278.33
  • QS211205
    Sulfadiazine EP Impurity E
    CAS# 127-74-2
    M.F.: C12H12N4O3S
    M.W.: 292.31
  • QS211201
    Sulfadiazine EP Impurity A
    CAS# 109-12-6
    M.F.: C4H5N3
    M.W.: 95.10
  • QS531507
    Sucralose EP Impurity G
    CAS# NA
    M.F.: C12H18Cl2O8
    M.W.: 361.17
  • QS531506
    Sucralose EP Impurity F
    CAS# NA
    M.F.: C12H20Cl2O9
    M.W.: 379.19
  • QS531505
    Sucralose EP Impurity E
    CAS# NA
    M.F.: C12H20Cl2O9
    M.W.: 379.19
  • QS531502
    Sucralose EP Impurity B
    CAS# NA
    M.F.: C12H19Cl3O8
    M.W.: 397.63
  • QS201800
    Streptomycin sulfate
    CAS# 3810-74-0;57-92-1(free base)
    M.F.: C42H84N14O36S3
    M.W.: 1457.38
  • QP1903103
    Posaconazole Impurity 103
    CAS# 81445-44-5
    M.F.: C10H12O2
    M.W.: 164.20
  • QS201402
    Stanozolol EP Impurity B
    CAS# NA
    M.F.: C21H32O3
    M.W.: 332.48
  • QS201400
    Stanozolol
    CAS# 10418-03-8
    M.F.: C21H32N2O
    M.W.: 328.49
  • QS152004
    Sotalol hydrochloride EP Impurity D
    CAS# 2724689-38-5;2724689-39-6(HCl salt)
    M.F.: C12H20N2O3S
    M.W.: 272.36
  • QS152003
    Sotalol hydrochloride EP Impurity C
    CAS# 83922-54-7
    M.F.: C8H9NO3S
    M.W.: 199.23
  • QS152002
    Sotalol hydrochloride EP Impurity B
    CAS# 60735-85-5;5576-49-8(HCl salt)
    M.F.: C12H18N2O3S
    M.W.: 270.35
  • QS152001
    Sotalol hydrochloride EP Impurity A
    CAS# 16974-42-8;16974-44-0(HCl salt)
    M.F.: C12H20N2O2S
    M.W.: 256.36
  • QS152000
    Sotalol hydrochloride
    CAS# 959-24-0;3930-20-9(free base);
    366-80-3(2HCl salt);1350271-32-7(HBr salt)
    M.F.: C12H21ClN2O3S
    M.W.: 308.82
  • QC051400
    Cefalotin Sodium
    CAS# 58-71-9
    M.F.: C16H15N2NaO6S2
    M.W.: 418.42
  • QS151100
    Sodium salicylate
    CAS# 54-21-7
    M.F.: C7H5NaO3
    M.W.: 160.10
  • QS151000
    Sodium propionate
    CAS# 137-40-6
    M.F.: C3H5NaO2
    M.W.: 96.06
  • QS150900
    Ethylparaben sodium;Sodium ethyl parahydroxybenzoate
    CAS# 35285-68-8
    M.F.: C9H9NaO3
    M.W.: 188.16
  • QS150810
    Sodium caprylate EP Impurity J;
    Caprylic acid EP Impurity J

    CAS# NA
    M.F.: C8H14O2
    M.W.: 142.20
  • QS150809
    Sodium caprylate EP Impurity I;
    Caprylic acid EP Impurity I

    CAS# NA
    M.F.: C11H22O2
    M.W.: 170.29
  • QS150808
    Sodium caprylate EP Impurity H;
    Caprylic acid EP Impurity H

    CAS# 110-42-9
    M.F.: C11H22O2
    M.W.: 186.29
  • QS150807
    Sodium caprylate EP Impurity G;
    Caprylic acid EP Impurity G

    CAS# NA
    M.F.: C10H20O2
    M.W.: 172.26
  • QS150806
    Sodium caprylate EP Impurity F;
    Caprylic acid EP Impurity F

    CAS# 111-11-5
    M.F.: C9H18O2
    M.W.: 158.24
  • QS150804
    Sodium caprylate EP Impurity D;
    Caprylic acid EP Impurity D;Decanoic acid

    CAS# 334-48-5
    M.F.: C10H20O2
    M.W.: 172.26
  • QS150803
    Sodium caprylate EP Impurity C;
    Caprylic acid EP Impurity C;Nonanoic acid

    CAS# NA
    M.F.: C9H18O2
    M.W.: 158.24
  • QS150802
    Sodium caprylate EP Impurity B
    CAS# NA
    M.F.: C7H14O2
    M.W.: 130.18
  • QS150801
    Sodium caprylate EP Impurity A
    CAS# NA
    M.F.: C6H12O2
    M.W.: 116.16
  • QS150800
    Sodium caprylate
    CAS# 1984-06-1
    M.F.: C8H15NaO2
    M.W.: 166.19
  • QS150701
    Sodium calcium edetate EP Impurity A
    CAS# 139-13-9
    M.F.: C6H9NO6
    M.W.: 191.14
  • QS150700
    Sodium calcium edetate
    CAS# 62-33-9
    M.F.: C10H12CaN2Na2O8,xH2O
    M.W.: 374.27,x18.02
  • QZ090300
    Zinc undecylenate
    CAS# 557-08-4
    M.F.: C22H38O4Zn
    M.W.: 431.91
  • QZ091403
    Zinc acexamate EP Impurity C
    CAS# 1888-91-1
    M.F.: C8H13NO2
    M.W.: 155.19
  • QZ091401
    Zinc acexamate EP Impurity A
    CAS# NA
    M.F.: C14H26N2O4
    M.W.: 286.37
  • QZ091400
    Zinc acexamate
    CAS# 70020-71-2
    M.F.: C16H28N2O6Zn
    M.W.: 409.78
  • QY151205
    Yohimbine hydrochloride EP Impurity E
    CAS# NA
    M.F.: C22H28N2O3
    M.W.: 368.47
  • QS150600
    Sodium aminosalicylate dihydrate
    CAS# 6018-19-5
    M.F.: C7H10NNaO5
    M.W.: 211.15
  • QS150502
    Sodium amidotrizoate EP Impurity B;
    Amidotrizoic Acid EP Impurity B

    CAS# NA
    M.F.: C11H10I2N2O4
    M.W.: 488.02
  • QS150500
    Sodium amidotrizoate
    CAS# 737-31-5
    M.F.: C11H8I3N2NaO4
    M.W.: 635.90
  • QS150400
    Sodium alendronate trihydrate
    CAS# 121268-17-5
    M.F.: C4H18NNaO10P2
    M.W.: 325.12
  • QS052000
    Sertaconazole nitrate
    CAS# 99592-39-9
    M.F.: C20H16Cl3N3O4S
    M.W.: 500.78
  • QS051300
    Selenium disulfide
    CAS# 7488-56-4
    M.F.: S2Se
    M.W.: 143.09
  • QS011708
    Saquinavir mesilate EP Impurity H
    CAS# NA
    M.F.: C38H47N5O5
    M.W.: 653.81
  • QS011707
    Saquinavir mesilate EP Impurity G
    CAS# NA
    M.F.: C39H51N5O6
    M.W.: 685.85
  • QS011706
    Saquinavir mesilate EP Impurity F
    CAS# NA
    M.F.: C38H48N6O4
    M.W.: 652.83
  • QS011705
    Saquinavir mesilate EP Impurity E
    CAS# NA
    M.F.: C38H49N5O6
    M.W.: 671.83
  • QS011704
    Saquinavir mesilate EP Impurity D
    CAS# NA
    M.F.: C38H50N6O5
    M.W.: 670.84
  • QS011703
    Saquinavir mesilate EP Impurity C
    CAS# NA
    M.F.: C24H39N3O2
    M.W.: 401.59
  • QS011702
    Saquinavir mesilate EP Impurity B
    CAS# NA
    M.F.: C16H17N3O4
    M.W.: 315.32
  • QS011701
    Saquinavir mesilate EP Impurity A
    CAS# NA
    M.F.: C14H13N3O4
    M.W.: 287.27
  • QS011700
    Saquinavir mesilate
    CAS# 149845-06-7
    M.F.: C39H54N6O8S
    M.W.: 766.95
  • QS011230
    Salmeterol xinafoate
    CAS# 94749-08-3;89365-50-4(free base)
    M.F.: C36H45NO7
    M.W.: 603.75
  • QS010410
    Saccharin sodium
    CAS# 128-44-9
    M.F.: C7H4NNaO3S
    M.W.: 205.17
  • QR212203
    Rutoside trihydrate EP Impurity C;
    Quercetin

    CAS# 117-39-5
    M.F.: C15H10O7
    M.W.: 302.24
  • QR212202
    Rutoside trihydrate EP Impurity B;
    Nicotiflorin;Kaempferol-3-O-rutinoside

    CAS# 17650-84-9
    M.F.: C27H30O15
    M.W.: 594.52
  • QR212201
    Rutoside trihydrate EP Impurity A
    CAS# 21637-25-2
    M.F.: C21H20O12
    M.W.: 464.38
  • QR212200
    Rutoside trihydrate
    CAS# 250249-75-3
    M.F.: C27H36O19
    M.W.: 664.56
  • QR091905
    Risedronate sodium 2.5-hydrate EP Impurity E
    CAS# 75755-10-1
    M.F.: C7H11NO6P2
    M.W.: 267.11
  • QR091904
    Risedronate sodium 2.5-hydrate EP Impurity D
    CAS# 501-81-5
    M.F.: C7H7NO2
    M.W.: 137.14
  • QR091903
    Risedronate sodium 2.5-hydrate EP Impurity C
    CAS# 105462-25-7
    M.F.: C7H11NO7P2
    M.W.: 283.11
  • QR091902
    Risedronate sodium 2.5-hydrate EP Impurity B
    CAS# 105462-23-5;1220806-40-5(monohydrate)
    M.F.: C7H11NO7P2
    M.W.: 283.11
  • QR091901
    Risedronate sodium 2.5-hydrate EP Impurity A
    CAS# 1486617-90-6;1486466-30-1(2Na salt)
    M.F.: C14H18N2O12P4
    M.W.: 530.20
  • QR091900
    Risedronate sodium 2.5-hydrate
    CAS# 329003-65-8
    M.F.: C7H10NNaO7P2,2½H2O
    M.W.: 350.13
  • QM040139
    Midazolam Impurity 13
    CAS# 60656-76-0
    M.F.: C16H11ClFN3O3
    M.W.: 347.73
  • QR091303
    Rilmenidine dihydrogen phosphate EP Impurity C
    CAS# NA
    M.F.: C17H26N2O
    M.W.: 274.40
  • QR091302
    Rilmenidine dihydrogen phosphate EP Impurity B
    CAS# NA
    M.F.: C10H17ClN2O
    M.W.: 216.71
  • QR091301
    Rilmenidine dihydrogen phosphate EP Impurity A
    CAS# NA
    M.F.: C10H18N2O2
    M.W.: 198.26
  • QR091300
    Rilmenidine dihydrogen phosphate
    CAS# 85409-38-7
    M.F.: C10H19N2O5P
    M.W.: 278.24
  • QR090705
    Rifabutin EP Impurity E
    CAS# 100324-63-8
    M.F.: C44H60N4O10
    M.W.: 804.97
  • QR090704
    Rifabutin EP Impurity D
    CAS# 62041-01-4
    M.F.: C37H47N3O11
    M.W.: 709.78
  • QR090702
    Rifabutin EP Impurity B
    CAS# 51756-80-0
    M.F.: C37H46N2O12
    M.W.: 710.77
  • QR090701
    Rifabutin EP Impurity A
    CAS# NA
    M.F.: C9H17NO
    M.W.: 155.24
  • QQ211403
    Quinidine sulfate EP Impurity C
    CAS# NA
    M.F.: C20H26N2O2
    M.W.: 326.43
  • QQ211402
    Quinidine sulfate EP Impurity B
    CAS# NA
    M.F.: C19H22N2O
    M.W.: 294.39
  • QQ211401
    Quinidine sulfate EP Impurity A
    CAS# NA
    M.F.: C20H24N2O2
    M.W.: 324.42
  • QP252002
    Pyridostigmine bromide EP Impurity B
    CAS# NA
    M.F.: C6H8NO
    M.W.: 110.13
  • QP252001
    Pyridostigmine bromide EP Impurity A
    CAS# 51581-32-9
    M.F.: C8H10N2O2
    M.W.: 166.18
  • QP252000
    Pyridostigmine bromide
    CAS# 101-26-8;155-97-5(cation form)
    M.F.: C9H13BrN2O2
    M.W.: 261.12
  • QP251903
    Pyrantel embonate EP Impurity C
    CAS# NA
    M.F.: C5H4OS
    M.W.: 112.15
  • QP251902
    Pyrantel embonate EP Impurity B
    CAS# NA
    M.F.: C11H16N2OS
    M.W.: 224.32
  • QP251901
    Pyrantel embonate EP Impurity A
    CAS# 36700-38-6
    M.F.: C11H14N2S
    M.W.: 206.31
  • QP251900
    Pyrantel embonate
    CAS# 22204-24-6
    M.F.: C34H30N2O6S
    M.W.: 594.68
  • QP152104
    Protirelin EP Impurity D
    CAS# NA
    M.F.: C16H21N5O5
    M.W.: 363.37
  • QP152102
    Protirelin EP Impurity B
    CAS# NA
    M.F.: C16H22N6O4
    M.W.: 362.38
  • QP152101
    Protirelin EP Impurity A
    CAS# NA
    M.F.: C16H22N6O4
    M.W.: 362.38
  • QP151802
    Propyphenazone EP Impurity B
    CAS# NA
    M.F.: C14H18N2O
    M.W.: 230.31
  • QP151800
    Propyphenazone
    CAS# 479-92-5
    M.F.: C14H18N2O
    M.W.: 230.31
  • QP151700
    Propantheline bromide
    CAS# 50-34-0
    M.F.: C23H30BrNO3
    M.W.: 448.39
  • QP151600
    Propacetamol hydrochloride
    CAS# 66532-86-3
    M.F.: C14H20N2O3.HCl
    M.W.: 264.32 36.46
  • QP151501
    Promazine hydrochloride EP Impurity A
    CAS# NA
    M.F.: C17H20N2OS
    M.W.: 300.42
  • QP150704
    Proguanil hydrochloride EP Impurity D
    CAS# NA
    M.F.: C8H19N5
    M.W.: 185.27
  • QP150703
    Proguanil hydrochloride EP Impurity C
    CAS# NA
    M.F.: C14H13Cl2N5
    M.W.: 322.19
  • QP150701
    Proguanil hydrochloride EP Impurity A
    CAS# NA
    M.F.: C5H10N4
    M.W.: 126.16
  • QP150700
    Proguanil hydrochloride
    CAS# 637-32-1;500-92-5(free base)
    M.F.: C11H16ClN5.HCl
    M.W.: 253.73 36.46
  • QP150300
    Prochlorperazine maleate
    CAS# 84-02-6
    M.F.: C28H32ClN3O8S
    M.W.: 606.09
  • QP150204
    Probenecid EP Impurity D
    CAS# 70190-76-0
    M.F.: C15H23NO4S
    M.W.: 313.41
  • QM050609
    Mefenamic Acid Impurity 9
    CAS# NA
    M.F.: C14H9ClO4
    M.W.: 276.67
  • QP150203
    Probenecid EP Impurity C
    CAS# NA
    M.F.: C19H32N2O3S
    M.W.: 368.53
  • QM050608
    Mefenamic Acid Impurity 8
    CAS# NA
    M.F.: C13H8Cl2O2
    M.W.: 267.11
  • QM050607
    Mefenamic Acid Impurity 7
    CAS# NA
    M.F.: C13H8Cl2O2
    M.W.: 267.11
  • QP150201
    Probenecid EP Impurity A
    CAS# 636-78-2
    M.F.: C7H6O5S
    M.W.: 202.18
  • QP150200
    Probenecid
    CAS# 57-66-9
    M.F.: C13H19NO4S
    M.W.: 285.36
  • QM050606
    Mefenamic Acid Impurity 6
    CAS# NA
    M.F.: C13H8Cl2O2
    M.W.: 267.11
  • QT211500
    Taurochenodeoxycholic Acid
    CAS# 516-35-8;6009-98-9(Na salt)
    M.F.: C26H45NO6S
    M.W.: 499.70
  • QF012218
    Favipiravir Impurity 18
    CAS# 2305633-62-7
    M.F.: C5H2BrN3O
    M.W.: 199.99
  • QT0307166
    Ticagrelor Impurity 166
    CAS# 187666-88-2
    M.F.: C7H10N2O2S
    M.W.: 186.23
  • QC031612
    Cefcapene pivoxil Impurity 12
    CAS# NA
    M.F.: C22H27N5O8S2
    M.W.: 553.61
  • QC031611
    Cefcapene pivoxil Impurity 11
    CAS# 105889-80-3
    M.F.: C28H37N5O10S2
    M.W.: 667.75
  • QC031609
    Cefcapene pivoxil Impurity 9
    CAS# NA
    M.F.: C24H30N4O8S2
    M.W.: 566.65
  • QC031608
    Cefcapene pivoxil Impurity 8
    CAS# NA
    M.F.: C22H28N4O7S2
    M.W.: 524.61
  • QC031607
    Cefcapene pivoxil Impurity 7
    CAS# NA
    M.F.: C23H31N5O9S2
    M.W.: 585.65
  • QC031606
    Cefcapene pivoxil Impurity 6
    CAS# NA
    M.F.: C23H29N5O9S2
    M.W.: 583.63
  • QC031605
    Cefcapene pivoxil Impurity 5
    CAS# NA
    M.F.: C39H45N9O12S4
    M.W.: 960.09
  • QC031604
    Cefcapene pivoxil Impurity 4
    CAS# NA
    M.F.: C17H19N5O6S2
    M.W.: 453.49
  • QC031603
    Cefcapene pivoxil Impurity 3
    CAS# NA
    M.F.: C23H29N5O8S2
    M.W.: 567.64
  • QC031602
    Cefcapene pivoxil Impurity 2
    CAS# NA
    M.F.: C23H29N5O8S2
    M.W.: 567.64
  • QC031601
    Cefcapene pivoxil Impurity 1
    CAS# NA
    M.F.: C16H16N4O4S2
    M.W.: 392.45
  • QC031600
    Cefcapene pivoxil
    CAS# 105889-45-0;147816-23-7(HCl salt);
    147816-24-8(H2O HCl salt)
    M.F.: C23H29N5O8S2
    M.W.: 567.64
  • QC250223
    Cytarabine Impurity 23
    CAS# 6698-20-0
    M.F.: C9H11N3O4
    M.W.: 225.20
  • QT142424
    Tranexamic Acid Impurity 24
    CAS# NA
    M.F.: C16H28N2O3
    M.W.: 296.41
  • QT142423
    Tranexamic Acid Impurity 23
    CAS# NA
    M.F.: C16H16N2O3
    M.W.: 284.31
  • QT142422
    Tranexamic Acid Impurity 22
    CAS# 98270-32-7
    M.F.: C24H21NO6
    M.W.: 419.43
  • QT142421
    Tranexamic Acid Impurity 21
    CAS# 14900-61-9
    M.F.: C16H15NO4
    M.W.: 285.29
  • QT142420
    Tranexamic Acid Impurity 20
    CAS# 179076-85-8
    M.F.: C8H9NO3
    M.W.: 167.16
  • QT142419
    Tranexamic Acid Impurity 19
    CAS# 165530-43-8;549531-01-3(HCl salt)
    M.F.: C8H8ClNO2
    M.W.: 185.61
  • QT142418
    Tranexamic Acid Impurity 18
    CAS# 100-21-0
    M.F.: C8H6O4
    M.W.: 166.13
  • QT142417
    Tranexamic Acid Impurity 17
    CAS# 121-91-5
    M.F.: C8H6O4
    M.W.: 166.13
  • QT142416
    Tranexamic Acid Impurity 16
    CAS# 85888-81-9
    M.F.: C8H7ClO2
    M.W.: 170.59
  • QT142415
    Tranexamic Acid Impurity 15
    CAS# 31719-77-4
    M.F.: C8H7ClO2
    M.W.: 170.59
  • QT142414
    Tranexamic Acid Impurity 14
    CAS# 5264-40-4
    M.F.: C8H5Cl3O2
    M.W.: 239.48
  • QT142413
    Tranexamic Acid Impurity 13
    CAS# 5278-91-1
    M.F.: C8H6Cl2O2
    M.W.: 205.04
  • QT142412
    Tranexamic Acid Impurity 12
    CAS# 1564748-46-4
    M.F.: C8H6Cl2O2
    M.W.: 205.04
  • QR1922104
    Rosuvastatin Impurity 104
    CAS# NA
    M.F.: C29H42FN3O7S
    M.W.: 595.72
  • QP092302
    Pivmecillinam hydrochloride EP Impurity B
    CAS# NA
    M.F.: C21H35N3O6S
    M.W.: 457.58
  • QP092301
    Pivmecillinam hydrochloride EP Impurity A
    CAS# 25031-08-7
    M.F.: C14H22N2O5S
    M.W.: 330.40
  • QP092203
    Pivampicillin EP Impurity C
    CAS# NA
    M.F.: C44H58N6O12S2
    M.W.: 927.09
  • QP092002
    Piretanide EP Impurity B
    CAS# NA
    M.F.: C21H25N3O5S
    M.W.: 431.51
  • QP091903
    Pirenzepine EP Impurity C
    CAS# NA
    M.F.: C19H21N5O2
    M.W.: 351.40
  • QC182559
    Canagliflozin Impurity 59
    CAS# NA
    M.F.: C24H25FO6S
    M.W.: 460.52
  • QL130621
    Lamivudine Impurity 21
    CAS# 147027-10-9
    M.F.: C18H27N3O4S
    M.W.: 381.49
  • QP161510
    Piperazine hydrate
    CAS# 142-63-2
    M.F.: C4H22N2O6
    M.W.: 194.23
  • QP131605
    Pimozide EP Impurity E
    CAS# NA
    M.F.: C28H29F2N3O2
    M.W.: 477.55
  • QP131603
    Pimozide EP Impurity C
    CAS# NA
    M.F.: C28H29F2N3O
    M.W.: 461.55
  • QP131602
    Pimozide EP Impurity B
    CAS# NA
    M.F.: C28H30FN3O
    M.W.: 443.56
  • QA162971
    Apremilast Impurity 71
    CAS# NA
    M.F.: C21H24N2O8S
    M.W.: 464.49
  • QP131501
    Pimobendan EP Impurity A
    CAS# NA
    M.F.: C19H18N2O4
    M.W.: 338.36
  • QC012501
    Neochlorogenic acid
    CAS# 906-33-2
    M.F.: C16H18O9
    M.W.: 354.31
  • QL051509
    Calcium Levofolinate Impurity 9
    CAS# 2800-34-2
    M.F.: C20H23N7O7
    M.W.: 473.44
  • QR152418
    Roxadustat Nitroso Impurity 1
    CAS# 20689-96-7
    M.F.: C9H12N2O
    M.W.: 164.20
  • QA180243
    Arbidol Impurity 43
    CAS# 153633-07-9
    M.F.: C16H21BrN2O3
    M.W.: 369.25
  • QS010256
    Salbutamol Impurity 30
    CAS# NA
    M.F.: C13H22BNO3
    M.W.: 251.13
  • QD241346
    Dexamethasone sodium phosphate EP Impurity C
    CAS# NA
    M.F.: C22H30FO8P
    M.W.: 472.44
  • QI222037
    Itraconazole Impurity 37
    CAS# NA
    M.F.: C34H35Cl3N8O4
    M.W.: 726.05
  • QB151435
    Bromfenac Impurity 9
    CAS# 845276-75-7
    M.F.: C13H10BrNO
    M.W.: 276.13
  • QC061618
    Cefpodoxime Proxetil Impurity 18
    CAS# NA
    M.F.: C25H33N5O11S2
    M.W.: 643.69
  • QT201620
    Tiotropium bromide Impurity 20
    CAS# 1508-46-9
    M.F.: C9H16BrNO2
    M.W.: 250.13
  • QP091704
    Picotamide monohydrate EP Impurity D
    CAS# NA
    M.F.: C6H8N2
    M.W.: 108.14
  • QP091703
    Picotamide monohydrate EP Impurity C
    CAS# NA
    M.F.: C15H14N2O4
    M.W.: 286.28
  • QP091702
    Picotamide monohydrate EP Impurity B
    CAS# NA
    M.F.: C15H14N2O4
    M.W.: 286.28
  • QP091700
    Picotamide monohydrate
    CAS# NA
    M.F.: C21H22N4O4
    M.W.: 394.42
  • QP082600
    Physostigmine salicylate
    CAS# 57-64-7
    M.F.: C22H27N3O5
    M.W.: 413.47
  • QP081605
    Pholcodine EP Impurity E
    CAS# NA
    M.F.: C23H30N2O5
    M.W.: 414.49
  • QP081604
    Pholcodine EP Impurity D
    CAS# NA
    M.F.: C29H41N3O5
    M.W.: 511.65
  • QP050809
    Pethidine EP Impurity I
    CAS# NA
    M.F.: C15H19NO2
    M.W.: 245.32
  • QP050801
    Pethidine EP Impurity A
    CAS# 774-52-7
    M.F.: C12H17N
    M.W.: 175.27
  • QP181701
    Perphenazine EP Impurity A
    CAS# 10078-25-8
    M.F.: C21H26ClN3O2S
    M.W.: 419.97
  • QP050702
    Pergolide mesilate EP Impurity B
    CAS# NA
    M.F.: C19H26N2O2S
    M.W.: 346.49
  • QR457038
    Rocuronium bromide Impurity 38
    CAS# NA
    M.F.: C32H53BrN2O5
    M.W.: 625.68
  • QR457037
    Rocuronium bromide Impurity 37
    CAS# 159325-45-8
    M.F.: C23H35NO2
    M.W.: 357.53
  • QR457036
    Rocuronium bromide Impurity 36
    CAS# NA
    M.F.: C23H36BrNO3
    M.W.: 454.44
  • QR457035
    Rocuronium bromide Impurity 35
    CAS# NA
    M.F.: C23H37NO3
    M.W.: 375.54
  • QR457034
    Rocuronium bromide Impurity 34
    CAS# NA
    M.F.: C19H28O2
    M.W.: 288.42
  • QR457033
    Rocuronium bromide Impurity 33
    CAS# 50588-22-2
    M.F.: C21H30O4
    M.W.: 346.46
  • QP051601
    Penbutolol sulfate EP Impurity A
    CAS# NA
    M.F.: C18H27NO2
    M.W.: 289.41
  • QR457032
    Rocuronium bromide Impurity 32
    CAS# 10429-07-9
    M.F.: C26H36O4S
    M.W.: 444.63
  • QT140206
    Trandolapril EP Impurity F
    CAS# NA
    M.F.: C24H34N2O5
    M.W.: 430.54
  • QT140205
    Trandolapril EP Impurity E
    CAS# 87679-71-8
    M.F.: C22H30N2O5
    M.W.: 402.48
  • QT140204
    Trandolapril EP Impurity D
    CAS# 149881-40-3
    M.F.: C24H32N2O4
    M.W.: 412.52
  • QT140203
    Trandolapril EP Impurity C
    CAS# NA
    M.F.: C24H40N2O5
    M.W.: 436.58
  • QT140202
    Trandolapril EP Impurity B
    CAS# NA
    M.F.: C25H36N2O5
    M.W.: 444.56
  • QT140201
    Trandolapril EP Impurity A
    CAS# 118194-41-5
    M.F.: C23H32N2O5
    M.W.: 416.51
  • QT010901
    Trapidil EP Impurity A
    CAS# 2503-56-2
    M.F.: C6H6N4O
    M.W.: 150.14
  • QT040900
    Trehalose dihydrate
    CAS# 6138-23-4;99-20-7(free base)
    M.F.: C12H22O11,2H2O
    M.W.: 342.30 36.03
  • QT041265
    Tadalafil Impurity 65
    CAS# 1356345-67-9
    M.F.: C23H23N3O4
    M.W.: 405.45
  • QL091657
    Lipoic Acid Impurity 31
    CAS# NA
    M.F.: C8H14O3S2
    M.W.: 222.32
  • QL091656
    Lipoic Acid Impurity 30
    CAS# NA
    M.F.: C8H14O3S2
    M.W.: 222.32
  • QO240204
    Oxybutynin hydrochloride EP Impurity D
    CAS# 4335-77-7
    M.F.: C14H18O3
    M.W.: 234.29
  • QO240202
    Oxybutynin hydrochloride EP Impurity B
    CAS# 14943-53-4
    M.F.: C22H25NO3
    M.W.: 351.44
  • QT022103
    Tributyl Acetylcitrate EP Impurity C
    CAS# NA
    M.F.: C20H34O8
    M.W.: 402.48
  • QT022102
    Tributyl Acetylcitrate EP Impurity B
    CAS# 7568-58-3
    M.F.: C18H30O6
    M.W.: 342.43
  • QT022101
    Tributyl Acetylcitrate EP Impurity A
    CAS# 77-94-1
    M.F.: C18H32O7
    M.W.: 360.44
  • QT022100
    Tributyl Acetylcitrate
    CAS# 77-90-7
    M.F.: C20H34O8
    M.W.: 402.48
  • QO240200
    Oxybutynin hydrochloride
    CAS# 1508-65-2
    M.F.: C22H32ClNO3
    M.W.: 393.95
  • QO241703
    Oxolinic acid EP Impurity C
    CAS# 14205-66-4
    M.F.: C12H9NO5
    M.W.: 247.20
  • QO241702
    Oxolinic acid EP Impurity B
    CAS# NA
    M.F.: C15H15NO5
    M.W.: 289.28
  • QO241701
    Oxolinic acid EP Impurity A
    CAS# NA
    M.F.: C11H7NO5
    M.W.: 233.18
  • QO241003
    Oxitropium bromide EP Impurity C
    CAS# NA
    M.F.: C19H26NO4
    M.W.: 332.41
  • QO240504
    Oxeladin hydrogen citrate EP Impurity D
    CAS# 18109-81-4(citrate salt)
    M.F.: C18H29NO3
    M.W.: 307.43
  • QO240502
    Oxeladin hydrogen citrate EP Impurity B
    CAS# NA
    M.F.: C12H16O2
    M.W.: 192.25
  • QO242605
    Oxazepam EP Impurity E;
    Chlordiazepoxide EP Impurity A

    CAS# 963-39-3
    M.F.: C15H11ClN2O2
    M.W.: 286.71
  • QO242603
    Oxazepam EP Impurity C
    CAS# 5958-05-4
    M.F.: C15H9ClN2O
    M.W.: 268.70
  • QO181606
    Orphenadrine citrate EP Impurity F
    CAS# 19804-27-4
    M.F.: C18H23NO
    M.W.: 269.38
  • QO181605
    Orphenadrine citrate EP Impurity E
    CAS# 21945-86-8
    M.F.: C18H23NO
    M.W.: 269.38
  • QO181604
    Orphenadrine citrate EP Impurity D
    CAS# NA
    M.F.: C17H21NO
    M.W.: 255.35
  • QA130308
    Aminocaproic acid Impurity H
    CAS# 4775-98-8
    M.F.: C6H11NO
    M.W.: 113.16
  • QO181603
    Orphenadrine citrate EP Impurity C
    CAS# 17349-96-1;17752-32-8(HCl salt)
    M.F.: C16H19NO
    M.W.: 241.33
  • QA130307
    Aminocaproic acid Impurity G
    CAS# 22993-71-1
    M.F.: C12H20N2O
    M.W.: 208.30
  • QO181602
    Orphenadrine citrate EP Impurity B
    CAS# NA
    M.F.: C14H12O
    M.W.: 196.24
  • QA130306
    Aminocaproic acid Impurity F
    CAS# NA
    M.F.: C12H25NO7
    M.W.: 295.33
  • QO181601
    Orphenadrine citrate EP Impurity A
    CAS# NA
    M.F.: C14H14O
    M.W.: 198.26
  • QA130305
    Aminocaproic acid Impurity E
    CAS# NA
    M.F.: C12H19NO8 HCl
    M.W.: 305.28 36.46
  • QA130304
    Aminocaproic acid Impurity D
    CAS# 1675217-42-1
    M.F.: C12H19NO8
    M.W.: 305.28
  • QA130303
    Aminocaproic acid Impurity C
    CAS# 5776-78-3
    M.F.: C18H35N3O4
    M.W.: 357.49
  • QP160619
    Propofol Impurity 19
    CAS# 859034-02-9
    M.F.: C10H12O3
    M.W.: 180.20
  • QO180302
    Orciprenaline sulfate EP Impurity B
    CAS# NA
    M.F.: C11H15NO3
    M.W.: 209.24
  • QO180301
    Orciprenaline sulfate EP Impurity A
    CAS# NA
    M.F.: C12H17NO3
    M.W.: 223.27
  • QO180300
    Orciprenaline sulfate
    CAS# 5874-97-5
    M.F.: C11H17NO3.1/2H2SO4
    M.W.: 211.26 49.04
  • QO180207
    Orbifloxacin EP Impurity G
    CAS# NA
    M.F.: C18H20F3N3O
    M.W.: 351.37
  • QO180206
    Orbifloxacin EP Impurity F
    CAS# NA
    M.F.: C13H7F4NO3
    M.W.: 301.19
  • QO180204
    Orbifloxacin EP Impurity D
    CAS# NA
    M.F.: C19H21F2N3O4
    M.W.: 393.38
  • QO180201
    Orbifloxacin EP Impurity A
    CAS# NA
    M.F.: C25H33F2N5O3
    M.W.: 489.56
  • QN182007
    Nortriptyline hydrochloride EP Impurity G
    CAS# 16234-88-1
    M.F.: C22H25NO2
    M.W.: 335.44
  • QT180209
    Tri-n-butyl Phosphate EP Impurity I
    CAS# NA
    M.F.: C20H45O5P
    M.W.: 396.54
  • QT180208
    Tri-n-butyl Phosphate EP Impurity H
    CAS# NA
    M.F.: C13H29O4P
    M.W.: 280.34
  • QT180207
    Tri-n-butyl Phosphate EP Impurity G
    CAS# NA
    M.F.: C12H27O4P
    M.W.: 266.31
  • QT180206
    Tri-n-butyl Phosphate EP Impurity F
    CAS# NA
    M.F.: C11H25O4P
    M.W.: 252.29
  • QT180205
    Tri-n-butyl Phosphate EP Impurity E
    CAS# NA
    M.F.: C10H23O4P
    M.W.: 238.26
  • QT180204
    Tri-n-butyl Phosphate EP Impurity D
    CAS# 7242-59-3
    M.F.: C9H21O4P
    M.W.: 224.23
  • QT180202
    Tri-n-butyl Phosphate EP Impurity B
    CAS# 85391-11-3
    M.F.: C4H11O4P
    M.W.: 154.10
  • QT180201
    Tri-n-butyl Phosphate EP Impurity A
    CAS# NA
    M.F.: C8H19O4P
    M.W.: 210.21
  • QT180200
    Tri-n-butyl Phosphate
    CAS# 126-73-8
    M.F.: C12H27O4P
    M.W.: 266.31
  • QS040659
    Sildenafil Impurity 59
    CAS# NA
    M.F.: C24H26N4O5
    M.W.: 450.49
  • QA190400
    Ascaridole
    CAS# 512-85-6
    M.F.: C10H16O2
    M.W.: 168.23
  • QE200239
    Eltrombopag Impurity 13
    CAS# 18048-64-1
    M.F.: C12H14N2O
    M.W.: 202.25
  • QA1624132
    Apixaban Impurity 132
    CAS# NA
    M.F.: C10H16Cl2O3
    M.W.: 255.14
  • QR1922100
    Rosuvastatin Impurity 100
    CAS# 1007871-86-4(Na salt)
    M.F.: C22H28FN3O6S
    M.W.: 481.54
  • QP132070
    Pemetrexed Impurity 44
    CAS# NA
    M.F.: C17H23N5O3
    M.W.: 345.40
  • QM201814
    Metaraminol Impurity 14
    CAS# 7619-17-2
    M.F.: C9H13NO2
    M.W.: 167.21
  • QG121802
    18α-Glycyrrhizic Acid Ammonium Salt
    CAS# 80287-34-9;83896-44-0(free base)
    M.F.: C42H62O16 NH3
    M.W.: 822.93 17.03
  • QL142664
    Linezolid Impurity 64
    CAS# NA
    M.F.: C22H25FN4O4
    M.W.: 428.46
  • QL142662
    Linezolid Impurity 62
    CAS# NA
    M.F.: C22H25FN4O4
    M.W.: 428.46
  • QT182104
    Triflusal EP Impurity D
    CAS# NA
    M.F.: C18H10F6O6
    M.W.: 436.26
  • QT182103
    Triflusal EP Impurity C
    CAS# NA
    M.F.: C12H9F3O5
    M.W.: 290.19
  • QT182102
    Triflusal EP Impurity B
    CAS# 328-90-5
    M.F.: C8H5F3O3
    M.W.: 206.12
  • QT182101
    Triflusal EP Impurity A
    CAS# NA
    M.F.: C10H8O6
    M.W.: 224.17
  • QN032012
    Nicotinic acid Impurity 12
    CAS# 536-78-7
    M.F.: C7H9N
    M.W.: 107.15
  • QC042012
    Cefditoren pivoxil Impurity 12
    CAS# NA
    M.F.: C27H32N6O8S3
    M.W.: 664.77
  • QC042009
    Cefditoren pivoxil Impurity 9
    CAS# NA
    M.F.: C19H17N6NaO5S3
    M.W.: 528.56
  • QC042008
    Cefditoren pivoxil Impurity 8
    CAS# NA
    M.F.: C19H17N6NaO5S3
    M.W.: 528.56
  • QC042007
    Cefditoren pivoxil Impurity 7
    CAS# NA
    M.F.: C13H13N3O3S2
    M.W.: 323.39
  • QC042006
    Cefditoren pivoxil Impurity 6
    CAS# NA
    M.F.: C13H13N3O3S2
    M.W.: 323.39
  • QA201615
    Atropine Impurity 15
    CAS# 102312-28-7
    M.F.: C9H18N2
    M.W.: 154.25
  • QR161416
    Ropinirole Impurity 16
    CAS# 1027600-42-5
    M.F.: C17H26N2O2
    M.W.: 290.40
  • QV041412
    Vardenafil Impurity 12
    CAS# 1009013-42-6
    M.F.: C19H25N5O4S
    M.W.: 419.50
  • QT142411
    Tranexamic Acid Impurity 11
    CAS# 4331-54-8
    M.F.: C8H14O2
    M.W.: 142.20
  • QS180102
    Strontium ranelate Impurity 2
    CAS# NA
    M.F.: C10H10N2O4S
    M.W.: 254.26
  • QS180101
    Strontium ranelate Impurity 1
    CAS# NA
    M.F.: C11H10N2O6S
    M.W.: 298.27
  • QD032048
    Docetaxel Impurity 48
    CAS# 172018-16-5
    M.F.: C29H36O10
    M.W.: 544.59
  • QV192085
    Valsartan Impurity 85
    CAS# NA
    M.F.: C18H21NO2
    M.W.: 283.36
  • QS200767
    Sitagliptin Impurity 67
    CAS# 60470-15-7
    M.F.: C12H16O3
    M.W.: 208.25
  • QV140200
    Vinblastine Sulfate
    CAS# 143-67-9
    M.F.: C46H60N4O13S
    M.W.: 909.05
  • QA201611
    Atropine Impurity 11
    CAS# NA
    M.F.: C8H15NO2
    M.W.: 157.21
  • QT192053
    Telmisartan Impurity 27
    CAS# 39627-24-2
    M.F.: C14H13NO
    M.W.: 211.26
  • QT0307165
    Ticagrelor Impurity 165
    CAS# NA
    M.F.: C9H9F2N
    M.W.: 169.17
  • QP1824105
    Parecoxib Sodium Impurity 79
    CAS# 2304623-36-5
    M.F.: C19H18N2O4S
    M.W.: 370.42
  • QL091655
    Lipoic Acid Impurity 29
    CAS# 1700-12-5
    M.F.: C10H18O6
    M.W.: 234.25
  • QL091654
    Lipoic Acid Impurity 28
    CAS# 91009-30-2
    M.F.: C10H20O2S2
    M.W.: 236.39
  • QL091653
    Lipoic Acid Impurity 27
    CAS# 90435-60-2
    M.F.: C8H15ClO3
    M.W.: 194.66
  • QL091652
    Lipoic Acid Impurity 26
    CAS# 74903-53-0
    M.F.: C8H16O4
    M.W.: 176.21
  • QL091651
    (S)-Lipoic acid
    CAS# 1077-27-6
    M.F.: C8H14O2S2
    M.W.: 206.33
  • QL091650
    Lipoic Acid Impurity 24
    CAS# 50628-92-7
    M.F.: C10H16O3
    M.W.: 184.23
  • QT090308
    Thioctic Acid Impurity 8
    CAS# 1070-65-1
    M.F.: C10H19ClO3
    M.W.: 222.71
  • QT090307
    Thioctic Acid Impurity 7
    CAS# 50628-91-6
    M.F.: C10H17ClO3
    M.W.: 220.69
  • QL151407
    Lornoxicam Impurity 7
    CAS# 70415-50-8
    M.F.: C9H8ClNO5S2
    M.W.: 309.75
  • QA121900
    Allisartan Isoproxil
    CAS# 947331-05-7
    M.F.: C27H29ClN6O5
    M.W.: 553.01
  • QA121905
    Allisartan Isoproxil Impurity 5
    CAS# NA
    M.F.: C28H27ClN6O8
    M.W.: 611.00
  • QA121904
    Allisartan Isoproxil Impurity 4
    CAS# NA
    M.F.: C23H21ClN6O5
    M.W.: 496.90
  • QA121903
    Allisartan Isoproxil Impurity 3
    CAS# NA
    M.F.: C25H25ClN6O5
    M.W.: 524.96
  • QA152408
    Amphotericin B-13C6
    CAS# 1397-89-3 (non-labelled)
    M.F.: C4113C6H73NO17
    M.W.: 930.03
  • QA152407
    Amphotericin B-13C6 Methyl Ester
    CAS# 36148-89-7 (non-labelled)
    M.F.: C4213C6H75NO17
    M.W.: 944.06
  • QA152406
    Amphotericin B Methyl Ester
    CAS# 36148-89-7
    M.F.: C48H75NO17
    M.W.: 938.11
  • QA152405
    Amphotericin B Impurity E
    CAS# NA
    M.F.: C48H73NO18
    M.W.: 952.09
  • QA152403
    Amphotericin B EP Impurity C;
    Amphotericin X2 (13-O-Ethyl Amphotericin B)

    CAS# NA
    M.F.: C49H77NO17
    M.W.: 952.13
  • QA152402
    Amphotericin B EP Impurity B;
    Amphotericin X1 (13-O-Methyl Amphotericin B)

    CAS# 136135-57-4
    M.F.: C48H75NO17
    M.W.: 938.11
  • QA152401
    Amphotericin B EP Impurity A;Amphotericin A
    CAS# 1405-32-9
    M.F.: C47H75NO17
    M.W.: 926.09
  • QC160324
    Capecitabine Impurity 24
    CAS# NA
    M.F.: C13H15FN2O7
    M.W.: 330.27
  • QS010601
    Safflor Yellow A
    CAS# 85532-77-0
    M.F.: C27H30O15
    M.W.: 594.52
  • QA030318
    Acetylcysteine Impurity 18
    CAS# 20960-91-2
    M.F.: C5H9NO6S
    M.W.: 211.19
  • QT022009
    Terbutaline Impurity 9
    CAS# NA
    M.F.: C12H17NO4
    M.W.: 239.27
  • QC051503
    Cefonicid Sodium Impurity 3
    CAS# NA
    M.F.: C2H4N4O3S2
    M.W.: 196.21
  • QC182700
    Sodium Cromoglicate
    CAS# 15826-37-6;16110-51-3(free base)
    M.F.: C23H14Na2O11
    M.W.: 512.33
  • QP080300
    Phytolaccagenic acid
    CAS# 54928-05-1
    M.F.: C31H48O6
    M.W.: 516.71
  • QN151945
    Norflurane EP Impurity SS
    CAS# 75-10-5
    M.F.: CH2F2
    M.W.: 52.02
  • QN151943
    Norflurane EP Impurity QQ
    CAS# 75-46-7
    M.F.: CHF3
    M.W.: 70.01
  • QN151942
    Norflurane EP Impurity PP
    CAS# 353-36-6
    M.F.: C2H5F
    M.W.: 48.06
  • QN151939
    Norflurane EP Impurity MM
    CAS# 354-33-6
    M.F.: C2HF5
    M.W.: 120.02
  • QN151938
    Norflurane EP Impurity LL
    CAS# 1645-83-6
    M.F.: C3H2F4
    M.W.: 114.04
  • QN151936
    Norflurane EP Impurity JJ
    CAS# 75-38-7
    M.F.: C2H2F2
    M.W.: 64.03
  • QN151935
    Norflurane EP Impurity II
    CAS# 359-11-5
    M.F.: C2HF3
    M.W.: 82.02
  • QN151933
    Norflurane EP Impurity GG
    CAS# 75-45-6
    M.F.: CHClF2
    M.W.: 86.47
  • QN151930
    Norflurane EP Impurity DD
    CAS# 354-25-6
    M.F.: C2HClF4
    M.W.: 136.48
  • QN151929
    Norflurane EP Impurity CC
    CAS# 354-23-4
    M.F.: C2HCl2F3
    M.W.: 152.93
  • QN151927
    Norflurane EP Impurity AA
    CAS# 2268-32-8
    M.F.: C2H2ClF
    M.W.: 80.49
  • QN151926
    Norflurane EP Impurity Z
    CAS# 2268-31-7
    M.F.: C2H2ClF
    M.W.: 80.49
  • QN151925
    Norflurane EP Impurity Y
    CAS# 359-04-6
    M.F.: C2HClF2
    M.W.: 98.48
  • QN151924
    Norflurane EP Impurity X
    CAS# NA
    M.F.: C2HCl2F
    M.W.: 114.93
  • QN151920
    Norflurane EP Impurity T
    CAS# 1516-64-9
    M.F.: C4F8
    M.W.: 200.03
  • QN151919
    Norflurane EP Impurity S
    CAS# 1516-65-0
    M.F.: C4F8
    M.W.: 200.03
  • QN151918
    Norflurane EP Impurity R
    CAS# 354-55-2
    M.F.: C2BrF5
    M.W.: 198.92
  • QN151917
    Norflurane EP Impurity Q
    CAS# 76-18-6
    M.F.: C3ClF7
    M.W.: 204.47
  • QN151916
    Norflurane EP Impurity P
    CAS# 75-72-9
    M.F.: CClF3
    M.W.: 104.46
  • QN151915
    Norflurane EP Impurity O
    CAS# 353-59-3
    M.F.: CBrClF2
    M.W.: 165.36
  • QN151914
    Norflurane EP Impurity N
    CAS# 76-15-3
    M.F.: C2ClF5
    M.W.: 154.47
  • QN151913
    Norflurane EP Impurity M
    CAS# 374-07-2
    M.F.: C2Cl2F4
    M.W.: 170.92
  • QN151909
    Norflurane EP Impurity I
    CAS# 677-21-4
    M.F.: C3H3F3
    M.W.: 96.05
  • QS091303
    Simethicone Impurity 3
    CAS# 556-67-2
    M.F.: C8H24O4Si4
    M.W.: 296.62
  • QN151907
    Norflurane EP Impurity G
    CAS# 359-10-4
    M.F.: C2HClF2
    M.W.: 98.48
  • QN151906
    Norflurane EP Impurity F
    CAS# 79-35-6
    M.F.: C2Cl2F2
    M.W.: 132.92
  • QN151905
    Norflurane EP Impurity E
    CAS# 75-37-6
    M.F.: C2H4F2
    M.W.: 66.05
  • QN151904
    Norflurane EP Impurity D
    CAS# 420-46-2
    M.F.: C2H3F3
    M.W.: 84.04
  • QN151903
    Norflurane EP Impurity C
    CAS# 359-35-3
    M.F.: C2H2F4
    M.W.: 102.03
  • QN151902
    Norflurane EP Impurity B
    CAS# 2837-89-0
    M.F.: C2HClF4
    M.W.: 136.48
  • QN151900
    Controlled Substance
    (Norflurane)

    CAS# 811-97-2
    M.F.: C2H2F4
    M.W.: 102.03
  • QN151301
    Nomegestrol acetate EP Impurity A
    CAS# NA
    M.F.: C23H32O4
    M.W.: 372.50
  • QN151300
    Nomegestrol acetate
    CAS# 58652-20-3
    M.F.: C23H30O4
    M.W.: 370.48
  • QN092204
    Nitrazepam EP Impurity D
    CAS# NA
    M.F.: C23H15N3O6
    M.W.: 429.38
  • QN092203
    Nitrazepam EP Impurity C
    CAS# NA
    M.F.: C15H11BrN2O4
    M.W.: 363.16
  • QN092202
    Nitrazepam EP Impurity B
    CAS# 1775-95-7
    M.F.: C13H10N2O3
    M.W.: 242.23
  • QN092201
    Nitrazepam EP Impurity A
    CAS# 36020-93-6
    M.F.: C15H11N3O3
    M.W.: 281.27
  • QN091400
    Nimodipine
    CAS# 66085-59-4
    M.F.: C21H26N2O7
    M.W.: 418.44
  • QN091304
    Nilutamide EP Impurity D
    CAS# NA
    M.F.: C15H8F6N4O5
    M.W.: 438.24
  • QN091301
    Nilutamide EP Impurity A
    CAS# NA
    M.F.: C12H11F3N4O3
    M.W.: 316.24
  • QN091300
    Nilutamide
    CAS# 63612-50-0
    M.F.: C12H10F3N3O4
    M.W.: 317.22
  • QN092104
    Nifuroxazide EP Impurity D
    CAS# NA
    M.F.: C10H6N4O6
    M.W.: 278.18
  • QI091627
    Ipratropium Bromide Impurity 27
    CAS# 3423-25-4
    M.F.: C10H19NO
    M.W.: 169.26
  • QN092101
    Nifuroxazide EP Impurity A
    CAS# NA
    M.F.: C7H8N2O2
    M.W.: 152.15
  • QN051607
    Neohesperidin-dihydrochalcone EP Impurity G
    CAS# NA
    M.F.: C16H16O6
    M.W.: 304.29
  • QN090706
    Niflumic acid EP Impurity F
    CAS# NA
    M.F.: C14H11F3N2O2
    M.W.: 296.24
  • QN090705
    Niflumic acid EP Impurity E
    CAS# NA
    M.F.: C13H9F3N2O2
    M.W.: 282.22
  • QN090702
    Niflumic acid EP Impurity B
    CAS# NA
    M.F.: C13H9F3N2O2
    M.W.: 282.22
  • QN090700
    Niflumic acid
    CAS# 4394-00-7
    M.F.: C13H9F3N2O2
    M.W.: 282.22
  • QN051606
    Neohesperidin-dihydrochalcone EP Impurity F
    CAS# NA
    M.F.: C22H26O11
    M.W.: 466.44
  • QN051605
    Neohesperidin-dihydrochalcone EP Impurity E
    CAS# NA
    M.F.: C28H36O15
    M.W.: 612.58
  • QN011512
    Nandrolone decanoate EP Impurity L
    CAS# NA
    M.F.: C27H42O3
    M.W.: 414.62
  • QN011511
    Nandrolone decanoate EP Impurity K
    CAS# NA
    M.F.: C26H40O3
    M.W.: 400.59
  • QN011510
    Nandrolone decanoate EP Impurity J
    CAS# NA
    M.F.: C38H64O4
    M.W.: 584.91
  • QN011509
    Nandrolone decanoate EP Impurity I
    CAS# NA
    M.F.: C30H48O3
    M.W.: 456.70
  • QN011508
    Nandrolone decanoate EP Impurity H
    CAS# NA
    M.F.: C29H46O3
    M.W.: 442.67
  • QN011507
    Nandrolone decanoate EP Impurity G
    CAS# NA
    M.F.: C28H42O3
    M.W.: 426.63
  • QN011506
    Nandrolone decanoate EP Impurity F
    CAS# NA
    M.F.: C28H42O4
    M.W.: 442.63
  • QN011505
    Nandrolone decanoate EP Impurity E
    CAS# NA
    M.F.: C28H44O4
    M.W.: 444.65
  • QN011504
    Nandrolone decanoate EP Impurity D
    CAS# 434-22-0
    M.F.: C18H26O2
    M.W.: 274.40
  • QN011503
    Nandrolone decanoate EP Impurity C
    CAS# NA
    M.F.: C30H52O4
    M.W.: 476.73
  • QN011502
    Nandrolone decanoate EP Impurity B
    CAS# NA
    M.F.: C29H44O3
    M.W.: 440.66
  • QN011501
    Nandrolone decanoate EP Impurity A
    CAS# NA
    M.F.: C28H46O3
    M.W.: 430.66
  • QB201454
    Bortezomib Impurity 54
    CAS# 514820-48-5
    M.F.: C21H44BNO2Si2
    M.W.: 409.56
  • QO192055
    Oseltamivir EP Impurity E
    CAS# 208720-71-2;208720-78-9(HCl salt)
    M.F.: C15H26N2O4
    M.W.: 298.38
  • QN011500
    Nandrolone decanoate
    CAS# 360-70-3
    M.F.: C28H44O3
    M.W.: 428.65
  • QP1824103
    Parecoxib Sodium Impurity 77
    CAS# NA
    M.F.: C16H13NO7S2
    M.W.: 395.41
  • QP1824102
    Parecoxib Sodium Impurity 76
    CAS# NA
    M.F.: C16H13ClN2O3S
    M.W.: 348.80
  • QA1624126
    Apixaban Impurity 126
    CAS# 942142-51-0
    M.F.: C26H41ClN4O5
    M.W.: 525.08
  • QN011403
    Nalidixic acid EP Impurity C
    CAS# 87-13-8
    M.F.: C10H16O5
    M.W.: 216.23
  • QN011402
    Nalidixic acid EP Impurity B
    CAS# NA
    M.F.: C12H12N2O3
    M.W.: 232.24
  • QN011401
    Nalidixic acid EP Impurity A
    CAS# NA
    M.F.: C6H8N2
    M.W.: 108.14
  • QN011400
    Nalidixic acid
    CAS# 389-08-2
    M.F.: C12H12N2O3
    M.W.: 232.24
  • QT260423
    Trazodone hydrochloride Impurity W
    CAS# 55290-67-0
    M.F.: C19H24ClN5O3
    M.W.: 405.88
  • QN012006
    Naftidrofuryl hydrogen oxalate EP Impurity F
    CAS# NA
    M.F.: C24H33NO3
    M.W.: 383.52
  • QN012005
    Naftidrofuryl hydrogen oxalate EP Impurity E
    CAS# NA
    M.F.: C24H29NO3
    M.W.: 379.49
  • QN012004
    Naftidrofuryl hydrogen oxalate EP Impurity D
    CAS# NA
    M.F.: C13H25NO3
    M.W.: 243.34
  • QN012003
    Naftidrofuryl hydrogen oxalate EP Impurity C
    CAS# NA
    M.F.: C30H33NO2
    M.W.: 439.59
  • QN012002
    Naftidrofuryl hydrogen oxalate EP Impurity B
    CAS# NA
    M.F.: C20H24O3
    M.W.: 312.40
  • QN012001
    Naftidrofuryl hydrogen oxalate EP Impurity A
    CAS# NA
    M.F.: C18H20O3
    M.W.: 284.35
  • QN012000
    Naftidrofuryl hydrogen oxalate
    CAS# 3200-06-4
    M.F.: C26H35NO7
    M.W.: 473.56
  • QN010407
    Nadolol EP Impurity G
    CAS# NA
    M.F.: C17H27NO2
    M.W.: 277.40
  • QN010406
    Nadolol EP Impurity F
    CAS# NA
    M.F.: C17H23NO2
    M.W.: 273.37
  • QN010405
    Nadolol EP Impurity E
    CAS# NA
    M.F.: C17H26INO4
    M.W.: 435.30
  • QN010404
    Nadolol EP Impurity D
    CAS# NA
    M.F.: C30H43NO8
    M.W.: 545.66
  • QN010403
    Nadolol EP Impurity C
    CAS# NA
    M.F.: C23H28O7
    M.W.: 416.46
  • QN010402
    Nadolol EP Impurity B
    CAS# NA
    M.F.: C14H20O5
    M.W.: 268.31
  • QN010401
    Nadolol EP Impurity A
    CAS# NA
    M.F.: C13H18O5
    M.W.: 254.28
  • QN010205
    Nabumetone EP Impurity E
    CAS# NA
    M.F.: C27H26O3
    M.W.: 398.49
  • QN010204
    Nabumetone EP Impurity D
    CAS# 127053-22-9
    M.F.: C15H14O2
    M.W.: 226.27
  • QN010203
    Nabumetone EP Impurity C
    CAS# 65726-24-1
    M.F.: C15H18O2
    M.W.: 230.30
  • QN010202
    Nabumetone EP Impurity B
    CAS# 343272-51-5
    M.F.: C18H18O2
    M.W.: 266.33
  • QB052804
    Benzocaine EP Impurity D
    CAS# 87-25-2
    M.F.: C9H11NO2
    M.W.: 165.19
  • QT012700
    Taurohyodeoxycholic acid
    CAS# 2958-04-5;38411-85-7(Na salt)
    M.F.: C26H45NO6S
    M.W.: 499.70
  • QH252400
    Hyodeoxycholic acid
    CAS# 83-49-8
    M.F.: C24H40O4
    M.W.: 392.57
  • QM152503
    Moxonidine EP Impurity C
    CAS# NA
    M.F.: C9H13N5O2
    M.W.: 223.23
  • QM152501
    Moxonidine EP Impurity A
    CAS# 352457-35-3
    M.F.: C8H9Cl2N5
    M.W.: 246.10
  • QM180105
    Morantel hydrogen tartrate EP Impurity E
    CAS# NA
    M.F.: C6H6OS
    M.W.: 126.18
  • QM180104
    Morantel hydrogen tartrate EP Impurity D
    CAS# NA
    M.F.: C12H18N2OS
    M.W.: 238.35
  • QM180103
    Morantel hydrogen tartrate EP Impurity C;
    Pyrantel embonate EP Impurity D

    CAS# 4271-96-9
    M.F.: C6H12N2
    M.W.: 112.17
  • QM180102
    Morantel hydrogen tartrate EP Impurity B
    CAS# NA
    M.F.: C12H16N2S
    M.W.: 220.33
  • QM180101
    Morantel hydrogen tartrate EP Impurity A
    CAS# NA
    M.F.: C12H16N2S
    M.W.: 220.33
  • QM180100
    Morantel hydrogen tartrate
    CAS# 26155-31-7
    M.F.: C16H22N2O6S
    M.W.: 370.42
  • QM091406
    Mianserin hydrochloride EP Impurity F
    CAS# NA
    M.F.: C24H24N2
    M.W.: 340.46
  • QM091404
    Mianserin hydrochloride EP Impurity D
    CAS# NA
    M.F.: C24H26N2O
    M.W.: 358.48
  • QM091402
    Mianserin hydrochloride EP Impurity B
    CAS# NA
    M.F.: C18H20N2O3S
    M.W.: 344.43
  • QM091400
    Mianserin hydrochloride
    CAS# 21535-47-7
    M.F.: C18H21ClN2
    M.W.: 300.83
  • QM052702
    Metixene hydrochloride EP Impurity B
    CAS# NA
    M.F.: C13H8OS
    M.W.: 212.27
  • QM052701
    Metixene hydrochloride EP Impurity A
    CAS# NA
    M.F.: C13H10S
    M.W.: 198.28
  • QM052700
    Metixene hydrochloride
    CAS# 7081-40-5
    M.F.: C20H26ClNOS
    M.W.: 363.94
  • QM052600
    Methylrosanilinium chloride
    CAS# 548-62-9
    M.F.: C25H30ClN3
    M.W.: 407.98
  • QM052306
    Methylphenidate hydrochloride EP Impurity F
    CAS# 7251-52-7
    M.F.: C13H12N2O
    M.W.: 212.25
  • QM052305
    Methylphenidate hydrochloride EP Impurity E
    CAS# NA
    M.F.: C15H21NO2
    M.W.: 247.33
  • QM052304
    Methylphenidate hydrochloride EP Impurity D
    CAS# NA
    M.F.: C13H18N2O
    M.W.: 218.29
  • QM052303
    Methylphenidate hydrochloride EP Impurity C
    CAS# NA
    M.F.: C13H18N2O
    M.W.: 218.29
  • QM052302
    Controlled Substance
    (Methylphenidate hydrochloride EP Impurity B)

    CAS# NA
    M.F.: C14H19NO2
    M.W.: 233.31
  • QM052301
    Methylphenidate hydrochloride EP Impurity A
    CAS# NA
    M.F.: C13H17NO2
    M.W.: 219.28
  • QM052300
    Controlled Substance
    (Methylphenidate hydrochloride)

    CAS# 298-59-9
    M.F.: C14H19NO2.HCl
    M.W.: 233.31 36.46
  • QS060281
    Sofosbuvir Impurity 81
    CAS# 2524-64-3
    M.F.: C12H10ClO3P
    M.W.: 268.63
  • QM052209
    Methylergometrine maleate EP Impurity I
    CAS# 724767-21-9
    M.F.: C20H25N3O2
    M.W.: 339.43
  • QM052208
    Methylergometrine maleate EP Impurity H
    CAS# 29477-88-1
    M.F.: C20H25N3O2
    M.W.: 339.43
  • QM052207
    Methylergometrine maleate EP Impurity G
    CAS# 361-37-5
    M.F.: C21H27N3O2
    M.W.: 353.46
  • QM052206
    Methylergometrine maleate EP Impurity F
    CAS# 479-00-5
    M.F.: C19H23N3O2
    M.W.: 325.40
  • QM052205
    Methylergometrine maleate EP Impurity E
    CAS# 2889-26-1
    M.F.: C16H17N3O
    M.W.: 267.33
  • QM052204
    Methylergometrine maleate EP Impurity D
    CAS# NA
    M.F.: C19H23N3O2
    M.W.: 325.40
  • QM052203
    Methylergometrine maleate EP Impurity C
    CAS# 478-94-4
    M.F.: C16H17N3O
    M.W.: 267.33
  • QM052202
    Methylergometrine maleate EP Impurity B
    CAS# 478-95-5
    M.F.: C16H16N2O2
    M.W.: 268.31
  • QM052201
    Methylergometrine maleate EP Impurity A
    CAS# NA
    M.F.: C16H16N2O2
    M.W.: 268.31
  • QM052200
    Methylergometrine maleate
    CAS# 57432-61-8;113-42-8(free base)
    M.F.: C24H29N3O6
    M.W.: 455.50
  • QM052104
    Methyldopa EP Impurity D
    CAS# 2799-15-7;1369423-51-7(HCl salt)
    M.F.: C10H13NO4
    M.W.: 211.21
  • QM052103
    Methyldopa EP Impurity C
    CAS# NA
    M.F.: C12H17NO4
    M.W.: 239.27
  • QM052101
    Methyldopa EP Impurity A
    CAS# 6739-31-7
    M.F.: C11H15NO4
    M.W.: 225.24
  • QM200213
    Metacresol EP Impurity M
    CAS# 697-82-5
    M.F.: C9H12O
    M.W.: 136.19
  • QM200212
    Metacresol EP Impurity L
    CAS# 95-65-8
    M.F.: C8H10O
    M.W.: 122.16
  • QM200211
    Metacresol EP Impurity K
    CAS# 123-07-9
    M.F.: C8H10O
    M.W.: 122.16
  • QM200210
    Metacresol EP Impurity J
    CAS# 108-68-9
    M.F.: C8H10O
    M.W.: 122.16
  • QM200209
    Metacresol EP Impurity I
    CAS# 526-75-0
    M.F.: C8H10O
    M.W.: 122.16
  • QM200208
    Metacresol EP Impurity H
    CAS# NA
    M.F.: C9H12O
    M.W.: 136.19
  • QM200206
    Metacresol EP Impurity F
    CAS# 105-67-9
    M.F.: C8H10O
    M.W.: 122.16
  • QM200205
    Metacresol EP Impurity E
    CAS# 90-00-6
    M.F.: C8H10O
    M.W.: 122.16
  • QM192002
    Mesterolone EP Impurity B
    CAS# NA
    M.F.: C20H34O2
    M.W.: 306.48
  • QM051905
    Mesna EP Impurity E
    CAS# 1391054-56-0
    M.F.: C5H9N5O3S2
    M.W.: 251.29
  • QM051904
    Mesna EP Impurity D
    CAS# 45127-11-5;16208-51-8(2Na salt)
    M.F.: C4H10O6S4
    M.W.: 282.38
  • QM051903
    Mesna EP Impurity C
    CAS# 69536-71-6;76274-71-0(Na salt)
    M.F.: C4H8O4S2
    M.W.: 184.23
  • QM051902
    Mesna EP Impurity B
    CAS# 1391053-66-9
    M.F.: C4H10N4O3S2
    M.W.: 226.28
  • QM051901
    Mesna EP Impurity A
    CAS# 25985-57-3
    M.F.: C3H8N2O3S2
    M.W.: 184.24
  • QM051801
    Mercaptopurine EP Impurity A;
    Hypoxanthine

    CAS# 68-94-0
    M.F.: C5H4N4O
    M.W.: 136.11
  • QM162503
    Mepyramine maleate EP Impurity C;
    Tenoxicam EP Impurity A

    CAS# 504-29-0
    M.F.: C5H6N2
    M.W.: 94.11
  • QM162501
    Mepyramine maleate EP Impurity A
    CAS# NA
    M.F.: C13H14N2O
    M.W.: 214.26
  • QM162500
    Mepyramine maleate
    CAS# 59-33-6
    M.F.: C21H27N3O5
    M.W.: 401.46
  • QM011806
    Marbofloxacin EP Impurity F
    CAS# NA
    M.F.: C17H19FN4O5
    M.W.: 378.35
  • QM011804
    Marbofloxacin EP Impurity D
    CAS# NA
    M.F.: C16H19FN4O4
    M.W.: 350.34
  • QM011803
    Marbofloxacin EP Impurity C
    CAS# NA
    M.F.: C16H18F2N4O3
    M.W.: 352.34
  • QM011802
    Marbofloxacin EP Impurity B
    CAS# 115551-41-2
    M.F.: C12H8F2N2O4
    M.W.: 282.20
  • QM011801
    Marbofloxacin EP Impurity A
    CAS# NA
    M.F.: C11H8F2N2O4
    M.W.: 270.19
  • QM011605
    Maprotiline hydrochloride EP Impurity E
    CAS# NA
    M.F.: C21H25N
    M.W.: 291.43
  • QM011604
    Maprotiline hydrochloride EP Impurity D
    CAS# NA
    M.F.: C20H21N
    M.W.: 275.39
  • QM011603
    Maprotiline hydrochloride EP Impurity C
    CAS# 92202-51-2(HCl salt)
    M.F.: C19H21N
    M.W.: 263.38
  • QM011602
    Maprotiline hydrochloride EP Impurity B
    CAS# NA
    M.F.: C39H41N
    M.W.: 523.75
  • QM011601
    Maprotiline hydrochloride EP Impurity A
    CAS# NA
    M.F.: C19H16O
    M.W.: 260.33
  • QM011600
    Maprotiline hydrochloride
    CAS# 10347-81-6
    M.F.: C20H24ClN
    M.W.: 313.86
  • QM120903
    Malathion EP Impurity C
    CAS# NA
    M.F.: C9H17O6PS2
    M.W.: 316.33
  • QM120902
    Malathion EP Impurity B
    CAS# NA
    M.F.: C10H19O7PS
    M.W.: 314.29
  • QM120901
    Malathion EP Impurity A
    CAS# NA
    M.F.: C10H19O6PS2
    M.W.: 330.36
  • QP090402
    Magnesium pidolate EP Impurity B
    CAS# 29227-92-7
    M.F.: C10H14N2O6
    M.W.: 258.23
  • QP090400
    Magnesium pidolate
    CAS# 62003-27-4
    M.F.: C10H12MgN2O6
    M.W.: 280.52
  • QL252004
    Lysine acetate EP Impurity D;Valine
    CAS# 72-18-4
    M.F.: C5H11NO2
    M.W.: 117.15
  • QL252000
    Lysine acetate
    CAS# 57282-49-2;56-87-1(free base)
    M.F.: C8H18N2O4
    M.W.: 206.24
  • QL251403
    Lynestrenol EP Impurity C
    CAS# NA
    M.F.: C20H30O
    M.W.: 286.45
  • QL251402
    Lynestrenol EP Impurity B
    CAS# NA
    M.F.: C20H28O
    M.W.: 284.44
  • QL251401
    Lynestrenol EP Impurity A
    CAS# NA
    M.F.: C20H28O
    M.W.: 284.44
  • QL251307
    Lymecycline EP Impurity G
    CAS# NA
    M.F.: C22H23ClN2O8
    M.W.: 478.88
  • QL120608
    Lufenuron EP Impurity H
    CAS# NA
    M.F.: C19H8Cl4F12N2O3
    M.W.: 682.07
  • QL120607
    Lufenuron EP Impurity G
    CAS# NA
    M.F.: C21H12Cl2F2N2O5
    M.W.: 481.23
  • QL120606
    Lufenuron EP Impurity F
    CAS# NA
    M.F.: C17H9Cl2F7N2O3
    M.W.: 493.16
  • QL120605
    Lufenuron EP Impurity E
    CAS# NA
    M.F.: C17H8Cl3F7N2O3
    M.W.: 527.60
  • QL120604
    Lufenuron EP Impurity D
    CAS# NA
    M.F.: C17H9ClF8N2O3
    M.W.: 476.71
  • QL120603
    Lufenuron EP Impurity C
    CAS# NA
    M.F.: C17H9ClF8N2O3
    M.W.: 476.71
  • QL120602
    Lufenuron EP Impurity B
    CAS# 2767988-84-9
    M.F.: C14H8Cl2F2N2O3
    M.W.: 361.13
  • QL120601
    Lufenuron EP Impurity A
    CAS# NA
    M.F.: C7H5F2NO
    M.W.: 157.12
  • QL120600
    Lufenuron
    CAS# 103055-07-8
    M.F.: C17H8Cl2F8N2O3
    M.W.: 511.15
  • QI091626
    Ipratropium Bromide Impurity 26
    CAS# NA
    M.F.: C20H30BrNO4
    M.W.: 428.36
  • QI091625
    Ipratropium Bromide Impurity 25
    CAS# NA
    M.F.: C20H30BrNO4
    M.W.: 428.36
  • QI091624
    Ipratropium Bromide Impurity 24
    CAS# NA
    M.F.: C20H30BrNO4
    M.W.: 428.36
  • QM154250
    Mirabegron Impurity 24
    CAS# NA
    M.F.: C9H10N2O5S
    M.W.: 258.25
  • QL161418
    Lopinavir EP Impurity R
    CAS# NA
    M.F.: C47H58N4O7
    M.W.: 790.99
  • QL161416
    Lopinavir EP Impurity P
    CAS# NA
    M.F.: C37H48N4O5
    M.W.: 628.80
  • QL161415
    Lopinavir EP Impurity O
    CAS# NA
    M.F.: C46H62N6O7
    M.W.: 811.02
  • QL161414
    Lopinavir EP Impurity N
    CAS# NA
    M.F.: C38H50N4O5
    M.W.: 642.83
  • QL161413
    Lopinavir EP Impurity M
    CAS# NA
    M.F.: C38H50N4O5
    M.W.: 642.83
  • QL161412
    Lopinavir EP Impurity L
    CAS# NA
    M.F.: C22H26N2O4
    M.W.: 382.45
  • QL161411
    Lopinavir EP Impurity K
    CAS# NA
    M.F.: C37H48N4O5
    M.W.: 628.80
  • QL161410
    Lopinavir EP Impurity J
    CAS# NA
    M.F.: C37H48N4O5
    M.W.: 628.80
  • QL161409
    Lopinavir EP Impurity I
    CAS# NA
    M.F.: C37H48N4O5
    M.W.: 628.80
  • QL161408
    Lopinavir EP Impurity H
    CAS# NA
    M.F.: C29H32N2O4
    M.W.: 472.58
  • QL161407
    Lopinavir EP Impurity G
    CAS# NA
    M.F.: C30H36N2O4
    M.W.: 488.62
  • QL161405
    Lopinavir EP Impurity E
    CAS# NA
    M.F.: C28H34N2O3
    M.W.: 446.58
  • QL161403
    Lopinavir EP Impurity C
    CAS# NA
    M.F.: C36H52N6O5
    M.W.: 648.84
  • QL161402
    Lopinavir EP Impurity B
    CAS# NA
    M.F.: C28H38N4O4
    M.W.: 494.63
  • QL161401
    Lopinavir EP Impurity A
    CAS# NA
    M.F.: C27H38N4O3
    M.W.: 466.62
  • QL052706
    Levomethadone hydrochloride EP Impurity F
    CAS# NA
    M.F.: C12H15NO6S
    M.W.: 301.32
  • QL052701
    Levomethadone hydrochloride EP Impurity A
    CAS# NA
    M.F.: C21H27NO
    M.W.: 309.45
  • QL052700
    Levomethadone hydrochloride
    CAS# 5967-73-7
    M.F.: C21H28ClNO
    M.W.: 345.91
  • QL052600
    Levomepromazine hydrochloride
    CAS# 1236-99-3;7104-38-3(maleate)
    M.F.: C19H25ClN2OS
    M.W.: 364.93
  • QL052503
    Levodropropizine EP Impurity C
    CAS# NA
    M.F.: C3H6O2
    M.W.: 74.08
  • QL052502
    Levodropropizine EP Impurity B
    CAS# 92-54-6;153121-53-0(HBr salt)
    M.F.: C10H14N2
    M.W.: 162.23
  • QL052501
    Levodropropizine EP Impurity A
    CAS# 99291-24-4
    M.F.: C13H20N2O2
    M.W.: 236.31
  • QL052500
    Levodropropizine
    CAS# 99291-25-5
    M.F.: C13H20N2O2
    M.W.: 236.31
  • QL052412
    Levocabastine hydrochloride EP Impurity L
    CAS# NA
    M.F.: C26H29FN2O3
    M.W.: 436.52
  • QL052411
    Levocabastine hydrochloride EP Impurity K
    CAS# NA
    M.F.: C25H24FN2
    M.W.: 371.47
  • QL052410
    Levocabastine hydrochloride EP Impurity J
    CAS# NA
    M.F.: C26H29FN2O3
    M.W.: 436.52
  • QL052409
    Levocabastine hydrochloride EP Impurity I
    CAS# NA
    M.F.: C26H29FN2O2
    M.W.: 420.52
  • QL052408
    Levocabastine hydrochloride EP Impurity H
    CAS# NA
    M.F.: C13H12FNO
    M.W.: 217.24
  • QL052407
    Levocabastine hydrochloride EP Impurity G
    CAS# NA
    M.F.: C26H31FN2O3
    M.W.: 438.53
  • QL052406
    Levocabastine hydrochloride EP Impurity F
    CAS# NA
    M.F.: C13H17NO2
    M.W.: 219.28
  • QL052405
    Levocabastine hydrochloride EP Impurity E
    CAS# NA
    M.F.: C26H29FN2O2
    M.W.: 420.52
  • QL052404
    Levocabastine hydrochloride EP Impurity D
    CAS# NA
    M.F.: C25H27FN2O2
    M.W.: 406.49
  • QL052403
    Levocabastine hydrochloride EP Impurity C
    CAS# NA
    M.F.: C26H29FN2O2
    M.W.: 420.52
  • QL052402
    Levocabastine hydrochloride EP Impurity B
    CAS# NA
    M.F.: C26H29FN2O2
    M.W.: 420.52
  • QL052401
    Levocabastine hydrochloride EP Impurity A
    CAS# NA
    M.F.: C26H30N2O2
    M.W.: 402.53
  • QL052400
    Levocabastine hydrochloride
    CAS# 79547-78-7;79516-68-0(free base)
    M.F.: C26H30ClFN2O2
    M.W.: 456.98
  • QL052305
    Levamisole EP Impurity E
    CAS# 32190-36-6
    M.F.: C22H26N4O2S2
    M.W.: 442.60
  • QL052304
    Levamisole EP Impurity D
    CAS# 4335-28-8;4335-29-9(HCl salt)
    M.F.: C11H10N2S
    M.W.: 202.28
  • QL052303
    Levamisole EP Impurity C
    CAS# 32190-33-3
    M.F.: C11H14N2OS
    M.W.: 222.31
  • QL052301
    Levamisole EP Impurity A
    CAS# 32190-34-4
    M.F.: C11H14N2OS
    M.W.: 222.31
  • QL052300
    Levamisole
    CAS# 14769-73-4;32093-35-9(phosphate);
    16595-80-5(HCl salt)
    M.F.: C11H12N2S
    M.W.: 204.29
  • QK201505
    Ketobemidone hydrochloride EP Impurity E
    CAS# NA
    M.F.: C13H16N2O
    M.W.: 216.28
  • QK201504
    Ketobemidone hydrochloride EP Impurity D
    CAS# NA
    M.F.: C16H23NO2
    M.W.: 261.36
  • QK201503
    Ketobemidone hydrochloride EP Impurity C
    CAS# NA
    M.F.: C14H19NO2
    M.W.: 233.31
  • QK201502
    Ketobemidone hydrochloride EP Impurity B
    CAS# NA
    M.F.: C14H19NO2
    M.W.: 233.31
  • QK201501
    Ketobemidone hydrochloride EP Impurity A
    CAS# NA
    M.F.: C15H21NO3
    M.W.: 263.33
  • QK201500
    Ketobemidone hydrochloride
    CAS# 5965-49-1
    M.F.: C15H22ClNO2
    M.W.: 283.79
  • QJ151911
    Josamycin EP Impurity K
    CAS# NA
    M.F.: C40H65NO15
    M.W.: 799.94
  • QJ151910
    Josamycin EP Impurity J
    CAS# NA
    M.F.: C43H71NO15
    M.W.: 842.02
  • QJ151909
    Josamycin EP Impurity I
    CAS# NA
    M.F.: C38H63NO14
    M.W.: 757.91
  • QJ151908
    Josamycin EP Impurity H
    CAS# NA
    M.F.: C40H67NO14
    M.W.: 785.96
  • QJ151907
    Josamycin EP Impurity G
    CAS# NA
    M.F.: C37H61NO14
    M.W.: 743.88
  • QJ151906
    Josamycin EP Impurity F
    CAS# NA
    M.F.: C35H59NO13
    M.W.: 701.84
  • QJ151905
    Josamycin EP Impurity E
    CAS# NA
    M.F.: C43H71NO15
    M.W.: 842.02
  • QJ151904
    Josamycin EP Impurity D
    CAS# NA
    M.F.: C42H69NO15
    M.W.: 827.99
  • QJ151902
    Josamycin EP Impurity B
    CAS# NA
    M.F.: C42H71NO15
    M.W.: 830.01
  • QJ151901
    Josamycin EP Impurity A
    CAS# NA
    M.F.: C41H67NO15
    M.W.: 813.97
  • QI191705
    Isopropyl alcohol EP Impurity E
    CAS# 67-56-1
    M.F.: CH4O
    M.W.: 32.04
  • QI191704
    Isopropyl alcohol EP Impurity D
    CAS# NA
    M.F.: C4H10O
    M.W.: 74.12
  • QA165127
    Azithromycin Impurity 27
    CAS# 67342-52-3
    M.F.: C10H13NO3S
    M.W.: 227.28
  • QI191701
    Isopropyl alcohol EP Impurity A
    CAS# NA
    M.F.: C3H6O
    M.W.: 58.08
  • QI191700
    Isopropyl alcohol
    CAS# 67-63-0
    M.F.: C3H8O
    M.W.: 60.10
  • QI152408
    Ioxaglic acid EP Impurity H
    CAS# NA
    M.F.: C35H28I9N7O13
    M.W.: 1896.78
  • QI152407
    Ioxaglic acid EP Impurity G
    CAS# NA
    M.F.: C26H23I6N5O9
    M.W.: 1310.92
  • QI152405
    Ioxaglic acid EP Impurity E
    CAS# NA
    M.F.: C36H31I9N8O12
    M.W.: 1909.82
  • QI152404
    Ioxaglic acid EP Impurity D
    CAS# NA
    M.F.: C25H23I6N5O8
    M.W.: 1282.91
  • QI152402
    Ioxaglic acid EP Impurity B
    CAS# NA
    M.F.: C24H22I5N5O8
    M.W.: 1142.98
  • QI152401
    Ioxaglic acid EP Impurity A
    CAS# NA
    M.F.: C10H9I3N2O4
    M.W.: 601.90
  • QI152400
    Ioxaglic acid
    CAS# 59017-64-0
    M.F.: C24H21I6N5O8
    M.W.: 1268.88
  • QI152110
    Iotrolan EP Impurity J
    CAS# NA
    M.F.: C49H64I6N6O18
    M.W.: 1786.49
  • QI152109
    Iotrolan EP Impurity I
    CAS# NA
    M.F.: C46H60I6N6O18
    M.W.: 1746.42
  • QI152108
    Iotrolan EP Impurity H
    CAS# NA
    M.F.: C43H56I6N6O18
    M.W.: 1706.36
  • QI152107
    Iotrolan EP Impurity G
    CAS# NA
    M.F.: C21H8Cl4I6N2O6
    M.W.: 1287.54
  • QI152106
    Iotrolan EP Impurity F
    CAS# NA
    M.F.: C21H12I6N2O10
    M.W.: 1213.75
  • QI152105
    Iotrolan EP Impurity E
    CAS# NA
    M.F.: C17H24I3N3O8
    M.W.: 779.10
  • QI152104
    Iotrolan EP Impurity D
    CAS# NA
    M.F.: C33H39I6N5O16
    M.W.: 1523.11
  • QI152103
    Iotrolan EP Impurity C
    CAS# NA
    M.F.: C20H26I3N3O11
    M.W.: 865.15
  • QI152102
    Iotrolan EP Impurity B
    CAS# NA
    M.F.: C19H26I3N3O9
    M.W.: 821.14
  • QI152101
    Iotrolan EP Impurity A
    CAS# NA
    M.F.: C40H52I6N6O18
    M.W.: 1666.30
  • QI152100
    Iotrolan
    CAS# 79770-24-4
    M.F.: C37H48I6N6O18
    M.W.: 1626.23
  • QI160100
    Iopanoic acid
    CAS# NA
    M.F.: C11H12I3NO2
    M.W.: 570.93
  • QI140505
    Indinavir sulfate EP Impurity E
    CAS# NA
    M.F.: C51H65N5O7
    M.W.: 860.09
  • QI140504
    Indinavir sulfate EP Impurity D
    CAS# NA
    M.F.: C27H36N4O3
    M.W.: 464.60
  • QI140503
    Indinavir sulfate EP Impurity C
    CAS# NA
    M.F.: C36H47N5O4
    M.W.: 613.79
  • QI140502
    Indinavir sulfate EP Impurity B
    CAS# NA
    M.F.: C30H42N4O4
    M.W.: 522.68
  • QI140501
    Indinavir sulfate EP Impurity A
    CAS# NA
    M.F.: C9H11NO
    M.W.: 149.19
  • QI140500
    Indinavir sulfate
    CAS# 157810-81-6
    M.F.: C38H55N5O9S
    M.W.: 757.94
  • QI131003
    Imipramine hydrochloride EP Impurity C
    CAS# NA
    M.F.: C18H20N2O
    M.W.: 280.36
  • QI131002
    Imipramine hydrochloride EP Impurity B
    CAS# NA
    M.F.: C19H22N2
    M.W.: 278.39
  • QI131001
    Imipramine hydrochloride EP Impurity A
    CAS# NA
    M.F.: C18H22N2
    M.W.: 266.38
  • QI131000
    Imipramine hydrochloride
    CAS# 113-52-0
    M.F.: C19H25ClN2
    M.W.: 316.87
  • QI061506
    Ifosfamide EP Impurity F
    CAS# NA
    M.F.: C5H10Cl2NO2P
    M.W.: 218.02
  • QI061505
    Ifosfamide EP Impurity E
    CAS# 42453-19-0
    M.F.: C5H11Cl2N
    M.W.: 156.05
  • QI061503
    Ifosfamide EP Impurity C;
    Carmustine EP Impurity B

    CAS# 689-98-5;870-24-6(HCl salt)
    M.F.: C2H6ClN
    M.W.: 79.53
  • QI061502
    Ifosfamide EP Impurity B
    CAS# 241482-18-8
    M.F.: C10H24Cl2N2O7P2
    M.W.: 417.16
  • QI061501
    Ifosfamide EP Impurity A
    CAS# 22608-58-8
    M.F.: C5H13ClNO4P
    M.W.: 217.59
  • QI041700
    Idoxuridine
    CAS# 54-42-2
    M.F.: C9H11IN2O5
    M.W.: 354.10
  • QH250601
    Hydroxyethyl salicylate EP Impurity A
    CAS# NA
    M.F.: C7H6O3
    M.W.: 138.12
  • QH250600
    Hydroxyethyl salicylate
    CAS# 87-28-5
    M.F.: C9H10O4
    M.W.: 182.17
  • QH250504
    Hydromorphone hydrochloride EP Impurity D
    CAS# NA
    M.F.: C17H21NO3
    M.W.: 287.35
  • QH250502
    Hydromorphone hydrochloride EP Impurity B
    CAS# NA
    M.F.: C17H19NO4
    M.W.: 301.34
  • QH250501
    Hydromorphone hydrochloride EP Impurity A
    CAS# NA
    M.F.: C34H36N2O6
    M.W.: 568.66
  • QH250500
    Hydromorphone hydrochloride
    CAS# 71-68-1
    M.F.: C17H20ClNO3
    M.W.: 321.80
  • QH151401
    Homatropine hydrobromide EP Impurity A
    CAS# NA
    M.F.: C16H19NO3
    M.W.: 273.33
  • QH151400
    Homatropine hydrobromide;
    Homatropine methylbromide EP Impurity B

    CAS# 51-56-9
    M.F.: C16H21NO3.HBr
    M.W.: 275.34 80.91
  • QH091900
    Histamine dihydrochloride
    CAS# 56-92-8
    M.F.: C5H11Cl2N3
    M.W.: 184.07
  • QH052604
    Hexylresorcinol EP Impurity D
    CAS# NA
    M.F.: C12H16O3
    M.W.: 208.25
  • QH052603
    Hexylresorcinol EP Impurity C
    CAS# NA
    M.F.: C11H16O2
    M.W.: 180.24
  • QH052504
    Hexetidine EP Impurity D
    CAS# 81-04-9
    M.F.: C10H8O6S2
    M.W.: 288.30
  • QH052503
    Hexetidine EP Impurity C
    CAS# NA
    M.F.: C22H45N3
    M.W.: 351.61
  • QH052502
    Hexetidine EP Impurity B
    CAS# NA
    M.F.: C20H45N3
    M.W.: 327.59
  • QT150201
    Deoxystreptamine-kanosaminide
    CAS# 20744-51-8
    M.F.: C12H25N3O7
    M.W.: 323.34
  • QH051601
    Heptaminol hydrochloride EP Impurity A
    CAS# NA
    M.F.: C8H17N
    M.W.: 127.23
  • QH051600
    Heptaminol hydrochloride
    CAS# 543-15-7
    M.F.: C8H20ClNO
    M.W.: 181.7
  • QH011309
    Halothane EP Impurity I
    CAS# NA
    M.F.: C2BrCl2F3
    M.W.: 231.83
  • QH011307
    Halothane EP Impurity G
    CAS# NA
    M.F.: C2BrClF2
    M.W.: 177.38
  • QH011304
    Halothane EP Impurity D
    CAS# NA
    M.F.: C4HBrF6
    M.W.: 242.95
  • QH011303
    Halothane EP Impurity C
    CAS# NA
    M.F.: C8Cl4F12
    M.W.: 465.88
  • QH011302
    Halothane EP Impurity B
    CAS# NA
    M.F.: C8H2Cl2F12
    M.W.: 396.99
  • QH121503
    Halofantrine hydrochloride EP Impurity C
    CAS# NA
    M.F.: C16H9Cl2F3O
    M.W.: 345.14
  • QH121502
    Halofantrine hydrochloride EP Impurity B
    CAS# NA
    M.F.: C26H31ClF3NO
    M.W.: 465.98
  • QH121501
    Halofantrine hydrochloride EP Impurity A
    CAS# NA
    M.F.: C26H31ClF3NO
    M.W.: 465.98
  • QH121500
    Halofantrine hydrochloride
    CAS# 36167-63-2
    M.F.: C26H31Cl3F3NO
    M.W.: 536.88
  • QG210300
    Guanethidine monosulfate
    CAS# 645-43-2
    M.F.: C10H24N4O4S
    M.W.: 296.39
  • QG210208
    Guaiacol EP Impurity H
    CAS# NA
    M.F.: C7H8O2
    M.W.: 124.14
  • QG210207
    Guaiacol EP Impurity G
    CAS# 150-76-5
    M.F.: C7H8O2
    M.W.: 124.14
  • QG210206
    Guaiacol EP Impurity F
    CAS# NA
    M.F.: C8H10O2
    M.W.: 138.16
  • QG210203
    Guaiacol EP Impurity C
    CAS# 91-16-7
    M.F.: C8H10O2
    M.W.: 138.16
  • QG210202
    Guaiacol EP Impurity B
    CAS# 108-95-2
    M.F.: C6H6O
    M.W.: 94.11
  • QG180900
    Griseofulvin
    CAS# 126-07-8
    M.F.: C17H17ClO6
    M.W.: 352.77
  • QG122200
    Glutamic acid; Lysine acetate EP Impurity B; Pemetrexed Impurity M; Asparagine EP Impurity B;Magnesium pidolate EP Impurity A;Aspartic acid EP Impurity C;Alanine EP Impurity B
    CAS# 56-86-0;142-47-2(Na salt);6106-04-3(Na salt monohydrate)
    M.F.: C5H9NO4
    M.W.: 147.13
  • QG011206
    Galantamine hydrobromide EP Impurity F
    CAS# 60384-53-4
    M.F.: C17H21NO3
    M.W.: 287.35
  • QG011205
    Galantamine hydrobromide EP Impurity E
    CAS# 41303-74-6
    M.F.: C16H19NO3
    M.W.: 273.33
  • QG011204
    Galantamine hydrobromide EP Impurity D
    CAS# 664995-65-7
    M.F.: C17H19NO2
    M.W.: 269.34
  • QG011203
    Galantamine hydrobromide EP Impurity C;
    Dihydro Galantamine

    CAS# 21133-52-8
    M.F.: C17H23NO3
    M.W.: 289.37
  • QG011201
    Galantamine hydrobromide EP Impurity A
    CAS# 510-77-0
    M.F.: C17H19NO3
    M.W.: 285.34
  • QF180107
    Framycetin sulfate EP Impurity G;Neomycin sulfate EP Impurity G;Neomycin B-LP
    CAS# 54617-40-2
    M.F.: C25H48N6O14
    M.W.: 656.68
  • QF180106
    Framycetin sulfate EP Impurity F;Neomycin sulfate EP Impurity F
    CAS# 51795-47-2
    M.F.: C23H45N5O14
    M.W.: 615.63
  • QF180105
    Framycetin sulfate EP Impurity E;
    Neomycin sulfate EP Impurity E

    CAS# 7542-37-2;1263-89-4(xH2SO4 salt)
    M.F.: C23H45N5O14
    M.W.: 615.63
  • QF180104
    Framycetin sulfate EP Impurity D;Neomycin sulfate EP Impurity D
    CAS# 534-47-4;18685-97-7(3HCl salt)
    M.F.: C12H25N3O7
    M.W.: 323.34
  • QF180103
    Framycetin sulfate EP Impurity C; Neomycin C;Neomycin sulfate EP Impurity C
    CAS# 66-86-4
    M.F.: C23H46N6O13
    M.W.: 614.64
  • QF180102
    Framycetin sulfate EP Impurity B;Neomycin sulfate EP Impurity B
    CAS# NA
    M.F.: C14H28N4O7
    M.W.: 364.39
  • QF180101
    Framycetin sulfate EP Impurity A;Neomycin sulfate EP Impurity A
    CAS# 3947-65-7
    M.F.: C12H26N4O6
    M.W.: 322.36
  • QF180100
    Framycetin sulfate
    CAS# NA
    M.F.: C23H46N6O13
    M.W.: 614.64
  • QF151904
    Foscarnet sodium hexahydrate EP Impurity D
    CAS# 1474-78-8
    M.F.: C7H15O5P
    M.W.: 210.16
  • QF151902
    Foscarnet sodium hexahydrate EP Impurity B
    CAS# 55920-24-6
    M.F.: C3H5Na2O5P
    M.W.: 198.02
  • QF151903
    Foscarnet sodium hexahydrate EP Impurity C
    CAS# 72304-94-0
    M.F.: C5H10NaO5P
    M.W.: 204.09
  • QF151901
    Foscarnet sodium hexahydrate EP Impurity A
    CAS# 72305-00-1
    M.F.: C3H5Na2O5P
    M.W.: 198.02
  • QF151900
    Foscarnet sodium hexahydrate
    CAS# 34156-56-4
    M.F.: CH12Na3O11P
    M.W.: 300.04
  • QF123303
    Fluspirilene EP Impurity C
    CAS# NA
    M.F.: C30H33F2N3O2
    M.W.: 505.60
  • QF123302
    Fluspirilene EP Impurity B
    CAS# NA
    M.F.: C29H31F2N3O
    M.W.: 475.57
  • QF123203
    Flurazepam monohydrochloride EP Impurity C
    CAS# NA
    M.F.: C17H14ClFN2O2
    M.W.: 332.76
  • QF123202
    Flurazepam monohydrochloride EP Impurity B
    CAS# NA
    M.F.: C15H10ClFN2O
    M.W.: 288.70
  • QF123201
    Flurazepam monohydrochloride EP Impurity A
    CAS# 36105-18-7;19347-55-8(HCl salt)
    M.F.: C19H22ClFN2O
    M.W.: 348.84
  • QF123200
    Flurazepam monohydrochloride
    CAS# 36105-20-1
    M.F.: C21H24Cl2FN3O
    M.W.: 424.34
  • QF211607
    Fluphenazine decanoate EP Impurity G;
    Fluphenazine enantate EP Impurity G;
    fluphenazine dodecanoate

    CAS# NA
    M.F.: C34H48F3N3O2S
    M.W.: 619.82
  • QF211606
    Fluphenazine decanoate EP Impurity F;
    Fluphenazine enantate EP Impurity F;
    Fluphenazine undecanoate

    CAS# NA
    M.F.: C33H46F3N3O2S
    M.W.: 605.80
  • QF211604
    Fluphenazine decanoate EP Impurity D;
    Fluphenazine enantate EP Impurity D;
    Fluphenazine octanoate

    CAS# NA
    M.F.: C30H40F3N3O2S
    M.W.: 563.72
  • QF211605
    Fluphenazine decanoate EP Impurity E;
    Fluphenazine enantate EP Impurity E;
    Fluphenazine nonanoate

    CAS# NA
    M.F.: C31H42F3N3O2S
    M.W.: 577.74
  • QF211603
    Fluphenazine decanoate EP Impurity C;
    Fluphenazine enantate

    CAS# 2746-81-8
    M.F.: C29H38F3N3O2S
    M.W.: 549.69
  • QF211602
    Fluphenazine decanoate EP Impurity B;
    Fluphenazine enantate EP Impurity B;
    Fluphenazine

    CAS# 69-23-8;146-56-5(2HCl salt)
    M.F.: C22H26F3N3OS
    M.W.: 437.52
  • QF211601
    Fluphenazine decanoate EP Impurity A;
    Fluphenazine dihydrochloride EP Impurity A;
    Fluphenazine enantate EP Impurity A;
    Fluphenazine S-oxide

    CAS# 1674-76-6
    M.F.: C22H26F3N3O2S
    M.W.: 453.52
  • QF211600
    Fluphenazine decanoate;
    Fluphenazine enantate EP Impurity C

    CAS# 5002-47-1
    M.F.: C32H44F3N3O2S
    M.W.: 591.77
  • QF211504
    Fluocortolone pivalate EP Impurity D
    CAS# NA
    M.F.: C27H39FO5
    M.W.: 462.59
  • QF211503
    Fluocortolone pivalate EP Impurity C
    CAS# NA
    M.F.: C27H35FO5
    M.W.: 458.56
  • QF211502
    Fluocortolone pivalate EP Impurity B
    CAS# NA
    M.F.: C27H38O7
    M.W.: 474.59
  • QF211501
    Fluocortolone pivalate EP Impurity A
    CAS# 152-97-6
    M.F.: C22H29FO4
    M.W.: 376.46
  • QF211500
    Fluocortolone pivalate
    CAS# 29205-06-9
    M.F.: C27H37FO5
    M.W.: 460.58
  • QF211404
    Flunixin meglumine EP Impurity D
    CAS# NA
    M.F.: C16H15F3N2O2
    M.W.: 324.30
  • QF211403
    Flunixin meglumine EP Impurity C
    CAS# 1452-94-4
    M.F.: C8H8ClNO2
    M.W.: 185.61
  • QF211402
    Flunixin meglumine EP Impurity B
    CAS# 54396-44-0
    M.F.: C8H8F3N
    M.W.: 175.15
  • QF211400
    Flunixin meglumine
    CAS# 42461-84-7
    M.F.: C21H28F3N3O7
    M.W.: 491.46
  • QM092207
    Mivacurium chloride Impurity 7
    CAS# NA
    M.F.: C58H80Cl2N2O14
    M.W.: 1100.17
  • QM092206
    Mivacurium chloride Impurity 6
    CAS# NA
    M.F.: C58H80Cl2N2O14
    M.W.: 1100.17
  • QM092205
    Mivacurium chloride Impurity 5
    CAS# NA
    M.F.: C58H80Cl2N2O14
    M.W.: 1100.17
  • QM092204
    Mivacurium chloride Impurity 4
    CAS# 107740-66-9
    M.F.: C25H36ClNO6
    M.W.: 482.01
  • QM092203
    Mivacurium chloride Impurity 3
    CAS# 107740-64-7
    M.F.: C25H36ClNO6
    M.W.: 482.01
  • QM092202
    Mivacurium chloride Impurity 2
    CAS# 161816-38-2
    M.F.: C33H46ClNO9
    M.W.: 636.17
  • QM092201
    Mivacurium chloride Impurity 1
    CAS# 161816-39-3
    M.F.: C33H46ClNO9
    M.W.: 636.17
  • QF122304
    Flunitrazepam EP Impurity D
    CAS# NA
    M.F.: C14H11FN2O3
    M.W.: 274.25
  • QF122303
    Flunitrazepam EP Impurity C
    CAS# NA
    M.F.: C16H12FN3O3
    M.W.: 313.28
  • QF122302
    Flunitrazepam EP Impurity B
    CAS# NA
    M.F.: C15H10FN3O3
    M.W.: 299.26
  • QF121704
    Flumetasone pivalate EP Impurity D
    CAS# NA
    M.F.: C27H36ClFO6
    M.W.: 511.02
  • QF121703
    Flumetasone pivalate EP Impurity C
    CAS# 1926-94-9
    M.F.: C27H37FO6
    M.W.: 476.58
  • QF121702
    Flumetasone pivalate EP Impurity B
    CAS# NA
    M.F.: C24H30F2O6
    M.W.: 452.49
  • QF121701
    Flumetasone pivalate EP Impurity A
    CAS# 2135-17-3
    M.F.: C22H28F2O5
    M.W.: 410.45
  • QF121700
    Flumetasone pivalate
    CAS# 2002-29-1
    M.F.: C27H36F2O6
    M.W.: 494.57
  • QF120805
    Flecainide acetate EP Impurity E
    CAS# NA
    M.F.: C17H14F6N2O3
    M.W.: 408.30
  • QF120804
    Flecainide acetate EP Impurity D
    CAS# NA
    M.F.: C11H8F6O4
    M.W.: 318.17
  • QF120803
    Flecainide acetate EP Impurity C
    CAS# NA
    M.F.: C17H20F6N2O4
    M.W.: 430.34
  • QF120802
    Flecainide acetate EP Impurity B
    CAS# NA
    M.F.: C6H14N2
    M.W.: 114.19
  • QF120801
    Flecainide acetate EP Impurity A
    CAS# NA
    M.F.: C17H18F6N2O2
    M.W.: 396.33
  • QF120800
    Flecainide acetate
    CAS# 54143-56-5
    M.F.: C19H24F6N2O5
    M.W.: 474.39
  • QF120703
    Flavoxate hydrochloride EP Impurity C
    CAS# NA
    M.F.: C20H18O4
    M.W.: 322.35
  • QF120702
    Flavoxate hydrochloride EP Impurity B
    CAS# NA
    M.F.: C19H16O4
    M.W.: 308.33
  • QF120701
    Flavoxate hydrochloride EP Impurity A
    CAS# NA
    M.F.: C17H12O4
    M.W.: 280.27
  • QF120700
    Flavoxate hydrochloride
    CAS# 3717-88-2
    M.F.: C24H26ClNO4
    M.W.: 427.92
  • QF051900
    Ferrous fumarate
    CAS# 141-01-5
    M.F.: C4H2FeO4
    M.W.: 169.9
  • QF052003
    Fenticonazole nitrate EP Impurity C
    CAS# NA
    M.F.: C24H20Cl2N2O3S
    M.W.: 487.40
  • QF052002
    Fenticonazole nitrate EP Impurity B
    CAS# 80639-94-7;80639-95-8(nitrate)
    M.F.: C24H20Cl2N2O2S
    M.W.: 471.40
  • QF052001
    Fenticonazole nitrate EP Impurity A;
    Tioconazole EP Impurity D;
    Isoconazole EP Impurity B

    CAS# NA
    M.F.: C11H10Cl2N2O
    M.W.: 257.12
  • QF052000
    Fenticonazole nitrate
    CAS# 73151-29-8;72479-26-6(free base)
    M.F.: C24H21Cl2N3O4S
    M.W.: 518.41
  • QF051603
    Fenoterol hydrobromide EP Impurity C
    CAS# NA
    M.F.: C18H23NO4
    M.W.: 317.38
  • QF051602
    Fenoterol hydrobromide EP Impurity B
    CAS# NA
    M.F.: C17H19NO4
    M.W.: 301.34
  • QF051601
    Fenoterol hydrobromide EP Impurity A
    CAS# NA
    M.F.: C17H21NO4
    M.W.: 303.35
  • QF051600
    Fenoterol hydrobromide
    CAS# 1944-12-3
    M.F.: C17H22BrNO4
    M.W.: 384.26
  • QF051504
    Fenbufen EP Impurity D
    CAS# NA
    M.F.: C16H14O4
    M.W.: 270.28
  • QF051502
    Fenbufen EP Impurity B
    CAS# NA
    M.F.: C16H12O3
    M.W.: 252.26
  • QF051201
    Felbinac EP Impurity A
    CAS# NA
    M.F.: C14H12O2
    M.W.: 196.24
  • QF051200
    Felbinac
    CAS# 5728-52-9
    M.F.: C14H12O2
    M.W.: 212.24
  • QE151617
    Etoposide EP Impurity Q
    CAS# 153975-26-9
    M.F.: C21H16O7
    M.W.: 380.35
  • QE151616
    Etoposide EP Impurity P
    CAS# 117669-31-5
    M.F.: C21H16O8
    M.W.: 396.35
  • QE151614
    Etoposide EP Impurity N
    CAS# NA
    M.F.: C50H50O20
    M.W.: 970.92
  • QE151612
    Etoposide EP Impurity L
    CAS# NA
    M.F.: C21H20O8
    M.W.: 400.38
  • QE151609
    Etoposide EP Impurity I
    CAS# 111712-42-6
    M.F.: C30H34O13
    M.W.: 602.58
  • QE151608
    Etoposide EP Impurity H
    CAS# 102306-95-6
    M.F.: C23H24O8
    M.W.: 428.43
  • QE151607
    Etoposide EP Impurity G
    CAS# NA
    M.F.: C39H38O17
    M.W.: 778.71
  • QE151606
    Etoposide EP Impurity F
    CAS# NA
    M.F.: C37H38O15
    M.W.: 722.69
  • QE151604
    Etoposide EP Impurity D
    CAS# 23363-35-1
    M.F.: C27H30O13
    M.W.: 562.52
  • QE151603
    Etoposide EP Impurity C
    CAS# 100007-53-2
    M.F.: C29H32O13
    M.W.: 588.56
  • QE151602
    Etoposide EP Impurity B
    CAS# 100007-56-5
    M.F.: C29H32O13
    M.W.: 588.56
  • QE151601
    Etoposide EP Impurity A
    CAS# 124151-67-3
    M.F.: C37H38O15
    M.W.: 722.69
  • QE202006
    Etilefrine hydrochloride EP Impurity F
    CAS# NA
    M.F.: C9H13N
    M.W.: 135.21
  • QE202005
    Etilefrine hydrochloride EP Impurity E
    CAS# NA
    M.F.: C8H8O2
    M.W.: 136.15
  • QE202004
    Etilefrine hydrochloride EP Impurity D
    CAS# NA
    M.F.: C17H19NO2
    M.W.: 269.34
  • QE202003
    Etilefrine hydrochloride EP Impurity C
    CAS# NA
    M.F.: C8H11NO2
    M.W.: 153.18
  • QE202002
    Etilefrine hydrochloride EP Impurity B
    CAS# 1477-63-0;154-86-9(HCl salt)
    M.F.: C9H13NO2
    M.W.: 167.21
  • QE202001
    Etilefrine hydrochloride EP Impurity A
    CAS# 22510-12-9
    M.F.: C10H13NO2
    M.W.: 179.22
  • QE202000
    Etilefrine hydrochloride
    CAS# 943-17-9
    M.F.: C10H16ClNO2
    M.W.: 217.69
  • QE201100
    Etidronate disodium
    CAS# 7414-83-7
    M.F.: C2H6Na2O7P2
    M.W.: 249.99
  • QE052001
    Ethosuximide EP Impurity A
    CAS# NA
    M.F.: C7H12O4
    M.W.: 160.17
  • QE052000
    Ethosuximide
    CAS# 77-67-8
    M.F.: C7H11NO2
    M.W.: 141.17
  • QE201003
    Ethacridine lactate monohydrate EP Impurity C
    CAS# NA
    M.F.: C17H18N2O3
    M.W.: 298.34
  • QE201002
    Ethacridine lactate monohydrate EP Impurity B
    CAS# NA
    M.F.: C15H13ClN2O
    M.W.: 272.73
  • QE201001
    Ethacridine lactate monohydrate EP Impurity A
    CAS# NA
    M.F.: C15H14N2O2
    M.W.: 254.28
  • QE201000
    Ethacridine lactate monohydrate
    CAS# 6402-23-9
    M.F.: C18H23N3O5
    M.W.: 361.39
  • QE011803
    Etacrynic acid EP Impurity C
    CAS# NA
    M.F.: C26H24Cl4O8
    M.W.: 606.28
  • QE011802
    Etacrynic acid EP Impurity B
    CAS# NA
    M.F.: C13H13Cl3O4
    M.W.: 339.60
  • QE011801
    Etacrynic acid EP Impurity A
    CAS# NA
    M.F.: C12H12Cl2O4
    M.W.: 291.13
  • QE011800
    Etacrynic acid
    CAS# 58-54-8
    M.F.: C13H12Cl2O4
    M.W.: 303.14
  • QE191104
    Esketamine hydrochloride EP Impurity D
    CAS# NA
    M.F.: C13H16ClNO
    M.W.: 237.73
  • QE191103
    Esketamine hydrochloride EP Impurity C
    CAS# 90717-17-2
    M.F.: C12H13ClO2
    M.W.: 224.68
  • QE191102
    Esketamine hydrochloride EP Impurity B
    CAS# NA
    M.F.: C12H13ClO2
    M.W.: 224.68
  • QE191101
    Esketamine hydrochloride EP Impurity A
    CAS# NA
    M.F.: C13H16ClNO
    M.W.: 237.73
  • QE191100
    Esketamine hydrochloride
    CAS# 33795-24-3
    M.F.: C13H17Cl2NO
    M.W.: 274.19
  • QE051903
    Ergotamine tartrate EP Impurity C
    CAS# NA
    M.F.: C34H37N5O5
    M.W.: 595.69
  • QE051902
    Ergotamine tartrate EP Impurity B
    CAS# NA
    M.F.: C33H35N5O5
    M.W.: 581.66
  • QE051901
    Ergotamine tartrate EP Impurity A
    CAS# NA
    M.F.: C33H35N5O6
    M.W.: 597.66
  • QE051900
    Ergotamine tartrate
    CAS# 379-79-3
    M.F.: C70H76N10O16
    M.W.: 1313.41
  • QE091807
    Epirubicin hydrochloride EP Impurity G;
    Epirubicin dimer

    CAS# 1046827-43-3
    M.F.: C54H58N2O22
    M.W.: 1087.04
  • QE091806
    Epirubicin hydrochloride EP Impurity F
    CAS# 57918-24-8;56390-08-0(HCl salt)
    M.F.: C27H29NO10
    M.W.: 527.52
  • QL142269
    Lenvatinib Impurity 69
    CAS# 108-43-0
    M.F.: C6H5ClO
    M.W.: 128.56
  • QE091805
    Epirubicin hydrochloride EP Impurity E
    CAS# NA
    M.F.: C27H31NO10
    M.W.: 529.54
  • QE091803
    Epirubicin hydrochloride EP Impurity C;Daunorubicin EP Impurity D
    CAS# NA
    M.F.: C27H29NO11
    M.W.: 543.52
  • QE091802
    Epirubicin hydrochloride EP Impurity B;
    Daunorubicin EP Impurity A

    CAS# 21794-55-8
    M.F.: C21H18O8
    M.W.: 398.36
  • QE091800
    Epirubicin hydrochloride
    CAS# 56390-09-1;56420-45-2(free base)
    M.F.: C27H30ClNO11
    M.W.: 579.98
  • QV180379
    Voriconazole Impurity 53
    CAS# NA
    M.F.: C8H14N4
    M.W.: 166.22
  • QE140906
    Enilconazole EP Impurity F
    CAS# NA
    M.F.: C14H14Cl2N2O
    M.W.: 297.18
  • QE140904
    Enilconazole EP Impurity D
    CAS# NA
    M.F.: C15H17Cl2NO2
    M.W.: 314.21
  • QE140903
    Enilconazole EP Impurity C
    CAS# NA
    M.F.: C12H13Cl2NO2
    M.W.: 274.14
  • QE140902
    Enilconazole EP Impurity B
    CAS# NA
    M.F.: C14H17Cl2NO
    M.W.: 286.2
  • QE140901
    Enilconazole EP Impurity A
    CAS# NA
    M.F.: C11H13Cl2NO
    M.W.: 246.13
  • QE130400
    Emedastine difumarate
    CAS# 87233-62-3;87233-61-2(free base)
    M.F.: C17H26N4O.2C4H4O4
    M.W.: 302.42 232.14
  • QE041800
    Edrophonium chloride
    CAS# 116-38-1
    M.F.: C10H16ClNO
    M.W.: 201.69
  • QE040601
    Edetic acid EP Impurity A
    CAS# NA
    M.F.: C6H9NO6
    M.W.: 191.14
  • QE040600
    Edetic acid
    CAS# 60-00-4
    M.F.: C10H16N2O8
    M.W.: 292.24
  • QD250403
    Dydrogesterone EP Impurity C
    CAS# 246038-13-1
    M.F.: C21H28O2
    M.W.: 312.45
  • QD250401
    Dydrogesterone EP Impurity A
    CAS# 23035-53-2
    M.F.: C21H26O2
    M.W.: 310.43
  • QD250400
    Dydrogesterone
    CAS# 152-62-5
    M.F.: C21H28O2
    M.W.: 312.45
  • QD181710
    Drospirenone EP Impurity K
    CAS# 889652-31-7
    M.F.: C24H30O3
    M.W.: 366.49
  • QD181709
    Drospirenone EP Impurity I
    CAS# 2896199-04-3
    M.F.: C24H32O3
    M.W.: 368.51
  • QD181708
    Drospirenone EP Impurity H
    CAS# 932388-89-1
    M.F.: C24H31ClO3
    M.W.: 402.95
  • QD181707
    Drospirenone EP Impurity G
    CAS# 932388-90-4
    M.F.: C24H31ClO3
    M.W.: 402.95
  • QD181704
    Drospirenone EP Impurity D
    CAS# 67372-69-4
    M.F.: C23H28O3
    M.W.: 352.47
  • QD181703
    Drospirenone EP Impurity C
    CAS# 116298-21-6
    M.F.: C21H26O2
    M.W.: 310.43
  • QD181702
    Drospirenone EP Impurity B
    CAS# NA
    M.F.: C24H32O4
    M.W.: 384.51
  • QD181701
    Drospirenone EP Impurity A
    CAS# 67372-68-3
    M.F.: C23H30O3
    M.W.: 354.48
  • QD240102
    Doxapram hydrochloride EP Impurity B
    CAS# 1688-76-2
    M.F.: C22H28N2O2
    M.W.: 352.47
  • QD240101
    Doxapram hydrochloride EP Impurity A
    CAS# 3192-64-1
    M.F.: C20H22ClNO
    M.W.: 327.85
  • QD240100
    Doxapram hydrochloride
    CAS# 7081-53-0
    M.F.: C24H33ClN2O3
    M.W.: 432.98
  • QD152005
    Dosulepin hydrochloride EP Impurity E
    CAS# NA
    M.F.: C19H21NS
    M.W.: 295.44
  • QD152004
    Dosulepin hydrochloride EP Impurity D
    CAS# NA
    M.F.: C19H21NO2S
    M.W.: 327.44
  • QD152003
    Dosulepin hydrochloride EP Impurity C
    CAS# NA
    M.F.: C19H23NOS
    M.W.: 313.46
  • QD152002
    Dosulepin hydrochloride EP Impurity B
    CAS# 1531-77-7
    M.F.: C14H10OS
    M.W.: 226.29
  • QD152001
    Dosulepin hydrochloride EP Impurity A
    CAS# NA
    M.F.: C19H21NOS
    M.W.: 311.44
  • QD152000
    Dosulepin hydrochloride
    CAS# 897-15-4
    M.F.: C19H22ClNS
    M.W.: 331.9
  • QD150701
    Dodecyl gallate EP Impurity A;
    Octyl gallate EP Impurity A

    CAS# 149-91-7;5995-86-8(monohydrate)
    M.F.: C7H6O5
    M.W.: 170.12
  • QD150700
    Dodecyl gallate
    CAS# 1166-52-5
    M.F.: C19H30O5
    M.W.: 338.44
  • QD092104
    Disopyramide EP Impurity D
    CAS# NA
    M.F.: C13H10N2
    M.W.: 194.23
  • QD092103
    Disopyramide EP Impurity C
    CAS# 38236-46-3
    M.F.: C18H23N3O
    M.W.: 297.39
  • QD092102
    Disopyramide EP Impurity B
    CAS# NA
    M.F.: C20H28N2
    M.W.: 296.45
  • QD092101
    Disopyramide EP Impurity A
    CAS# NA
    M.F.: C21H27N3
    M.W.: 321.46
  • QD161502
    Controlled Substance
    (Dipotassium clorazepate EP Impurity B)

    CAS# 1088-11-5
    M.F.: C15H11ClN2O
    M.W.: 270.71
  • QD161500
    Dipotassium clorazepate
    CAS# 57109-90-7
    M.F.: C16H11ClK2N2O4
    M.W.: 408.92
  • QD141706
    Dinoprostone EP Impurity F
    CAS# 26441-05-4
    M.F.: C20H30O5
    M.W.: 350.45
  • QD141704
    Dinoprostone EP Impurity D
    CAS# 13345-50-1
    M.F.: C20H30O4
    M.W.: 334.45
  • QD141702
    Dinoprostone EP Impurity B
    CAS# 27415-25-4
    M.F.: C20H32O5
    M.W.: 352.47
  • QD141701
    Dinoprostone EP Impurity A
    CAS# 38873-82-4
    M.F.: C20H32O5
    M.W.: 352.47
  • QD141700
    Dinoprostone;Alprostadil EP Impurity G
    CAS# 363-24-6
    M.F.: C20H32O5
    M.W.: 352.47
  • QD141504
    Dinoprost trometamol EP Impurity D
    CAS# NA
    M.F.: C20H34O5
    M.W.: 354.48
  • QD141502
    Dinoprost trometamol EP Impurity B
    CAS# 37658-84-7
    M.F.: C20H34O5
    M.W.: 354.48
  • QD141501
    Dinoprost trometamol EP Impurity A
    CAS# 36150-01-3
    M.F.: C20H34O5
    M.W.: 354.48
  • QD141500
    Dinoprost trometamol
    CAS# 38562-01-5;551-11-1(free base)
    M.F.: C24H45NO8
    M.W.: 475.62
  • QD131900
    Dimethyl sulfoxide
    CAS# 67-68-5
    M.F.: C2H6OS
    M.W.: 78.13
  • QD093303
    Dihydrotachysterol EP Impurity C
    CAS# NA
    M.F.: C28H48O
    M.W.: 400.68
  • QD093302
    Dihydrotachysterol EP Impurity B
    CAS# NA
    M.F.: C28H46O
    M.W.: 398.66
  • QD093301
    Dihydrotachysterol EP Impurity A
    CAS# NA
    M.F.: C28H46O
    M.W.: 398.66
  • QD093300
    Dihydrotachysterol
    CAS# 67-96-9
    M.F.: C28H46O
    M.W.: 398.66
  • QD093205
    Dihydroergotamine mesilate EP Impurity E
    CAS# 17479-19-5
    M.F.: C35H41N5O5
    M.W.: 611.73
  • QD093204
    Dihydroergotamine mesilate EP Impurity D
    CAS# NA
    M.F.: C33H37N5O5
    M.W.: 583.68
  • QD093203
    Dihydroergotamine mesilate EP Impurity C
    CAS# NA
    M.F.: C33H37N5O6
    M.W.: 599.68
  • QD093201
    Dihydroergotamine mesilate EP Impurity A
    CAS# NA
    M.F.: C33H35N5O5
    M.W.: 581.66
  • QD093200
    Dihydroergotamine mesilate
    CAS# 6190-39-2
    M.F.: C34H41N5O8S
    M.W.: 679.78
  • QD093112
    Dihydroergocristine mesilate EP Impurity L
    CAS# NA
    M.F.: C35H41N5O6
    M.W.: 627.73
  • QD093111
    Dihydroergocristine mesilate EP Impurity K;
    Ergotamine tartrate EP Impurity D

    CAS# NA
    M.F.: C35H39N5O5
    M.W.: 609.71
  • QD093110
    Dihydroergocristine mesilate EP Impurity J
    CAS# NA
    M.F.: C36H43N5O5
    M.W.: 625.76
  • QD093109
    Dihydroergocristine mesilate EP Impurity I
    CAS# NA
    M.F.: C32H43N5O5
    M.W.: 577.71
  • QD093108
    Dihydroergocristine mesilate EP Impurity H
    CAS# NA
    M.F.: C32H43N5O5
    M.W.: 577.71
  • QD093107
    Dihydroergocristine mesilate EP Impurity G;
    Dihydroergotamine mesilate EP Impurity B

    CAS# NA
    M.F.: C34H39N5O5
    M.W.: 597.70
  • QD093106
    Dihydroergocristine mesilate EP Impurity F
    CAS# NA
    M.F.: C31H41N5O5
    M.W.: 563.69
  • QD093105
    Dihydroergocristine mesilate EP Impurity E
    CAS# NA
    M.F.: C33H37N5O5
    M.W.: 583.68
  • QD093104
    Dihydroergocristine mesilate EP Impurity D
    CAS# NA
    M.F.: C29H37N5O5
    M.W.: 535.63
  • QD093102
    Dihydroergocristine mesilate EP Impurity B
    CAS# NA
    M.F.: C16H19N3O
    M.W.: 269.34
  • QD093101
    Dihydroergocristine mesilate EP Impurity A
    CAS# NA
    M.F.: C16H19N3O
    M.W.: 269.34
  • QD093100
    Dihydroergocristine mesilate
    CAS# 24730-10-7
    M.F.: C36H45N5O8S
    M.W.: 707.84
  • QD093004
    Dihydrocodeine hydrogen tartrate EP Impurity D
    CAS# NA
    M.F.: C19H25NO3
    M.W.: 315.41
  • QD093003
    Dihydrocodeine hydrogen tartrate EP Impurity C;
    Oxycodone hydrochloride EP Impurity E

    CAS# NA
    M.F.: C18H21NO3
    M.W.: 299.36
  • QD093002
    Dihydrocodeine hydrogen tartrate EP Impurity B
    CAS# NA
    M.F.: C17H19NO3
    M.W.: 285.34
  • QD093000
    Dihydrocodeine hydrogen tartrate
    CAS# 5965-13-9
    M.F.: C22H29NO9
    M.W.: 451.47
  • QD052200
    Diethylstilbestrol
    CAS# 56-53-1
    M.F.: C18H20O2
    M.W.: 268.35
  • QD091100
    Diethylcarbamazine citrate
    CAS# 1642-54-2
    M.F.: C16H29N3O8
    M.W.: 391.42
  • QD091004
    Dicloxacillin sodium EP Impurity D
    CAS# 3919-76-4
    M.F.: C11H7Cl2NO3
    M.W.: 272.08
  • QD091003
    Dicloxacillin sodium EP Impurity C
    CAS# 551-16-6
    M.F.: C8H12N2O3S
    M.W.: 216.26
  • QD091002
    Dicloxacillin sodium EP Impurity B
    CAS# NA
    M.F.: C18H19Cl2N3O4S
    M.W.: 444.33
  • QD091001
    Dicloxacillin sodium EP Impurity A
    CAS# 2088415-70-5
    M.F.: C19H19Cl2N3O6S
    M.W.: 488.34
  • QD091000
    Dicloxacillin sodium
    CAS# 13412-64-1;3116-76-5(free base)
    M.F.: C19H18Cl2N3NaO6S
    M.W.: 510.32
  • QD090707
    Diclazuril EP Impurity G
    CAS# NA
    M.F.: C22H17Cl3N4O4
    M.W.: 507.75
  • QD090706
    Diclazuril EP Impurity F
    CAS# NA
    M.F.: C16H10Cl3N3O2
    M.W.: 382.63
  • QD090705
    Diclazuril EP Impurity E
    CAS# NA
    M.F.: C14H9Cl3N2
    M.W.: 311.59
  • QD090704
    Diclazuril EP Impurity D
    CAS# NA
    M.F.: C16H8Cl3N3O3
    M.W.: 396.61
  • QD090703
    Diclazuril EP Impurity C
    CAS# NA
    M.F.: C18H10Cl3N5O3
    M.W.: 450.66
  • QD090702
    Diclazuril EP Impurity B
    CAS# NA
    M.F.: C17H10Cl2N4O3
    M.W.: 389.19
  • QD090701
    Diclazuril EP Impurity A
    CAS# NA
    M.F.: C18H9Cl3N4O4
    M.W.: 451.65
  • QD090202
    Dibrompropamidine diisetionate EP Impurity B
    CAS# NA
    M.F.: C17H19BrN4O2
    M.W.: 391.26
  • QD090201
    Dibrompropamidine diisetionate EP Impurity A
    CAS# NA
    M.F.: C17H17Br2N3O3
    M.W.: 471.14
  • QD090200
    Dibrompropamidine diisetionate
    CAS# 614-87-9
    M.F.: C21H30Br2N4O10S2
    M.W.: 722.42
  • QD052906
    Dextropropoxyphene hydrochloride EP Impurity F
    CAS# NA
    M.F.: C13H18O
    M.W.: 190.28
  • QD052904
    Dextropropoxyphene hydrochloride EP Impurity D
    CAS# NA
    M.F.: C22H29NO2
    M.W.: 339.47
  • QD052903
    Dextropropoxyphene hydrochloride EP Impurity C
    CAS# NA
    M.F.: C23H31NO2
    M.W.: 353.50
  • QD052902
    Dextropropoxyphene hydrochloride EP Impurity B
    CAS# NA
    M.F.: C21H27NO2
    M.W.: 325.44
  • QD052901
    Dextropropoxyphene hydrochloride EP Impurity A
    CAS# NA
    M.F.: C19H25NO
    M.W.: 283.41
  • QD052900
    Dextropropoxyphene hydrochloride
    CAS# 1639-60-7
    M.F.: C22H30ClNO2
    M.W.: 375.93
  • QD052800
    Dextromoramide tartrate
    CAS# 2922-44-3
    M.F.: C29H38N2O8
    M.W.: 542.62
  • QD052602
    Dexchlorpheniramine maleate EP Impurity B
    CAS# 32188-09-3;23095-76-3(maleate salt)
    M.F.: C16H19ClN2
    M.W.: 274.79
  • QD052600
    Dexchlorpheniramine maleate
    CAS# 2438-32-6;25523-97-1(free base)
    M.F.: C20H23ClN2O4
    M.W.: 390.86
  • QD191500
    Desoxycortone acetate
    CAS# 56-47-3
    M.F.: C23H32O4
    M.W.: 372.5
  • QD051600
    Desipramine hydrochloride
    CAS# 58-28-6
    M.F.: C18H23ClN2
    M.W.: 302.84
  • QD052108
    Controlled Substance
    (Desflurane EP Impurity H)

    CAS# 67-64-1
    M.F.: C3H6O
    M.W.: 58.08
  • QD052103
    Desflurane EP Impurity C
    CAS# 75-43-4
    M.F.: CHCl2F
    M.W.: 102.92
  • QD052102
    Desflurane EP Impurity B
    CAS# NA
    M.F.: C3H2ClF5O
    M.W.: 184.49
  • QD052101
    Desflurane EP Impurity A
    CAS# 67429-44-1
    M.F.: C4H2F8O
    M.W.: 218.05
  • QD051305
    Dembrexine hydrochloride monohydrate EP Impurity E
    CAS# 118-79-6
    M.F.: C6H3Br3O
    M.W.: 330.80
  • QD051704
    Deptropine citrate EP Impurity D
    CAS# NA
    M.F.: C22H25NO
    M.W.: 319.44
  • QD051703
    Deptropine citrate EP Impurity C;
    Nortriptyline hydrochloride EP Impurity I;
    Amitriptyline EP Impurity G

    CAS# 1210-34-0
    M.F.: C15H14O
    M.W.: 210.27
  • QD051702
    Deptropine citrate EP Impurity B
    CAS# NA
    M.F.: C23H27NO
    M.W.: 333.47
  • QD051700
    Deptropine citrate
    CAS# 2169-75-7
    M.F.: C29H35NO8
    M.W.: 525.59
  • QD051303
    Dembrexine hydrochloride monohydrate EP Impurity C
    CAS# NA
    M.F.: C7H4Br2O2
    M.W.: 279.91
  • QD051302
    Dembrexine hydrochloride monohydrate EP Impurity B
    CAS# NA
    M.F.: C13H17Br2NO2
    M.W.: 379.09
  • QD051301
    Dembrexine hydrochloride monohydrate EP Impurity A
    CAS# NA
    M.F.: C13H15Br2NO2
    M.W.: 377.07
  • QD051300
    Dembrexine hydrochloride monohydrate
    CAS# 52702-51-9
    M.F.: C13H20Br2ClNO3
    M.W.: 433.56
  • QD010303
    Dacarbazine EP Impurity C
    CAS# 1314929-56-0
    M.F.: C4H5N5O
    M.W.: 139.12
  • QC251710
    Cyproterone acetate EP Impurity J
    CAS# 15423-97-9
    M.F.: C24H30O5
    M.W.: 398.49
  • QC251709
    Cyproterone acetate EP Impurity I;
    Chlormadinone acetate EP Impurity D

    CAS# 13698-49-2
    M.F.: C23H27ClO4
    M.W.: 402.91
  • QC251708
    Cyproterone acetate EP Impurity H
    CAS# 2668-74-8
    M.F.: C23H30O4
    M.W.: 370.48
  • QC251707
    Cyproterone acetate EP Impurity G
    CAS# 23814-84-8
    M.F.: C24H31ClO5
    M.W.: 434.95
  • QC251706
    Cyproterone acetate EP Impurity F
    CAS# 2098-66-0
    M.F.: C22H27ClO3
    M.W.: 374.90
  • QC251705
    Cyproterone acetate EP Impurity E
    CAS# 17184-05-3
    M.F.: C24H30O5
    M.W.: 398.49
  • QC251704
    Cyproterone acetate EP Impurity D
    CAS# NA
    M.F.: C24H31ClO5
    M.W.: 434.95
  • QC251703
    Cyproterone acetate EP Impurity C
    CAS# 17183-98-1
    M.F.: C24H30Cl2O4
    M.W.: 453.4
  • QC251702
    Cyproterone acetate EP Impurity B
    CAS# NA
    M.F.: C25H32O5
    M.W.: 412.52
  • QC251701
    Cyproterone acetate EP Impurity A
    CAS# 2701-50-0
    M.F.: C24H30O4
    M.W.: 382.49
  • QC251700
    Cyproterone acetate
    CAS# 427-51-0
    M.F.: C24H29ClO4
    M.W.: 416.94
  • QC250503
    Cyclopentolate hydrochloride EP Impurity C
    CAS# 36882-00-5;113079-81-5(HCl salt)
    M.F.: C12H17NO2
    M.W.: 207.27
  • QC250501
    Cyclopentolate hydrochloride EP Impurity A
    CAS# NA
    M.F.: C13H16O3
    M.W.: 220.26
  • QC250500
    Cyclopentolate hydrochloride
    CAS# 5870-29-1
    M.F.: C17H26ClNO3
    M.W.: 327.85
  • QC250402
    Cyclizine hydrochloride EP Impurity B
    CAS# 91-01-0
    M.F.: C13H12O
    M.W.: 184.23
  • QC250400
    Cyclizine hydrochloride
    CAS# 305-25-3;82-92-8(free base)
    M.F.: C18H23ClN2
    M.W.: 302.84
  • QM041847
    Minodronic Acid Impurity 21
    CAS# NA
    M.F.: C18H14N4O3
    M.W.: 334.33
  • QM041846
    Minodronic Acid Impurity 20
    CAS# NA
    M.F.: C9H7ClN2O
    M.W.: 194.62
  • QM041845
    Minodronic Acid Impurity 19
    CAS# NA
    M.F.: C9H12N2O8P2
    M.W.: 338.15
  • QC030203
    Cocaine hydrochloride EP Impurity C
    CAS# NA
    M.F.: C38H46N2O8
    M.W.: 658.78
  • QC030202
    Cocaine hydrochloride EP Impurity B
    CAS# NA
    M.F.: C38H46N2O8
    M.W.: 658.78
  • QC030201
    Cocaine hydrochloride EP Impurity A
    CAS# NA
    M.F.: C19H23NO4
    M.W.: 329.39
  • QC030200
    Cocaine hydrochloride
    CAS# 53-21-4
    M.F.: C17H22ClNO4
    M.W.: 339.81
  • QC152010
    Closantel sodium dihydrate EP Impurity J
    CAS# NA
    M.F.: C44H27Cl3I4N4O4
    M.W.: 1289.69
  • QC152009
    Closantel sodium dihydrate EP Impurity I
    CAS# NA
    M.F.: C22H15Cl2IN2O2
    M.W.: 537.18
  • QC152008
    Closantel sodium dihydrate EP Impurity H
    CAS# NA
    M.F.: C23H17Cl2I2NO4
    M.W.: 696.10
  • QC152007
    Closantel sodium dihydrate EP Impurity G
    CAS# NA
    M.F.: C23H18Cl2I2N2O3
    M.W.: 695.12
  • QC152006
    Closantel sodium dihydrate EP Impurity F
    CAS# NA
    M.F.: C21H13Cl2I2NO3
    M.W.: 652.05
  • QC152005
    Closantel sodium dihydrate EP Impurity E
    CAS# NA
    M.F.: C22H14Cl3IN2O2
    M.W.: 571.62
  • QC152004
    Closantel sodium dihydrate EP Impurity D
    CAS# NA
    M.F.: C22H16Cl2I2N2O3
    M.W.: 681.09
  • QC152003
    Closantel sodium dihydrate EP Impurity C
    CAS# NA
    M.F.: C22H15Cl2I2NO4
    M.W.: 682.07
  • QC152002
    Closantel sodium dihydrate EP Impurity B
    CAS# NA
    M.F.: C15H12Cl2N2
    M.W.: 291.18
  • QC152001
    Closantel sodium dihydrate EP Impurity A
    CAS# NA
    M.F.: C7H4I2O3
    M.W.: 389.91
  • QC152000
    Closantel sodium dihydrate
    CAS# 61438-64-0;57808-65-8(free base)
    M.F.: C22H17Cl2I2N2NaO4
    M.W.: 721.09
  • QC151608
    Clopamide EP Impurity H
    CAS# NA
    M.F.: C17H25ClN4O3S
    M.W.: 400.92
  • QC151607
    Clopamide EP Impurity G
    CAS# NA
    M.F.: C13H18ClN3O3S
    M.W.: 331.82
  • QC151601
    Clopamide EP Impurity A
    CAS# NA
    M.F.: C14H20ClN3O3S
    M.W.: 345.84
  • QC151502
    Clonazepam EP Impurity B
    CAS# 55198-89-5
    M.F.: C15H10ClN3O3
    M.W.: 315.71
  • QC151306
    Clomifene citrate EP Impurity F
    CAS# 47648-28-2
    M.F.: C26H27Cl2NO
    M.W.: 440.40
  • QC151305
    Clomifene citrate EP Impurity E
    CAS# 117884-82-9
    M.F.: C26H27Cl2NO
    M.W.: 440.40
  • QC151304
    Clomifene citrate EP Impurity D
    CAS# 1391054-64-0
    M.F.: C38H46N2O3
    M.W.: 578.78
  • QC151303
    Clomifene citrate EP Impurity C
    CAS# 5635-70-1(HCl salt)
    M.F.: C26H29NO2
    M.W.: 387.51
  • QC151302
    Clomifene citrate EP Impurity B
    CAS# 796-77-0
    M.F.: C19H23NO2
    M.W.: 297.39
  • QC151301
    Clomifene citrate EP Impurity A
    CAS# 19957-52-9;74056-26-1(HCl salt)
    M.F.: C26H29NO
    M.W.: 371.51
  • QC151300
    Clomifene citrate
    CAS# 50-41-9
    M.F.: C32H36ClNO8
    M.W.: 598.08
  • QC150509
    Clobetasone butyrate EP Impurity I
    CAS# NA
    M.F.: C26H32ClFO5
    M.W.: 478.98
  • QC150508
    Clobetasone butyrate EP Impurity H
    CAS# NA
    M.F.: C25H30ClFO5
    M.W.: 464.95
  • QC150507
    Clobetasone butyrate EP Impurity G
    CAS# NA
    M.F.: C29H37FO7
    M.W.: 516.6
  • QC150506
    Clobetasone butyrate EP Impurity F
    CAS# NA
    M.F.: C26H32ClFO5
    M.W.: 478.98
  • QC150505
    Clobetasone butyrate EP Impurity E
    CAS# NA
    M.F.: C26H34ClFO5
    M.W.: 481
  • QC150504
    Clobetasone butyrate EP Impurity D
    CAS# NA
    M.F.: C26H31BrClFO5
    M.W.: 557.88
  • QC150503
    Clobetasone butyrate EP Impurity C
    CAS# NA
    M.F.: C26H34ClFO5
    M.W.: 481
  • QC150501
    Clobetasone butyrate EP Impurity A
    CAS# NA
    M.F.: C22H26ClFO4
    M.W.: 408.89
  • QC150500
    Clobetasone butyrate
    CAS# 25122-57-0
    M.F.: C26H32ClFO
    M.W.: 478.98
  • QC150406
    Clobazam EP Impurity F
    CAS# NA
    M.F.: C17H17ClN2O3
    M.W.: 332.78
  • QC150405
    Clobazam EP Impurity E
    CAS# 75524-13-9
    M.F.: C15H15ClN2O
    M.W.: 274.75
  • QC150404
    Clobazam EP Impurity D
    CAS# 2092997-47-0
    M.F.: C18H17ClN2O2
    M.W.: 328.79
  • QC150403
    Clobazam EP Impurity C
    CAS# 22316-16-1
    M.F.: C17H15ClN2O2
    M.W.: 314.77
  • QC150402
    Clobazam EP Impurity B
    CAS# 22316-24-1
    M.F.: C16H14N2O2
    M.W.: 266.29
  • QC150401
    Clobazam EP Impurity A
    CAS# 22316-55-8
    M.F.: C15H11ClN2O2
    M.W.: 286.71
  • QC121103
    Clioquinol EP Impurity C
    CAS# NA
    M.F.: C9H5I2NO
    M.W.: 396.95
  • QC121102
    Clioquinol EP Impurity B
    CAS# NA
    M.F.: C9H5Cl2NO
    M.W.: 214.05
  • QC121101
    Clioquinol EP Impurity A
    CAS# NA
    M.F.: C9H6ClNO
    M.W.: 179.6
  • QC121003
    Clebopride malate EP Impurity C 
    CAS# NA
    M.F.: C20H25N3O2
    M.W.: 339.43
  • QC121002
    Clebopride malate EP Impurity B 
    CAS# 50541-93-0
    M.F.: C12H18N2
    M.W.: 190.28
  • QC121001
    Clebopride malate EP Impurity A 
    CAS# 7206-70-4
    M.F.: C8H8ClNO3
    M.W.: 201.61
  • QC121000
    Clebopride malate
    CAS# 57645-91-7
    M.F.: C24H30ClN3O7
    M.W.: 507.96
  • QC122609
    Clazuril   EP Impurity I 
    CAS# NA
    M.F.: C16H12Cl2N4O
    M.W.: 347.2
  • QC122608
    Clazuril   EP Impurity H 
    CAS# NA
    M.F.: C34H19Cl3N8O4
    M.W.: 709.92
  • QC122607
    Clazuril   EP Impurity G 
    CAS# NA
    M.F.: C16H9Cl2N3O3
    M.W.: 362.17
  • QC122606
    Clazuril   EP Impurity F 
    CAS# NA
    M.F.: C20H14Cl2N4O4
    M.W.: 445.26
  • QP032015
    Procaterol Impurity 15
    CAS# NA
    M.F.: C16H22N2O3 HCl
    M.W.: 290.36 36.46
  • QC122605
    Clazuril   EP Impurity E 
    CAS# NA
    M.F.: C19H12Cl2N4O4
    M.W.: 431.23
  • QC122604
    Clazuril   EP Impurity D 
    CAS# NA
    M.F.: C20H15Cl2N5O3
    M.W.: 444.27
  • QC122603
    Clazuril   EP Impurity C 
    CAS# NA
    M.F.: C17H12Cl2N4O3
    M.W.: 391.21
  • QC122602
    Clazuril   EP Impurity B 
    CAS# NA
    M.F.: C18H11Cl2N5O3
    M.W.: 416.22
  • QC122601
    Clazuril   EP Impurity A 
    CAS# NA
    M.F.: C17H11Cl2N3O4
    M.W.: 392.19
  • QC091204
    Cilazapril EP Impurity D 
    CAS# NA
    M.F.: C22H31N3O5
    M.W.: 417.50
  • QC091203
    Cilazapril EP Impurity C 
    CAS# NA
    M.F.: C24H35N3O5
    M.W.: 445.55
  • QC091202
    Cilazapril EP Impurity B 
    CAS# NA
    M.F.: C20H27N3O5
    M.W.: 389.45
  • QC091201
    Cilazapril EP Impurity A 
    CAS# NA
    M.F.: C26H39N3O5
    M.W.: 473.60
  • QC090403
    Ciclesonide EP Impurity C 
    CAS# NA
    M.F.: C32H42O7
    M.W.: 538.67
  • QC090402
    Ciclesonide EP Impurity B 
    CAS# 161115-59-9
    M.F.: C28H38O6
    M.W.: 470.60
  • QC090401
    Ciclesonide EP Impurity A 
    CAS# 141845-81-0
    M.F.: C32H44O7
    M.W.: 540.69
  • QN151841
    Noradrenaline (Norepinephrine) Impurity 41
    CAS# 2947-04-8;3770-01-2(HCl salt)
    M.F.: C9H13NO3
    M.W.: 183.20
  • QC182212
    Chlortetracycline EP Impurity L  
    CAS# NA
    M.F.: C22H21ClN2O7
    M.W.: 460.86
  • QC182211
    Chlortetracycline EP Impurity K  
    CAS# NA
    M.F.: C22H21ClN2O7
    M.W.: 460.86
  • QC182210
    Chlortetracycline EP Impurity J;
    Lymecycline EP Impurity C

    CAS# NA
    M.F.: C22H22N2O7
    M.W.: 426.42
  • QC182209
    Chlortetracycline EP Impurity I;
    Lymecycline EP Impurity D

    CAS# NA
    M.F.: C22H22N2O7
    M.W.: 426.42
  • QC182208
    Chlortetracycline EP Impurity H  
    CAS# NA
    M.F.: C23H24ClNO8
    M.W.: 477.89
  • QC182207
    Chlortetracycline EP Impurity G  
    CAS# NA
    M.F.: C22H23ClN2O8
    M.W.: 478.88
  • QC182206
    Chlortetracycline EP Impurity F  
    CAS# NA
    M.F.: C22H23ClN2O8
    M.W.: 478.88
  • QC182205
    Chlortetracycline EP Impurity E;
    Demeclocycline EP Impurity B

    CAS# 14206-59-8
    M.F.: C21H21ClN2O8
    M.W.: 464.85
  • QC182204
    Chlortetracycline EP Impurity D;
    Lymecycline EP Impurity A;
    Tetracycline EP Impurity A;
    4-Epitetracycline

    CAS# 79-85-6;23313-80-6(HCl salt)
    M.F.: C22H24N2O8
    M.W.: 444.43
  • QC182203
    Chlortetracycline EP Impurity C;
    Demeclocycline EP Impurity C

    CAS# NA
    M.F.: C21H22N2O8
    M.W.: 430.41
  • QC121701
    Chlorhexidine EP Impurity A  
    CAS# 152504-08-0
    M.F.: C16H24ClN9
    M.W.: 377.88
  • QT131211
    Timolol Maleate Impurity 11
    CAS# 1391068-18-0
    M.F.: C19H31N7O4S2
    M.W.: 485.62
  • QC121714
    Chlorhexidine EP Impurity N  
    CAS# 152504-10-4
    M.F.: C15H25ClN8
    M.W.: 352.87
  • QC121708
    Chlorhexidine EP Impurity H  
    CAS# NA
    M.F.: C30H47Cl2N15
    M.W.: 688.70
  • QC121705
    Chlorhexidine EP Impurity E  
    CAS# 45964-97-4;14279-91-5(HCl salt)
    M.F.: C7H8ClN3
    M.W.: 169.61
  • QC051309
    Celiprolol EP Impurity I 
    CAS# NA
    M.F.: C15H22N2O3
    M.W.: 278.35
  • QC051308
    Celiprolol EP Impurity H 
    CAS# NA
    M.F.: C16H23BrN2O4
    M.W.: 387.27
  • QC051307
    Celiprolol EP Impurity G 
    CAS# NA
    M.F.: C16H22N2O4
    M.W.: 306.36
  • QC051306
    Celiprolol EP Impurity F 
    CAS# NA
    M.F.: C13H18N2O3
    M.W.: 250.29
  • QC051304
    Celiprolol EP Impurity D 
    CAS# NA
    M.F.: C20H33N3O4
    M.W.: 379.49
  • QC051303
    Celiprolol EP Impurity C 
    CAS# NA
    M.F.: C20H33N3O4
    M.W.: 379.49
  • QC051301
    Celiprolol EP Impurity A 
    CAS# NA
    M.F.: C15H24N2O3
    M.W.: 280.36
  • QC012305
    Carteolol EP Impurity E 
    CAS# 56660-90-3
    M.F.: C21H22N2O5
    M.W.: 382.41
  • QC012304
    Carteolol EP Impurity D 
    CAS# 51781-13-6
    M.F.: C12H14ClNO3
    M.W.: 255.70
  • QC012303
    Carteolol EP Impurity C 
    CAS# 51781-14-7
    M.F.: C12H13NO3
    M.W.: 219.24
  • QC012302
    Carteolol EP Impurity B 
    CAS# 30389-33-4
    M.F.: C9H9NO2
    M.W.: 163.17
  • QC011705
    Carprofen EP Impurity E 
    CAS# NA
    M.F.: C12H8ClN
    M.W.: 201.65
  • QB051300
    Bempedoic acid
    CAS# 738606-46-7
    M.F.: C19H36O5
    M.W.: 344.49
  • QC012809
    Camphor EP Impurity I
    CAS# NA
    M.F.: C10H18O
    M.W.: 154.25
  • QC012804
    Camphor EP Impurity D
    CAS# NA
    M.F.: C10H18O
    M.W.: 154.25
  • QC012704
    Cabergoline EP Impurity D
    CAS# 85329-86-8
    M.F.: C23H32N4O
    M.W.: 380.53
  • QC012703
    Cabergoline EP Impurity C
    CAS# 126554-50-5
    M.F.: C29H42N6O3
    M.W.: 522.68
  • QC012702
    Cabergoline EP Impurity B
    CAS# 166533-36-4
    M.F.: C26H37N5O2
    M.W.: 451.60
  • QC012701
    Cabergoline EP Impurity A
    CAS# 81409-74-7
    M.F.: C18H20N2O2
    M.W.: 296.36
  • QB211610
    Buprenorphine EP Impurity J
    CAS# NA
    M.F.: C29H39NO4
    M.W.: 465.62
  • QB211609
    Buprenorphine EP Impurity I
    CAS# NA
    M.F.: C28H37NO3
    M.W.: 435.60
  • QN122033
    6α-N-methylnaltrexamine
    CAS# 102919-85-7
    M.F.: C21H28N2O3
    M.W.: 356.46
  • QB211608
    Buprenorphine EP Impurity H
    CAS# NA
    M.F.: C29H43NO4
    M.W.: 469.66
  • QB211607
    Buprenorphine EP Impurity G
    CAS# NA
    M.F.: C58H80N2O8
    M.W.: 933.26
  • QB211606
    Buprenorphine EP Impurity F
    CAS# NA
    M.F.: C29H39NO3
    M.W.: 449.62
  • QB211605
    Buprenorphine EP Impurity E
    CAS# NA
    M.F.: C28H39NO4
    M.W.: 453.61
  • QB211604
    Buprenorphine EP Impurity D
    CAS# NA
    M.F.: C30H43NO4
    M.W.: 481.67
  • QB211603
    Buprenorphine EP Impurity C
    CAS# NA
    M.F.: C27H36N2O4
    M.W.: 452.59
  • QB211602
    Controlled Substance
    (Buprenorphine EP Impurity B)

    CAS# 78715-23-8
    M.F.: C25H35NO4
    M.W.: 413.55
  • QB211601
    Buprenorphine EP Impurity A
    CAS# NA
    M.F.: C29H41NO4
    M.W.: 467.64
  • QB210503
    Bufexamac EP Impurity C
    CAS# NA
    M.F.: C16H24O3
    M.W.: 264.36
  • QB210502
    Bufexamac EP Impurity B
    CAS# NA
    M.F.: C13H18O3
    M.W.: 222.28
  • QB210501
    Bufexamac EP Impurity A
    CAS# NA
    M.F.: C12H16O3
    M.W.: 208.25
  • QB182002
    Brotizolam EP Impurity B
    CAS# NA
    M.F.: C14H8BrClN4S
    M.W.: 379.66
  • QB052202
    Betadex EP Impurity B;Alfadex EP Impurity B
    CAS# 17465-86-0
    M.F.: C48H80O40
    M.W.: 1297.12
  • QB052201
    Betadex EP Impurity A
    CAS# 10016-20-3
    M.F.: C36H60O30
    M.W.: 972.84
  • QB052700
    Benzyl benzoate
    CAS# 120-51-4
    M.F.: C14H12O2
    M.W.: 212.24
  • QA181007
    Articaine EP Impurity G
    CAS# NA
    M.F.: C14H22N2O3S
    M.W.: 298.4
  • QA181006
    Articaine EP Impurity F
    CAS# NA
    M.F.: C15H25N3O2S
    M.W.: 311.44
  • QA181002
    Articaine EP Impurity B
    CAS# 114176-52-2
    M.F.: C12H18N2O3S
    M.W.: 270.35
  • QA142601
    Antazoline hydrochloride EP Impurity A
    CAS# NA
    M.F.: C17H21N3O
    M.W.: 283.37
  • QF120315
    Folic Acid Impurity 15
    CAS# 712-29-8
    M.F.: C7H7N5O2
    M.W.: 193.16
  • QF120314
    Folic Acid Impurity 14
    CAS# 873397-19-4
    M.F.: C7H6ClN5O
    M.W.: 211.61
  • QA142600
    Antazoline hydrochloride
    CAS# 2508-72-7
    M.F.: C17H20ClN3
    M.W.: 301.81
  • QF122020
    Fluticasone Impurity 20;
    Fluticasone Furoate EP Impurity F

    CAS# NA
    M.F.: C29H34F2O7
    M.W.: 532.57
  • QN150300
    Neomycin sulfate
    CAS# 1405-10-3
    M.F.: C23H46N6O13.xH2SO4
    M.W.: 614.64 x(98.08)
  • QM091903
    Misoprostol EP Impurity C
    CAS# NA
    M.F.: C22H36O4
    M.W.: 364.52
  • QM050105
    Metamizole sodium EP Impurity E
    CAS# 117-38-4;129-89-5(Na salt)
    M.F.: C12H15N3O4S
    M.W.: 297.33
  • QM050104
    Metamizole sodium EP Impurity D
    CAS# 58-15-1
    M.F.: C13H17N3O
    M.W.: 231.29
  • QM050103
    Metamizole sodium EP Impurity C
    CAS# 519-98-2;856307-27-2(HCl salt)
    M.F.: C12H15N3O
    M.W.: 217.27
  • QM050102
    Metamizole sodium EP Impurity B
    CAS# 83-07-8
    M.F.: C11H13N3O
    M.W.: 203.24
  • QV307760
    Vitamin B12;Cyanocobalamin
    CAS# 68-19-9
    M.F.: C63H88CoN14O14P
    M.W.: 1355.37
  • QA130302
    Aminocaproic acid Impurity B
    CAS# NA
    M.F.: C8H11F2NO3
    M.W.: 207.17
  • QL241678
    Loxoprofen Impurity 52
    CAS# NA
    M.F.: C18H24O5
    M.W.: 320.38
  • QZ151206
    Zoledronic acid Impurity 6
    CAS# 1627731-61-6;2043362-88-3(chloride)
    M.F.: C7H16N2O14P4
    M.W.: 476.10
  • QA141501
    Aminoglutethimide EP Impurity A
    CAS# NA
    M.F.: C13H16N2O2
    M.W.: 232.28
  • QC162639
    Cefprozil Impurity 13
    CAS# NA
    M.F.: C36H36N6O9S2
    M.W.: 760.84
  • QM140437
    Metronidazole Nitroso Impurity 5
    CAS# NA
    M.F.: C4H5N3O
    M.W.: 111.10
  • QA120604
    Alfentanil EP Impurity D
    CAS# NA
    M.F.: C20H30N6O3
    M.W.: 402.49
  • QA120600
    Alfentanil hydrochloride
    CAS# 69049-06-5
    M.F.: C21H33ClN6O3
    M.W.: 452.98
  • QC123102
    Clemastine EP Impurity B
    CAS# NA
    M.F.: C21H26ClNO
    M.W.: 343.89
  • QA031228
    Aciclovir Impurity 28
    CAS# NA
    M.F.: C9H13N5O4
    M.W.: 255.23
  • QA161854
    Aprepitant Impurity 54
    CAS# NA
    M.F.: C3H6ClN3O2
    M.W.: 151.55
  • QP082701
    Pheniramine maleate EP Impurity A
    CAS# 101-82-6
    M.F.: C12H11N
    M.W.: 169.22
  • QA142001
    Antipyrine Impurity 1;Metamizole sodium EP Impurity A
    CAS# 1672-58-8
    M.F.: C12H13N3O2
    M.W.: 231.25
  • QC181504
    Cromolyn Sodium Impurity 4;
    Sodium Cromoglicate EP Impurity A

    CAS# 699-83-2
    M.F.: C8H8O3
    M.W.: 152.15
  • QF120313
    D-Folic Acid
    CAS# 65165-91-5
    M.F.: C19H19N7O6
    M.W.: 441.40
  • QT031856
    all-rac-alpha-Tocopherol EP Impurity C
    CAS# 90510-39-7
    M.F.: C30H52O2
    M.W.: 444.73
  • QV307758
    Vitamin B6 Impurity 58
    CAS# 19203-53-3
    M.F.: C16H20N2O5
    M.W.: 320.34
  • QV307757
    Vitamin B6 Impurity 57
    CAS# 18436-47-0
    M.F.: C16H20N2O5
    M.W.: 320.34
  • QB180926
    Brivaracetam Impurity Z
    CAS# 22530-99-0
    M.F.: C8H14O2
    M.W.: 142.20
  • QP080508
    Phenytoin Sodium impurity 8
    CAS# 56079-91-5
    M.F.: C15H11N3O4
    M.W.: 297.27
  • QP080507
    Phenytoin Sodium impurity 7
    CAS# 1189192-83-3
    M.F.: C15H10N4O6
    M.W.: 342.26
  • QP080506
    Phenytoin Sodium EP Impurity F
    CAS# 51169-17-6
    M.F.: C16H14N2O2
    M.W.: 266.29
  • QP080505
    Phenytoin Sodium EP Impurity E
    CAS# 6802-95-5
    M.F.: C15H14N2O3
    M.W.: 270.28
  • QP080511
    Phenytoin Sodium impurity 11
    CAS# 36898-62-1
    M.F.: C14H10N2O6
    M.W.: 302.24
  • QP080510
    Phenytoin Sodium impurity 10
    CAS# 61693-07-0
    M.F.: C14H11NO4
    M.W.: 257.24
  • QM041844
    Minodronic Acid Impurity 18
    CAS# NA
    M.F.: C8H6N2O2
    M.W.: 162.15
  • QR160731
    Repaglinide Impurity 5
    CAS# NA
    M.F.: C18H24O7
    M.W.: 352.38
  • QB050101
    Betaxolol EP Impurity A
    CAS# 67193-95-7
    M.F.: C14H23NO2
    M.W.: 237.34
  • QA190212
    Ascorbic Acid Impurity 12
    CAS# 3445-22-5
    M.F.: C6H8O7
    M.W.: 192.12
  • QL091649
    Lipoic Acid Impurity 23
    CAS# 940-69-2
    M.F.: C8H15NOS2
    M.W.: 205.34
  • QM041843
    Minodronic Acid Impurity 17
    CAS# NA
    M.F.: C9H9N2O4P
    M.W.: 240.15
  • QM041842
    Minodronic Acid Impurity 16
    CAS# NA
    M.F.: C14H12N4O
    M.W.: 252.27
  • QM041841
    Minodronic Acid Impurity 15
    CAS# 4437-06-3
    M.F.: C4H4O3
    M.W.: 100.07
  • QM041840
    Minodronic Acid Impurity 14
    CAS# 653599-20-3
    M.F.: C9H8N2O3
    M.W.: 192.17
  • QM041839
    Minodronic Acid Impurity 13
    CAS# 1507308-67-9
    M.F.: C9H7ClN2O2
    M.W.: 210.62
  • QM041838
    Minodronic Acid Impurity 12
    CAS# NA
    M.F.: C9H11ClN2O7P2
    M.W.: 356.59
  • QL091648
    Lipoic Acid Impurity 22
    CAS# 25636-58-2
    M.F.: C8H14O2S
    M.W.: 174.26
  • QM041837
    Minodronic Acid Impurity 11
    CAS# 17745-04-9
    M.F.: C9H8N2O2
    M.W.: 176.17
  • QA130502
    Aminolevulinic Acid Related Compound B
    CAS# 109258-71-1
    M.F.: C14H13NO5
    M.W.: 275.26
  • QA130501
    Aminolevulinic Acid Related Compound A
    CAS# 77479-02-8
    M.F.: C10H12N2O4
    M.W.: 224.21
  • QA130500
    Aminolevulinic Acid Hydrochloride
    CAS# 5451-09-2;106-60-5(free base)
    M.F.: C5H9NO3 HCl
    M.W.: 131.13 36.46
  • QC051206
    Ceftezole Sodium Impurity 6
    CAS# NA
    M.F.: C12H11N9O4S3
    M.W.: 441.47
  • QC051205
    Ceftezole Sodium Impurity 5
    CAS# NA
    M.F.: C13H12N8O4S3
    M.W.: 440.48
  • QC051204
    Ceftezole Sodium Impurity 4
    CAS# NA
    M.F.: C13H13N9O3S3
    M.W.: 439.50
  • QC051203
    Ceftezole Sodium Impurity 3
    CAS# NA
    M.F.: C13H14N8O5S3
    M.W.: 458.50
  • QC051202
    Ceftezole Sodium Impurity 2
    CAS# NA
    M.F.: C13H12N8O4S3
    M.W.: 440.48
  • QC051201
    Ceftezole Sodium Impurity 1
    CAS# NA
    M.F.: C13H12N8O5S3
    M.W.: 456.48
  • QE120119
    Elagolix Impurity 19
    CAS# 2409132-61-0
    M.F.: C28H21F5N2O4
    M.W.: 544.47
  • QE120116
    Elagolix Impurity 16
    CAS# NA
    M.F.: C40H44F5N3O7
    M.W.: 773.79
  • QC061910
    Ceftaroline Fosamil Impurity J
    CAS# NA
    M.F.: C29H26N2O7S2
    M.W.: 578.66
  • QC061909
    Ceftaroline Fosamil Impurity I
    CAS# NA
    M.F.: C28H24N2O5S
    M.W.: 500.57
  • QC061908
    Ceftaroline Fosamil Impurity H
    CAS# NA
    M.F.: C16H14N4O3S3
    M.W.: 406.50
  • QU190425
    Ursodeoxycholic Acid Impurity 25
    CAS# NA
    M.F.: C24H38O4
    M.W.: 390.56
  • QP180437
    Perindopril Impurity 37
    CAS# 82864-25-3
    M.F.: C11H19NO2 HCl
    M.W.: 197.27 36.46
  • QT011500
    Tauroursodeoxycholic Acid
    CAS# 14605-22-2
    M.F.: C26H45NO6S
    M.W.: 499.70
  • QL091647
    Lipoic Acid Impurity 21
    CAS# NA
    M.F.: C9H16O2S2
    M.W.: 220.35
  • QL091646
    Lipoic Acid Impurity 20
    CAS# NA
    M.F.: C4H6O2S2
    M.W.: 150.22
  • QL091645
    Lipoic Acid Impurity 19
    CAS# NA
    M.F.: C6H10O3S2
    M.W.: 194.27
  • QL091644
    Lipoic Acid Impurity 18
    CAS# NA
    M.F.: C6H10O2S2
    M.W.: 178.27
  • QL091643
    Lipoic Acid Impurity 17
    CAS# NA
    M.F.: C9H16O2S2
    M.W.: 220.35
  • QL091642
    Lipoic Acid Impurity 16
    CAS# NA
    M.F.: C9H16O2S2
    M.W.: 220.35
  • QL091641
    Lipoic Acid Impurity 15
    CAS# 1071-71-2
    M.F.: C8H13ClO3
    M.W.: 192.64
  • QA130405
    Amidotrizoic Acid EP Impurity E
    CAS# NA
    M.F.: C13H11I3N2O5
    M.W.: 655.95
  • QA130404
    Amidotrizoic Acid EP Impurity D
    CAS# NA
    M.F.: C11H8I4N2O4
    M.W.: 739.81
  • QA130403
    Amidotrizoic Acid EP Impurity C
    CAS# NA
    M.F.: C11H10I2N2O4
    M.W.: 488.02
  • QA130401
    Amidotrizoic Acid EP Impurity A;
    Sodium amidotrizoate EP Impurity A

    CAS# NA
    M.F.: C9H7I3N2O3
    M.W.: 571.88
  • QA130400
    Amidotrizoic Acid
    CAS# 117-96-4
    M.F.: C11H9I3N2O4
    M.W.: 613.91
  • QA041601
    Adipic acid EP Impurity A
    CAS# 110-94-1
    M.F.: C5H8O4
    M.W.: 132.11
  • QA180228
    Arbidol Impurity 28
    CAS# NA
    M.F.: C20H21BrN2O3S
    M.W.: 449.36
  • QI091600
    Ipratropium bromide monohydrate
    CAS# 66985-17-9;60205-81-4(cation form)
    M.F.: C20H30BrNO3 H2O
    M.W.: 412.36 18.02
  • QT181400
    Treprostinil
    CAS# 81846-19-7;289480-64-4(Na salt)
    M.F.: C23H34O5
    M.W.: 390.51
  • QP072040
    Pioglitazone hydrochloride Impurity 40
    CAS# NA
    M.F.: C19H20N2O2S
    M.W.: 340.44
  • QN050904
    Netilmicin sulfate EP Impurity D
    CAS# NA
    M.F.: C23H45N5O7
    M.W.: 503.63
  • QA200345
    Cisatracurium Besylate Impurity 45
    CAS# NA
    M.F.: C65H82N2O18S2
    M.W.: 1243.48
  • QH121617
    Haloperidol Impurity 17
    CAS# NA
    M.F.: C31H32ClF2NO3
    M.W.: 540.04
  • QA200344
    Atracurium besylate
    CAS# 64228-81-5
    M.F.: C65H82N2O18S2
    M.W.: 1243.48
  • QS052003
    Sertaconazole nitrate EP Impurity C
    CAS# 142181-53-1
    M.F.: C9H7ClOS
    M.W.: 198.67
  • QS052002
    Sertaconazole nitrate EP Impurity B
    CAS# 17512-61-7
    M.F.: C9H6BrClS
    M.W.: 261.57
  • QC042005
    Cefditoren pivoxil Impurity 5
    CAS# NA
    M.F.: C28H33N7O7S3
    M.W.: 675.80
  • QC042004
    Cefditoren pivoxil Impurity 4
    CAS# 878002-86-9
    M.F.: C25H28N6O7S3
    M.W.: 620.72
  • QB050415
    Bedaquiline Fumarate Impurity 15
    CAS# 861709-47-9
    M.F.: C31H29BrN2O2
    M.W.: 541.48
  • QI091623
    Ipratropium Bromide Impurity 23
    CAS# NA
    M.F.: C20H30BrNO3
    M.W.: 412.36
  • QI091622
    Ipratropium Bromide Impurity 22
    CAS# NA
    M.F.: C19H27NO3
    M.W.: 317.42
  • QZ151205
    Zoledronic acid Impurity 5
    CAS# 1334703-07-9
    M.F.: C11H17ClN2O4
    M.W.: 276.72
  • QZ151204
    Zoledronic acid Impurity 4
    CAS# 117255-11-5;805228-36-8(chloride)
    M.F.: C7H8N2O4
    M.W.: 184.15
  • QZ151203
    Zoledronic acid Impurity 3
    CAS# 1627731-60-5
    M.F.: C7H12N2O9P2
    M.W.: 330.13
  • QZ151202
    Zoledronic acid Impurity 2
    CAS# NA
    M.F.: C10H16N4O12P4
    M.W.: 508.15
  • QZ151201
    Zoledronic acid Impurity 1;
    Zoledronic acid EP Impurity B

    CAS# 1632236-60-2;2043362-88-3(Cl salt)
    M.F.: C7H17N2O14P4
    M.W.: 477.11
  • QN151836
    Noradrenaline (Norepinephrine) Impurity 36
    CAS# 50988-14-2
    M.F.: C9H11NO3
    M.W.: 181.19
  • QN151835
    Noradrenaline (Norepinephrine) Impurity 35
    CAS# NA
    M.F.: C9H13NO4
    M.W.: 199.20
  • QN151834
    Noradrenaline (Norepinephrine) Impurity 34
    CAS# NA
    M.F.: C9H13NO4
    M.W.: 199.20
  • QN151833
    Noradrenaline (Norepinephrine) Impurity 33
    CAS# 21213-89-8
    M.F.: C9H11NO2
    M.W.: 165.19
  • QN151832
    Noradrenaline (Norepinephrine) Impurity 32
    CAS# 554-99-4 ;62-22-6(HCl salt)
    M.F.: C10H15NO3
    M.W.: 197.23
  • QN151831
    Noradrenaline (Norepinephrine) Impurity 31
    CAS# 2947-02-6;74571-90-7(HCl salt)
    M.F.: C10H15NO3
    M.W.: 197.23
  • QN151830
    Noradrenaline (Norepinephrine) Impurity 30
    CAS# NA
    M.F.: C17H21NO6
    M.W.: 335.35
  • QN151829
    Noradrenaline (Norepinephrine) Impurity 29
    CAS# NA
    M.F.: C17H17NO6
    M.W.: 331.32
  • QN151828
    Noradrenaline (Norepinephrine) Impurity 28
    CAS# 150-05-0
    M.F.: C9H13NO3
    M.W.: 183.20
  • QN151827
    Noradrenaline (Norepinephrine) Impurity 27
    CAS# 1197-09-7
    M.F.: C8H8O3
    M.W.: 152.15
  • QN151826
    Noradrenaline (Norepinephrine) Impurity 26
    CAS# 373360-12-4
    M.F.: C8H11NO3
    M.W.: 169.18
  • QN151825
    Noradrenaline (Norepinephrine) Impurity 25
    CAS# 73660-93-2
    M.F.: C8H11NO3
    M.W.: 169.18
  • QN151824
    Noradrenaline (Norepinephrine) Impurity 24
    CAS# 1891319-98-4
    M.F.: C8H9NO3
    M.W.: 167.16
  • QN151823
    Noradrenaline (Norepinephrine) Impurity 23
    CAS# NA
    M.F.: C8H9NO4
    M.W.: 183.16
  • QN151822
    Noradrenaline (Norepinephrine) Impurity 22
    CAS# NA
    M.F.: C8H6Cl2O3
    M.W.: 221.04
  • QN151821
    Noradrenaline (Norepinephrine) Impurity 21
    CAS# 29477-54-1
    M.F.: C8H8O4
    M.W.: 168.15
  • QN151820
    Noradrenaline (Norepinephrine) Impurity 20
    CAS# 408328-15-4
    M.F.: C8H8O4
    M.W.: 168.15
  • QN151819
    Noradrenaline (Norepinephrine) Impurity 19
    CAS# 60912-82-5
    M.F.: C8H7ClO3
    M.W.: 186.59
  • QN151818
    Noradrenaline (Norepinephrine) Impurity 18
    CAS# 490-90-4
    M.F.: C8H5NO3
    M.W.: 163.13
  • QN151817
    Noradrenaline (Norepinephrine) Impurity 17
    CAS# 490-89-1
    M.F.: C8H7NO3
    M.W.: 165.15
  • QN151816
    Noradrenaline (Norepinephrine) Impurity 16
    CAS# 3198-07-0(HCl salt)
    M.F.: C10H15NO3
    M.W.: 197.23
  • QN151815
    Noradrenaline (Norepinephrine) Impurity 15
    CAS# 132261-26-8
    M.F.: C8H12N2O2
    M.W.: 168.19
  • QN151814
    Noradrenaline (Norepinephrine) Impurity 14
    CAS# 3805-00-3(HCl salt)
    M.F.: C10H15NO3
    M.W.: 197.23
  • QN151813
    Noradrenaline (Norepinephrine) Impurity 13
    CAS# 5530-29-0
    M.F.: C8H9ClO3
    M.W.: 188.61
  • QN151812
    Noradrenaline (Norepinephrine) Impurity 12
    CAS# 28822-73-3
    M.F.: C8H10O4
    M.W.: 170.16
  • QN151811
    Noradrenaline (Norepinephrine) Impurity 11
    CAS# NA
    M.F.: C16H19NO6
    M.W.: 321.33
  • QN151809
    Noradrenaline (Norepinephrine) Impurity 9
    CAS# 872266-28-9
    M.F.: C16H15NO6
    M.W.: 317.29
  • QG122109
    Glucaric acid
    CAS# 87-73-0;5793-89-5(Calcium salt tetrahydrate)
    M.F.: C6H10O8
    M.W.: 210.14
  • QM050501
    Methylene violet
    CAS# 2516-05-4
    M.F.: C14H12N2OS
    M.W.: 256.32
  • QC071209
    Carglumic Acid Impurity 9
    CAS# NA
    M.F.: C6H8N2O4
    M.W.: 172.14
  • QC071208
    Carglumic Acid Impurity 8
    CAS# 5624-26-0
    M.F.: C6H8N2O4
    M.W.: 172.14
  • QC071207
    Carglumic Acid Impurity 7
    CAS# 17027-50-8
    M.F.: C6H8N2O4
    M.W.: 172.14
  • QC071206
    Carglumic Acid Impurity 6
    CAS# 2380660-24-0
    M.F.: C6H8N2O4
    M.W.: 172.14
  • QA032104
    Aclidinium bromide Impurity 4
    CAS# NA
    M.F.: C26H30BrNO4S2
    M.W.: 564.55
  • QP132613
    Promethazine Impurity 13
    CAS# 1207-71-2
    M.F.: C12H9NOS
    M.W.: 215.27
  • QM201244
    Montelukast Impurity 18
    CAS# 1152185-58-4
    M.F.: C35H36ClNO4S
    M.W.: 602.18
  • QA200343
    Atracurium Besylate Impurity 43
    CAS# 91950-41-3
    M.F.: C10H14O3S
    M.W.: 214.28
  • QA040638
    Adefovir Impurity 12
    CAS# NA
    M.F.: C32H52N5O18P
    M.W.: 825.75
  • QM131925
    Mometasone Furoate Impurity 25
    CAS# 134429-33-7
    M.F.: C27H30Cl2O7
    M.W.: 537.43
  • QM131924
    Mometasone Furoate Impurity 24
    CAS# 1404070-67-2
    M.F.: C26H28Cl2O6
    M.W.: 507.40
  • QM131923
    Mometasone Furoate Impurity 23
    CAS# 1370190-55-8
    M.F.: C28H32Cl2O6
    M.W.: 535.46
  • QM131922
    Mometasone Furoate Impurity 22
    CAS# NA
    M.F.: C27H28Cl2O6
    M.W.: 519.41
  • QM131921
    Mometasone Furoate Impurity 21
    CAS# NA
    M.F.: C26H29ClO7
    M.W.: 488.96
  • QM131920
    Mometasone Furoate EP Impurity T
    CAS# NA
    M.F.: C27H29Cl3O6
    M.W.: 555.87
  • QM131918
    Mometasone Furoate EP Impurity R
    CAS# 1370190-08-1
    M.F.: C28H33ClO9S
    M.W.: 581.07
  • QM131917
    Mometasone Furoate EP Impurity Q
    CAS# 83881-08-7
    M.F.: C22H27ClO4
    M.W.: 390.90
  • QM131916
    Mometasone Furoate EP Impurity P
    CAS# NA
    M.F.: C27H31ClO7
    M.W.: 502.98
  • QM131915
    Mometasone Furoate EP Impurity O
    CAS# 24916-91-4
    M.F.: C24H31ClO6
    M.W.: 450.95
  • QM131913
    Mometasone Furoate EP Impurity M
    CAS# 57780-86-6
    M.F.: C22H29ClO4
    M.W.: 392.92
  • QM131910
    Mometasone Furoate EP Impurity J
    CAS# NA
    M.F.: C28H32Cl2O6
    M.W.: 535.46
  • QK161827
    Kyprolis Impurity 27
    CAS# NA
    M.F.: C37H47N3O6
    M.W.: 629.79
  • QA032103
    Aclidinium bromide Impurity 3
    CAS# 320346-75-6
    M.F.: C25H28BrNO4S2
    M.W.: 550.53
  • QA032102
    Aclidinium bromide Impurity 2
    CAS# 1708930-15-7
    M.F.: C16H24BrNO2
    M.W.: 342.27
  • QA032101
    Aclidinium bromide Impurity 1
    CAS# 588-63-6
    M.F.: C9H11BrO
    M.W.: 215.09
  • QA032100
    Aclidinium bromide
    CAS# 320345-99-1
    M.F.: C26H30BrNO4S2
    M.W.: 564.55
  • QL010317
    Memantine Lactose Adduct
    CAS# 1159637-28-1
    M.F.: C24H41NO10
    M.W.: 503.58
  • QC022000
    Cabazitaxel
    CAS# 183133-96-2;1426815-65-7(acetone)
    M.F.: C45H57NO14
    M.W.: 835.93
  • QC071205
    Carglumic Acid Impurity 5
    CAS# 1009553-88-1
    M.F.: C6H8N2O4
    M.W.: 172.14
  • QI091621
    Ipratropium Bromide Impurity 21
    CAS# NA
    M.F.: C19H27NO3
    M.W.: 317.42
  • QV200101
    Vitamin A EP Impurity A
    CAS# NA
    M.F.: C40H60O2/C44H64O4
    M.W.: 572.90/ 656.98
  • QV200103
    Vitamin A EP Impurity C
    CAS# 16729-22-9
    M.F.: C20H30O
    M.W.: 286.45
  • QV200102
    Vitamin A EP Impurity B
    CAS# 144407-18-1
    M.F.: C20H28
    M.W.: 268.44
  • QT182702
    Tramadol EP Impurity B
    CAS# 66170-32-9(HCl salt)
    M.F.: C16H23NO
    M.W.: 245.36
  • QF122414
    Fluoxetine Impurity 14
    CAS# NA
    M.F.: C39H58F3NO5
    M.W.: 677.88
  • QF120312
    Folic Acid EP Impurity H
    CAS# 2366274-27-1
    M.F.: C31H31N9O10
    M.W.: 689.63
  • QF120311
    Folic Acid EP Impurity G
    CAS# 2734707-85-6
    M.F.: C19H19N7O6
    M.W.: 441.40
  • QG121800
    Glycyrrhizic Acid
    CAS# 1405-86-3
    M.F.: C42H62O16
    M.W.: 822.93
  • QC030354
    Cinacalcet Impurity 54
    CAS# 3751-48-2
    M.F.: C10H12O2
    M.W.: 164.20
  • QL091640
    Lipoic Acid Impurity 14
    CAS# NA
    M.F.: C8H14O3S2
    M.W.: 222.32
  • QL091639
    Lipoic Acid Impurity 13
    CAS# 41443-60-1
    M.F.: C8H14Cl2O2
    M.W.: 213.10
  • QT181919
    Torasemide Impurity 19
    CAS# 33263-44-4
    M.F.: C5H3Cl2NO2S
    M.W.: 212.05
  • QC-M011202
    Malic acid;
    Aspartic acid EP Impurity A

    CAS# 6915-15-7;617-48-1
    M.F.: C4H6O5
    M.W.: 134.09
  • QU190421
    Ursodeoxycholic Acid Impurity 21
    CAS# NA
    M.F.: C26H44O4
    M.W.: 420.63
  • QT070501
    Tigecycline EP Impurity A
    CAS# 1422262-97-2
    M.F.: C29H39N5O8
    M.W.: 585.65
  • QL051508
    Calcium Levofolinate EP Impurity H
    CAS# 73951-54-9
    M.F.: C20H23N7O7
    M.W.: 473.44
  • QL051507
    Calcium Levofolinate EP Impurity G;
    Calcium Folinate Hydrate EP Impurity G

    CAS# 4033-27-6
    M.F.: C19H21N7O6
    M.W.: 443.41
  • QL051506
    Calcium Levofolinate EP Impurity F;
    Calcium Folinate Hydrate EP Impurity F

    CAS# 28459-40-7
    M.F.: C20H21N7O7
    M.W.: 471.42
  • QL051504
    Calcium Levofolinate EP Impurity D;
    Calcium Folinate Hydrate EP Impurity D

    CAS# 134-05-4
    M.F.: C20H19N7O7
    M.W.: 469.41
  • QL051503
    Calcium Levofolinate EP Impurity C;
    Calcium Folinate Hydrate EP Impurity C;
    Folic acid

    CAS# 59-30-3
    M.F.: C19H19N7O6
    M.W.: 441.40
  • QL051502
    Calcium Levofolinate EP Impurity B
    CAS# NA
    M.F.: C21H23N7O8
    M.W.: 501.45
  • QL051500
    Calcium Levofolinate
    CAS# 80433-71-2;68538-85-2(free base)
    M.F.: C20H21CaN7O7
    M.W.: 511.50
  • QL051515
    Calcium levofolinate Impurity 15
    CAS# 26560-38-3;134-35-0 (free base)
    M.F.: C20H23CaN7O6
    M.W.: 497.52
  • QE262041
    Ezetimibe Impurity 41
    CAS# 163222-32-0
    M.F.: C31H27F2NO3
    M.W.: 499.55
  • QL051505
    Calcium levofolinate EP Impurity E
    CAS# 944737-05-7
    M.F.: C15H16N6O4
    M.W.: 344.33
  • QF122908
    Fluocinolone acetonide EP Impurity H;
    Triamcinolone acetonide

    CAS# 76-25-5
    M.F.: C24H31FO6
    M.W.: 434.50
  • QL091638
    Lipoic Acid Impurity 12
    CAS# 2114407-78-0
    M.F.: C8H14O3S2
    M.W.: 222.32
  • QL091637
    Lipoic Acid Impurity 11
    CAS# NA
    M.F.: C8H14O3S2
    M.W.: 222.32
  • QL091636
    Lipoic Acid Impurity 10
    CAS# NA
    M.F.: C8H14O3S2
    M.W.: 222.32
  • QL091635
    Lipoic Acid Impurity 9
    CAS# NA
    M.F.: C8H14O3S2
    M.W.: 222.32
  • QV011228
    4-Hydroxy Valproic Acid Sodium Salt
    CAS# 1216888-06-0
    M.F.: C8H15NaO3
    M.W.: 182.19
  • QS210300
    Sucrose
    CAS# 57-50-1
    M.F.: C12H22O11
    M.W.: 342.30
  • QD061807
    Deferasirox Impurity 7
    CAS# 1395346-29-8
    M.F.: C23H17N3O6
    M.W.: 431.40
  • QO132066
    Olmesartan Impurity 66
    CAS# NA
    M.F.: C45H44N6O3
    M.W.: 716.87
  • QT090306
    Thioctic Acid Impurity 6
    CAS# NA
    M.F.: C8H14O2S3
    M.W.: 238.39
  • QT090305
    Thioctic Acid EP Impurity B
    CAS# NA
    M.F.: H2O[C8H14OS2]n
    M.W.: 18.02[190.33]n
  • QW011803
    Warfarin sodium EP Impurity C
    CAS# 1896-62-4
    M.F.: C10H10O
    M.W.: 146.19
  • QW011800
    Warfarin sodium
    CAS# 129-06-6;81-81-2(free base)
    M.F.: C19H15NaO4
    M.W.: 330.31
  • QA180603
    ArforMoterol Tartrate Impurity 3
    CAS# 477552-94-6
    M.F.: C9H11NO3
    M.W.: 181.19
  • QO240110
    Oxacillin sodium monohydrate EP Impurity J;
    Ozolamide of 6-APA dimer

    CAS# NA
    M.F.: C27H31N5O8S2
    M.W.: 617.69
  • QO240109
    Oxacillin sodium monohydrate EP Impurity I
    CAS# NA
    M.F.: C27H29N5O7S2
    M.W.: 599.68
  • QO240107
    Oxacillin sodium monohydrate EP Impurity G
    CAS# NA
    M.F.: C19H18ClN3O5S
    M.W.: 435.88
  • QO240106
    Oxacillin sodium monohydrate EP Impurity F
    CAS# 5053-35-0
    M.F.: C19H19N3O4S2
    M.W.: 417.50
  • QO240105
    Oxacillin sodium monohydrate EP Impurity E;
    Cloxacillin

    CAS# 61-72-3;7081-44-9(Na salt monohydrate)
    M.F.: C19H18ClN3O5S
    M.W.: 435.88
  • QO240103
    Oxacillin sodium monohydrate EP Impurity C
    CAS# 1136-45-4
    M.F.: C11H9NO3
    M.W.: 203.19
  • QF120310
    Folic Acid Impurity 10;
    Calcium levofolinate EP Impurity I

    CAS# 31690-11-6
    M.F.: C20H23N7O6
    M.W.: 457.44
  • QF120309
    Folic Acid EP Impurity G
    CAS# 2734707-85-6
    M.F.: C19H19N7O6
    M.W.: 441.40
  • QF061311
    Fosfomycin Trometamol Impurity 11
    CAS# 26017-03-8
    M.F.: C3H7O4P
    M.W.: 138.06
  • QF061310
    Fosfomycin Trometamol Impurity 10
    CAS# 45629-00-3
    M.F.: C3H7O4P
    M.W.: 138.06
  • QF061304
    Fosfomycin Trometamol EP Impurity D
    CAS# 1262243-12-8
    M.F.: C10H25NO11P2
    M.W.: 397.25
  • QF061303
    Fosfomycin Trometamol EP Impurity C
    CAS# 23001-39-0;114252-50-5(Barium Salt)
    M.F.: C4H12NO6P
    M.W.: 201.11
  • QF061302
    Fosfomycin Trometamol EP Impurity B
    CAS# 1262243-11-7
    M.F.: C7H18NO7P
    M.W.: 259.19
  • QF061301
    Fosfomycin Trometamol EP Impurity A
    CAS# 84954-80-3
    M.F.: C3H9O5P
    M.W.: 156.07
  • QM051500
    Methocarbamol
    CAS# 532-03-6
    M.F.: C11H15NO5
    M.W.: 241.24
  • QD150305
    Docusate sodium Impurity 5
    CAS# NA
    M.F.: C14H25NaO7S
    M.W.: 360.40
  • QD150304
    Docusate sodium Impurity 4
    CAS# NA
    M.F.: C14H25NaO7S
    M.W.: 360.40
  • QD150303
    Docusate sodium Impurity 3
    CAS# 86878-53-7
    M.F.: C12H20Na2O7S
    M.W.: 354.33
  • QD150302
    Docusate sodium Impurity 2
    CAS# 115960-17-3;96954-01-7(2Na salt)
    M.F.: C12H21NaO7S
    M.W.: 332.35
  • QL091634
    Lipoic Acid Impurity 8
    CAS# NA
    M.F.: C20H37NO6S4 C4H11NO3
    M.W.: 515.77 121.14
  • QH251200
    Hyocholic acid
    CAS# 547-75-1
    M.F.: C24H40O5
    M.W.: 408.57
  • QC-S210301
    succinic acid;
    Adipic acid EP Impurity B;
    Aspartic acid EP Impurity E

    CAS# 110-15-6
    M.F.: C4H6O4
    M.W.: 118.09
  • QM160284
    Moxifloxacin Impurity 84
    CAS# NA
    M.F.: C21H24FN3O7
    M.W.: 449.43
  • QC-P160500
    Pteroic acid
    CAS# 119-24-4
    M.F.: C14H12N6O3
    M.W.: 312.28
  • QT031853
    α-Tocopherol;
    all-rac-α-Tocopherol

    CAS# 10191-41-0
    M.F.: C29H50O2
    M.W.: 430.71
  • QP082500
    Vitamin K1 (Phytonadione)
    CAS# 84-80-0
    M.F.: C31H46O2
    M.W.: 450.70
  • QT131204
    Timolol Maleate EP Impurity D
    CAS# 30165-97-0
    M.F.: C6H9N3O2S
    M.W.: 187.22
  • QF120308
    10-Formyl-7,8-dihydro Folic Acid Disodium Salt
    CAS# 28459-40-7(free base)
    M.F.: C20H19N7Na2O7
    M.W.: 515.39
  • QF120307
    Folic Acid Impurity 7
    CAS# NA
    M.F.: C31H31N9O10
    M.W.: 689.63
  • QC-A180701
    L-Arginine; Lysine acetate EP Impurity F
    CAS# 74-79-3;1119-34-2(HCl salt)
    M.F.: C6H14N4O2
    M.W.: 174.20
  • QE201208
    Estriol EP Impurity H;
    16alpha-Hydroxyestrone

    CAS# 566-76-7
    M.F.: C18H22O3
    M.W.: 286.37
  • QL091633
    Lipoic Acid Impurity 7
    CAS# NA
    M.F.: C16H28O6S4
    M.W.: 444.65
  • QV011201
    Valproic Acid Ethyl Ester
    CAS# 17022-31-0
    M.F.: C10H20O2
    M.W.: 172.26
  • QD032012
    Docetaxel Impurity 12
    CAS# 151636-78-1
    M.F.: C49H55Cl6NO18
    M.W.: 1158.67
  • QT142409
    Tranexamic Acid Impurity 9
    CAS# 70795-45-8
    M.F.: C8H18N2
    M.W.: 142.24
  • QT142408
    Tranexamic Acid Impurity 8
    CAS# NA
    M.F.: C9H17NO2
    M.W.: 171.24
  • QT142407
    Tranexamic Acid EP Impurity E
    CAS# 82755-59-7
    M.F.: C16H28N2O3
    M.W.: 296.41
  • QT142406
    Tranexamic Acid Impurity 6
    CAS# 13064-83-0
    M.F.: C8H14O2
    M.W.: 142.20
  • QC-A080301
    D-Glucose;Trehalose dihydrate EP Impurity A
    CAS# 50-99-7;77938-63-7(monohydrate)
    M.F.: C6H12O6
    M.W.: 180.16
  • QP050400
    Peonidin Chloride
    CAS# 134-01-0
    M.F.: C16H13ClO6
    M.W.: 336.72
  • QI020101
    Ibandronic acid Impurity 1
    CAS# 128202-57-3(free base)
    M.F.: C4H12NNaO7P2
    M.W.: 271.08
  • QT090304
    (R)-alpha-Thioctic Acid
    CAS# 1200-22-2
    M.F.: C8H14O2S2
    M.W.: 206.33
  • QM050605
    Mefenamic Acid EP Impurity E
    CAS# 4869-11-8
    M.F.: C14H15N
    M.W.: 197.28
  • QM050602
    Mefenamic Acid EP Impurity B
    CAS# 21122-68-9
    M.F.: C23H24N2O
    M.W.: 344.45
  • QM050601
    Mefenamic Acid EP Impurity A
    CAS# 87-59-2
    M.F.: C8H11N
    M.W.: 121.18
  • QM050600
    Mefenamic Acid
    CAS# 61-68-7
    M.F.: C15H15NO2
    M.W.: 241.29
  • QF211900
    Fusidic Acid
    CAS# 6990-06-3
    M.F.: C31H48O6
    M.W.: 516.71
  • QD190640
    Doxofylline Impurity 14
    CAS# NA
    M.F.: C13H20N4O6
    M.W.: 328.32
  • QM011412
    Mandelic acid 12
    CAS# 51019-43-3
    M.F.: C10H10O4
    M.W.: 194.18
  • QM011411
    Mandelic acid 11
    CAS# 29169-64-0
    M.F.: C9H7ClO3
    M.W.: 198.60
  • QM011410
    Mandelic acid 10
    CAS# 29169-63-9
    M.F.: C9H8O4
    M.W.: 180.16
  • QP011406
    DL-Pantothenic acid calcium salt
    CAS# 6381-63-1
    M.F.: C18H32CaN2O10
    M.W.: 476.53
  • QC-D091307
    Calcium Pantothenate EP Impurity B;
    Dexpanthenol EP Impurity B;
    Pantoic acid

    CAS# 1112-33-0;60979-68-2(Na salt)
    M.F.: C6H12O4
    M.W.: 148.16
  • QP051401
    Pentaerythritol tetrakis(3-(3,5-di-tert-butyl-4-hydroxyphenyl)propionate)
    CAS# 6683-19-8
    M.F.: C73H108O12
    M.W.: 1177.63
  • QE120100
    Elagolix Sodium
    CAS# 832720-36-2
    M.F.: C32H29F5N3NaO5
    M.W.: 653.57
  • QZ151200
    Zoledronic acid hydrate
    CAS# 165800-06-6;118072-93-8(free base)
    M.F.: C5H12N2O8P2
    M.W.: 290.10
  • QS151800
    Sorbitan Monolaurate
    CAS# 1338-39-2
    M.F.: C18H34O6
    M.W.: 346.46
  • QF161401
    Hydroxy-Fipronil
    CAS#  NA
    M.F.: C11H5Cl2F3N4O
    M.W.: 337.08
  • QA161907
    Acetylsalicylic Acid Impurity 7
    CAS# 2708578-72-5
    M.F.: C16H12O6
    M.W.: 300.26
  • QC551804
    Clenbuterol EP Impurity D
    CAS# 99-92-3
    M.F.: C8H9NO
    M.W.: 135.16
  • QC062804
    Cefetamet Pivoxyl Impurity 4
    CAS# NA
    M.F.: C41H50N10O14S4
    M.W.: 1035.15
  • QC062803
    Cefetamet Pivoxyl Impurity 3
    CAS# NA
    M.F.: C25H33N5O8S2
    M.W.: 595.69
  • QC062802
    Cefetamet Pivoxyl Impurity 2
    CAS# NA
    M.F.: C20H25N5O7S2
    M.W.: 511.57
  • QC062801
    Cefetamet Pivoxyl Impurity 1
    CAS# NA
    M.F.: C21H27N5O8S2
    M.W.: 541.60
  • QF121200
    Flucloxacillin sodium
    CAS# 1847-24-1
    M.F.: C19H16ClFN3NaO5S
    M.W.: 475.85
  • QF121205
    Flucloxacillin sodium EP Impurity E
    CAS# NA
    M.F.: C27H27ClFN5O7S2
    M.W.: 652.11
  • QF121204
    Flucloxacillin sodium EP Impurity D
    CAS# 3919-74-2
    M.F.: C11H7ClFNO3
    M.W.: 255.63
  • QF121202
    Flucloxacillin sodium EP Impurity B
    CAS# NA
    M.F.: C18H19ClFN3O4S
    M.W.: 427.88
  • QF121201
    Flucloxacillin sodium EP Impurity A
    CAS# 68728-50-7(2Na salt)
    M.F.: C19H19ClFN3O6S
    M.W.: 471.89
  • QT150900
    Tropicamide
    CAS# 1508-75-4
    M.F.: C17H20N2O2
    M.W.: 284.35
  • QA201500
    Atovaquone
    CAS# 95233-18-4
    M.F.: C22H19ClO3
    M.W.: 366.84
  • QE161236
    Epalrestat Impurity 10
    CAS# NA
    M.F.: C17H17NO3S2
    M.W.: 347.45
  • QC071200
    Carglumic Acid
    CAS# 1188-38-1
    M.F.: C6H10N2O5
    M.W.: 190.15
  • QT140405
    Tinidazole Impurity 5
    CAS# 110-77-0
    M.F.: C4H10OS
    M.W.: 106.19
  • QF211904
    Fusidic Acid EP Impurity D;
    Sodium Fusidate EP Impurity D

    CAS# NA
    M.F.: C31H48O7
    M.W.: 532.71
  • QF211903
    Fusidic Acid EP Impurity C;
    Sodium Fusidate EP Impurity C

    CAS# NA
    M.F.: C31H48O7
    M.W.: 532.71
  • QF211902
    Fusidic Acid EP Impurity B;
    Sodium Fusidate EP Impurity B

    CAS# NA
    M.F.: C31H48O7
    M.W.: 532.71
  • QF211906
    Fusidic Acid EP Impurity F;
    Sodium Fusidate EP Impurity F

    CAS# 1415035-94-7
    M.F.: C31H46O7
    M.W.: 530.69
  • QF211905
    Fusidic Acid EP Impurity E;
    Sodium Fusidate EP Impurity E

    CAS# NA
    M.F.: C31H48O7
    M.W.: 532.71
  • QF211901
    Fusidic Acid EP Impurity A;
    Sodium Fusidate EP Impurity A

    CAS# 80445-74-5
    M.F.: C31H50O8
    M.W.: 550.72
  • QF211911
    Fusidic Acid EP Impurity K;
    Sodium Fusidate EP Impurity K

    CAS# 4701-54-6
    M.F.: C29H44O4
    M.W.: 456.66
  • QF211910
    Fusidic Acid EP Impurity J;
    Sodium Fusidate EP Impurity J

    CAS# 13011-12-6
    M.F.: C29H44O4
    M.W.: 456.66
  • QF211915
    Fusidic Acid EP Impurity O;
    Sodium Fusidate EP Impurity O

    CAS# 55601-53-1(Na salt)
    M.F.: C29H46O5
    M.W.: 474.67
  • QF211913
    Fusidic Acid EP Impurity M;
    Sodium Fusidate EP Impurity M

    CAS# 1013937-16-0
    M.F.: C31H48O5
    M.W.: 500.71
  • QF211912
    Fusidic Acid EP Impurity L;
    Sodium Fusidate EP Impurity L

    CAS# 74048-41-2
    M.F.: C31H46O5
    M.W.: 498.69
  • QF211909
    Fusidic Acid EP Impurity I;
    Sodium Fusidate EP Impurity I;
    16-epi-Deacetylfusidic acid

    CAS# 5951-83-7
    M.F.: C29H46O5
    M.W.: 474.67
  • QF211908
    Fusidic Acid EP Impurity H;
    Sodium Fusidate EP Impurity H

    CAS# 16711-91-4
    M.F.: C31H46O6
    M.W.: 514.69
  • QF211907
    Fusidic Acid EP Impurity G;
    Sodium Fusidate EP Impurity G

    CAS# 4680-37-9
    M.F.: C31H46O6
    M.W.: 514.69
  • QE182012
    Erythromycin EP Impurity L;
    3″-N-demethyl-3″-N-formyl Erythromycin A

    CAS# 127955-44-6
    M.F.: C37H65NO14
    M.W.: 747.91
  • QS075425
    Mono-ethyl-ester-Sugammadex
    CAS# NA
    M.F.: C74H109Na7O48S8
    M.W.: 2184.08
  • QL091632
    Lipoic Acid Impurity 6
    CAS# NA
    M.F.: C8H14O4S2
    M.W.: 238.32
  • QE202512
    Estradiol Hemihydrate EP Impurity B;
    Ethinylestradiol EP Impurity L;
    Estriol EP Impurity J

    CAS# 57-91-0
    M.F.: C18H24O2
    M.W.: 272.38
  • QD090530
    Dienogest 17-Epi Impurity
    CAS# NA
    M.F.: C20H25NO2
    M.W.: 311.42
  • QA221805
    Alverine Citrate EP Impurity E
    CAS# 408309-07-9;878784-75-9(HCl salt)
    M.F.: C27H33N
    M.W.: 371.56
  • QA221804
    Alverine Citrate EP Impurity D
    CAS# 2732347-30-5
    M.F.: C20H33N
    M.W.: 287.48
  • QA221803
    Alverine Citrate EP Impurity C
    CAS# 13125-62-7;13125-63-8(HCl salt)
    M.F.: C11H17N
    M.W.: 163.26
  • QA221802
    Alverine Citrate EP Impurity B
    CAS# 122-97-4
    M.F.: C9H12O
    M.W.: 136.19
  • QA221801
    Alverine Citrate EP Impurity A
    CAS# 104-52-9
    M.F.: C9H11Cl
    M.W.: 154.64
  • QA190208
    Ascorbic Acid EP Impurity H;
    Sodium Ascorbate EP Impurity H

    CAS# 122046-79-1
    M.F.: C7H8O7
    M.W.: 204.13
  • QA190207
    Ascorbic Acid EP Impurity G;
    Sodium Ascorbate EP Impurity G

    CAS# 66757-69-5
    M.F.: C6H6O7
    M.W.: 190.11
  • QA190204
    Ascorbic Acid EP Impurity D;
    Sodium Ascorbate EP Impurity D

    CAS# 3031-98-9
    M.F.: C7H12O7
    M.W.: 208.17
  • QA190203
    Ascorbic Acid EP Impurity C;
    Sodium Ascorbate EP Impurity C

    CAS# 526-98-7;342385-52-8(Hydrate)
    M.F.: C6H10O7
    M.W.: 194.14
  • QA190200
    Ascorbic Acid
    CAS# 50-81-7
    M.F.: C6H8O6
    M.W.: 176.12
  • QA161900
    Acetylsalicylic Acid
    CAS# 50-78-2
    M.F.: C9H8O4
    M.W.: 180.16
  • QB200108
    Betamethasone Dipropionate EP Impurity H
    CAS# 2575516-37-7
    M.F.: C28H36BrFO7
    M.W.: 583.48
  • QB200107
    Betamethasone Dipropionate EP Impurity G
    CAS# 1186048-33-8
    M.F.: C31H41FO8
    M.W.: 560.65
  • QB200106
    Betamethasone Dipropionate EP Impurity F;
    Beclometasone Dipropionate EP Impurity J

    CAS# 66917-44-0
    M.F.: C28H36O7
    M.W.: 484.58
  • QB200105
    Betamethasone Dipropionate EP Impurity E;
    Beclometasone Dipropionate

    CAS# 5534-09-8
    M.F.: C28H37ClO7
    M.W.: 521.04
  • QB200104
    Betamethasone Dipropionate EP Impurity D
    CAS#  5514-81-8
    M.F.: C27H35FO7
    M.W.: 490.56
  • QB200103
    Betamethasone Dipropionate EP Impurity C;
    Clobetasol Propionate EP Impurity K;
    Betamethasone 21-propionate

    CAS# 75883-07-7
    M.F.: C25H33FO6
    M.W.: 448.52
  • QB200101
    Betamethasone Dipropionate EP Impurity A;
    Dexamethasone EP Impurity B;
    Betamethasone Acetate EP Impurity A;
    Betamethasone valerate EP Impurity A;
    Betamethasone

    CAS# 378-44-9
    M.F.: C22H29FO5
    M.W.: 392.46
  • QI121604
    Iloperidone Impurity 4
    CAS# NA
    M.F.: C12H14Cl2FNO
    M.W.: 278.15
  • QS160904
    Spironolactone EP Impurity D
    CAS# NA
    M.F.: C24H32O4S2
    M.W.: 448.64
  • QT120842
    Trelagliptin Impurity 16
    CAS# 1485536-93-3
    M.F.: C8H4Br2FN
    M.W.: 292.93
  • QG031906
    Glucosamine Impurity 6; Ascorbic Acid EP
    Impurity A;Sodium Ascorbate EP Impurity A

    CAS# 98-01-1
    M.F.: C5H4O2
    M.W.: 96.08
  • QR182424
    Brexpiprazole Impurity 24
    CAS# 98327-87-8
    M.F.: C44H32P2
    M.W.: 622.67
  • QC015905
    Cladribine EP Impurity E
    CAS# 1831121-84-6
    M.F.: C5H10O4
    M.W.: 134.13
  • QL131101
    Malic Acid Impurity 1
    CAS# 1800467-68-8
    M.F.: C8H10O9
    M.W.: 250.16
  • QF121403
    Flunarizine EP Impurity C
    CAS# 90830-31-2 
    M.F.: C26H26F2N2
    M.W.: 404.49
  • QP011405
    Calcium Pantothenate EP Impurity H
    CAS# NA
    M.F.: C10H17NO5
    M.W.: 231.25
  • QP011404
    Calcium Pantothenate EP Impurity G
    CAS# 2140-53-6
    M.F.: C6H12N2O3
    M.W.: 160.17
  • QP011403
    Calcium Pantothenate EP Impurity F
    CAS# 505-47-5
    M.F.: C6H11NO4
    M.W.: 161.16
  • QP011402
    Calcium Pantothenate EP Impurity E
    CAS# 897045-90-8
    M.F.: C12H22N2O6
    M.W.: 290.31
  • QP011401
    Calcium Pantothenate EP Impurity D;
    Methyl Pantothenate

    CAS# 50692-78-9
    M.F.: C10H19NO5
    M.W.: 233.26
  • QA181625
    Aripiprazole Impurity 25
    CAS# 710339-49-4
    M.F.: C12H16BrNO
    M.W.: 270.17
  • QT181501
    Controlled Substance
    (Trospium EP Impurity A)

    CAS# 76-93-7
    M.F.: C14H12O3
    M.W.: 228.24
  • QC-E200808
    ethyl 4-hydroxybenzoate;
    Propyl Parahydroxybenzoate EP Impurity C;
    Butyl parahydroxybenzoate EP Impurity C

    CAS# 120-47-8
    M.F.: C9H10O3
    M.W.: 166.17
  • QC-M052004
    methyl 4-hydroxybenzoate;
    Propyl Parahydroxybenzoate EP Impurity B;
    Nifuroxazide EP Impurity B;
    Sodium ethyl parahydroxybenzoate EP Impurity B;
    Butyl parahydroxybenzoate EP Impurity B

    CAS# 99-76-3
    M.F.: C8H8O3
    M.W.: 152.15
  • QE191307
    Esmolol Isopropyl Amide Analog HCl
    CAS# NA
    M.F.: C18H28N2O3.HCl
    M.W.: 320.43 36.46
  • QE191306
    N-Ethyl Esmolol HCl
    CAS# 2469273-97-8(free base)
    M.F.: C15H23NO4.HCl
    M.W.: 281.35 36.46
  • QE191305
    Esmolol Acid HCl
    CAS# 83356-60-9
    M.F.: C15H23NO4.HCl
    M.W.: 281.35 36.46
  • QF121902
    Fulvestrant Impurity 2
    CAS# NA
    M.F.: C32H47F5O2S
    M.W.: 590.77
  • QT081811
    N-Carbobenzoxy-D-threonine
    CAS# 80384-27-6
    M.F.: C12H15NO5
    M.W.: 253.25
  • QF191413
    Fosinopril EP Impurity N
    CAS# NA
    M.F.: C41H63N2O8P
    M.W.: 742.92
  • QF191410
    Fosinopril EP Impurity B
    CAS# NA
    M.F.: C30H46NO7P
    M.W.: 563.66
  • QF191409
    Fosinopril EP Impurity H
    CAS# NA
    M.F.: C30H46NO7P
    M.W.: 563.66
  • QA220327
    Avibactam Impurity 1
    CAS# 2306254-34-0;2413365-40-7(oxalate salt)
    M.F.: C15H22N2O3
    M.W.: 278.35
  • QH151600
    Homopiperazine
    CAS# 505-66-8
    M.F.: C5H12N2
    M.W.: 100.16
  • QF120306
    Folic Acid EP Impurity F
    CAS# 1391194-56-1
    M.F.: C7H6ClN5O
    M.W.: 211.61
  • QF120302
    Folic Acid EP Impurity B
    CAS# 1004-75-7;35011-47-3(H2SO4 salt)
    M.F.: C4H7N5O
    M.W.: 141.13
  • QP251800
    Pyrazolam
    CAS# 39243-02-2
    M.F.: C16H12BrN5
    M.W.: 354.20
  • QF141929
    Finasteride Impurity 3
    CAS# 140375-22-0
    M.F.: C23H36N2O2
    M.W.: 372.54
  • QC242015
    Cefoxitin Impurity 15
    CAS# NA
    M.F.: C16H16N3NaO8S2
    M.W.: 465.43
  • QD090508
    Dienogest EP Impurity H
    CAS# 16669-06-0
    M.F.: C20H25NO2
    M.W.: 311.42
  • QD090505
    Dienogest EP Impurity E
    CAS# 102193-41-9
    M.F.: C22H31NO3
    M.W.: 357.49
  • QD090504
    Dienogest EP Impurity D
    CAS# 190662-30-7
    M.F.: C22H29NO3
    M.W.: 355.47
  • QD090503
    Dienogest EP Impurity C
    CAS# 106111-42-6
    M.F.: C20H25NO2
    M.W.: 311.42
  • QI151612
    Iopamidol EPImpurity F
    CAS# 1869069-71-5
    M.F.: C16H20I3N3O6
    M.W.: 731.06
  • QI151601
    Iopamidol EP Impurity A
    CAS# 60166-98-5
    M.F.: C14H18I3N3O6
    M.W.: 705.02
  • QK201820
    Ketorolac EP Impurity H
    CAS# 80965-09-9
    M.F.: C16H15NO3
    M.W.: 269.30
  • QL141249
    Lenalidomide Impurity 49
    CAS# 827026-44-8
    M.F.: C13H14N4O5
    M.W.: 306.27
  • QN032011
    Nicotinic acid Impurity 11
    CAS# 33545-23-2
    M.F.: C9H11NO2
    M.W.: 165.19
  • QL130601
    Lamivudine EP Impurity A
    CAS# NA
    M.F.: C8H9N3O4S
    M.W.: 243.24
  • QM202413
    Methotrexate EP Impurity K;
    Folic Acid EP Impurity A;
    Calcium Levofolinate EP Impurity A;
    Calcium Folinate Hydrate EP Impurity A

    CAS# 4271-30-1
    M.F.: C12H14N2O5
    M.W.: 266.25
  • QM202410
    Methotrexate
    CAS# 59-05-2;133073-73-1(xH2O)
    M.F.: C20H22N8O5
    M.W.: 454.44
  • QN032010
    Nicotinic acid Impurity 10
    CAS# 13362-26-0
    M.F.: C8H10N2O2
    M.W.: 166.18
  • QN032009
    Nicotinic acid EP Impurity I
    CAS# 940-06-7
    M.F.: C5H3N3O4
    M.W.: 169.10
  • QN032008
    Nicotinic acid EP Impurity H
    CAS# 2530-26-9
    M.F.: C5H4N2O2
    M.W.: 124.10
  • QN032006
    Nicotinic acid EP Impurity F
    CAS# 2047-49-6
    M.F.: C6H4N2O4
    M.W.: 168.11
  • QN032004
    Nicotinic acid EP Impurity D
    CAS# 100-26-5
    M.F.: C7H5NO4
    M.W.: 167.12
  • QN032003
    Nicotinic acid EP Impurity C
    CAS# 104-90-5;2024-89-7(HCl salt)
    M.F.: C8H11N
    M.W.: 121.18
  • QN032002
    Nicotinic acid EP Impurity B
    CAS# 1802-30-8
    M.F.: C12H8N2O4
    M.W.: 244.20
  • QN032001
    Nicotinic acid EP Impurity A
    CAS# 3222-47-7
    M.F.: C7H7NO2
    M.W.: 137.14
  • QL091631
    Lipoic Acid Impurity 5
    CAS# 17370-41-1
    M.F.: C8H14O4S2
    M.W.: 238.32
  • QP141200
    Phenylephrine
    CAS# 59-42-7;61-76-7(HCl salt)
    M.F.: C9H13NO2
    M.W.: 167.21
  • QT161835
    Topiroxostat Impurity 9
    CAS# 2044708-04-3
    M.F.: C7H10N6O
    M.W.: 194.19
  • QR131617
    Ramipril EP Impurity N
    CAS# 129939-63-5
    M.F.: C23H32N2O5
    M.W.: 416.51
  • QS210209
    Sulbactam Impurity 9;Penicillanic acid
    CAS# 87-53-6
    M.F.: C8H11NO3S
    M.W.: 201.24
  • QS061900
    Sulfasalazine
    CAS# 599-79-1
    M.F.: C18H14N4O5S
    M.W.: 398.39
  • QD030422
    Diclofenac Impurity V
    CAS# NA
    M.F.: C26H35Cl2NO2
    M.W.: 464.47
  • QG121501
    Glycocholic Acid
    CAS# 475-31-0;863-57-0(Na salt);
    338950-81-5(xH2O Na salt)
    M.F.: C26H43NO6
    M.W.: 465.62
  • QS122501
    Silybin A
    CAS# 22888-70-6
    M.F.: C25H22O10
    M.W.: 482.44
  • QC120210
    Clobetasol Propionate EP Impurity J
    CAS# 1486466-31-2
    M.F.: C25H30ClFO4
    M.W.: 448.95
  • QC120206
    Clobetasol Propionate EP Impurity F
    CAS# 2412496-00-3
    M.F.: C22H27FO4
    M.W.: 374.45
  • QC120205
    Clobetasol Propionate EP Impurity E
    CAS# NA
    M.F.: C25H33ClO4
    M.W.: 432.98
  • QC120204
    Clobetasol Propionate EP Impurity D
    CAS# 25120-99-4 
    M.F.: C25H34ClFO5
    M.W.: 468.99
  • QC120203
    Clobetasol Propionate EP Impurity C
    CAS# 25122-52-5
    M.F.: C25H32ClFO5
    M.W.: 466.97
  • QC120202
    Clobetasol Propionate EP Impurity B
    CAS# 1356190-17-4
    M.F.: C22H26ClFO3
    M.W.: 392.89
  • QC120209
    Clobetasol Propionate EP Impurity I
    CAS# 15423-80-0
    M.F.: C26H35FO8S
    M.W.: 526.61
  • QC120208
    Clobetasol Propionate EP Impurity H
    CAS# 4351-48-8
    M.F.: C25H33FO5
    M.W.: 432.52
  • QC120201
    Clobetasol Propionate EP Impurity A;
    Betamethasone 17-propionate

    CAS# 5534-13-4
    M.F.: C25H33FO6
    M.W.: 448.52
  • QC120200
    Clobetasol Propionate
    CAS# 25122-46-7
    M.F.: C25H32ClFO5
    M.W.: 466.97
  • QC221213
    Clavulanate Potassium EP Impurity M
    CAS# 3033-62-3
    M.F.: C8H20N2O
    M.W.: 160.26
  • QC221212
    Clavulanate Potassium EP Impurity L
    CAS# 4013-94-9
    M.F.: C8H20N2
    M.W.: 144.26
  • QC221211
    Clavulanate Potassium EP Impurity K
    CAS# 107-45-9
    M.F.: C8H19N
    M.W.: 129.24
  • QC221215
    Clavulanate Potassium EP Impurity J
    CAS# 110-18-9;7677-21-6(2HCl salt)
    M.F.: C6H16N2
    M.W.: 116.20
  • QC221208
    Clavulanate Potassium EP Impurity H
    CAS# 75-64-9
    M.F.: C4H11N
    M.W.: 73.14
  • QU190400
    Ursodeoxycholic Acid;Chenodeoxycholic acid EP Impurity A
    CAS# 128-13-2
    M.F.: C24H40O4
    M.W.: 392.57
  • QH120311
    Halcinonide Impurity K
    CAS# NA
    M.F.: C21H28ClFO5
    M.W.: 414.90
  • QI221205
    Isoniazid Impurity E
    CAS# 31599-25-4
    M.F.: C12H10N6
    M.W.: 238.25
  • QI221204
    Isoniazid Impurity D
    CAS# 4329-75-3
    M.F.: C12H10N4O2
    M.W.: 242.23
  • QI221202
    Isoniazid EP Impurity D
    CAS# 553-53-7
    M.F.: C6H7N3O
    M.W.: 137.14
  • QR022221
    Ribavirin Impurity U;Ascorbic Acid EP Impurity E;Sodium Ascorbate EP Impurity E;Oxaliplatin EP Impurity A
    CAS# 144-62-7
    M.F.: C2H2O4
    M.W.: 90.03
  • QV011227
    Valproic Acid Impurity 1
    CAS# 624-24-8
    M.F.: C6H12O2
    M.W.: 116.16
  • QV011200
    Valproic Acid;
    Sodium caprylate EP Impurity E;
    Caprylic acid EP Impurity E

    CAS# 99-66-1
    M.F.: C8H16O2
    M.W.: 144.21
  • QN201800
    Nitrogen Mustard
    CAS# 55-86-7
    M.F.: C5H12Cl3N
    M.W.: 192.51
  • QE122031
    Erlotinib Impurity 5
    CAS# NA
    M.F.: C22H23N3O5
    M.W.: 409.44
  • QE122030
    Erlotinib Impurity 4
    CAS# NA
    M.F.: C22H25N3O6
    M.W.: 427.45
  • QA132006
    Amantadine EP Impurity B
    CAS# NA
    M.F.: C12H19NO
    M.W.: 193.29
  • QA132005
    Amantadine EP Impurity A
    CAS# 935-56-8
    M.F.: C10H15Cl
    M.W.: 170.68
  • QC062727
    Cefazolin Impurity 1
    CAS# 2416213-67-5
    M.F.: C18H20N4O8S2
    M.W.: 484.50
  • QP201642
    Pantoprazole Impurity 16
    CAS# 72830-08-1
    M.F.: C8H11NO3
    M.W.: 169.18
  • QT140695
    Tenofovir Impurity 95
    CAS# 108-23-6
    M.F.: C4H7ClO2
    M.W.: 122.55
  • QT140694
    Tenofovir Impurity 94
    CAS# 133217-92-2
    M.F.: C6H12ClNO2
    M.W.: 165.62
  • QT140692
    Tenofovir Impurity 92
    CAS# NA
    M.F.: C5H8Cl2O3
    M.W.: 187.02
  • QT140669
    Tenofovir Impurity 69
    CAS# 6482-34-4
    M.F.: C7H14O3
    M.W.: 146.18
  • QT140668
    Tenofovir Impurity 68
    CAS# 35273-90-6
    M.F.: C5H9ClO3
    M.W.: 152.58
  • QT140667
    Tenofovir Impurity 67
    CAS# 35179-98-7
    M.F.: C4H7ClO3
    M.W.: 138.55
  • QT140662
    Tenofovir Impurity 62
    CAS# 3084-40-0
    M.F.: C5H13O4P
    M.W.: 168.13
  • QT140661
    Tenofovir Impurity 61
    CAS# 762-04-9
    M.F.: C4H11O3P
    M.W.: 138.10
  • QT140609
    Tenofovir Impurity H
    CAS# NA
    M.F.: C11H17N5O2
    M.W.: 251.28
  • QE131610
    Empagliflozin Impurity J
    CAS# NA
    M.F.: C18H17ClO4
    M.W.: 332.78
  • QP020338
    Palbociclib Impurity 12
    CAS# NA
    M.F.: C44H52Br2N14O2
    M.W.: 968.78
  • QP020337
    Palbociclib Impurity 11
    CAS# NA
    M.F.: C13H14BrN3O2
    M.W.: 324.17
  • QP020336
    Palbociclib Impurity 10
    CAS# 851067-56-6;850918-83-1(HCl salt)
    M.F.: C22H26BrN7O
    M.W.: 484.39
  • QP020334
    Palbociclib Impurity 8
    CAS# 2172256-78-7
    M.F.: C15H17N3O3
    M.W.: 287.31
  • QP020333
    Palbociclib Impurity 7
    CAS# NA
    M.F.: C13H13Br2N3O
    M.W.: 387.07
  • QP020332
    Palbociclib Impurity 6
    CAS# 1244949-62-9
    M.F.: C11H14ClN3O
    M.W.: 239.70
  • QG210101
    Guanfacine Impurity A
    CAS# NA
    M.F.: C17H13Cl4N3O2
    M.W.: 433.12
  • QR010310
    Racecadotril Impurity J;
    Benzalkonium chloride EP Impurity C

    CAS# 100-44-7
    M.F.: C7H7Cl
    M.W.: 126.58
  • QA070208
    Argatroban Impurity H
    CAS# NA
    M.F.: C23H36N6O5S
    M.W.: 508.63
  • QA070206
    Argatroban Impurity F
    CAS# 74874-09-2
    M.F.: C25H35N7O7S
    M.W.: 577.65
  • QO022018
    Obeticholic Acid Impurity R
    CAS# 10538-59-7
    M.F.: C25H40O4
    M.W.: 404.58
  • QO022017
    Obeticholic Acid Impurity Q
    CAS# NA
    M.F.: C24H38O4
    M.W.: 390.56
  • QB161617
    Bupropion Impurity Q
    CAS# 119802-69-6
    M.F.: C9H10ClNO
    M.W.: 183.63
  • QF022461
    Febuxostat Impurity 35
    CAS# NA
    M.F.: C15H18N2O2S
    M.W.: 290.38
  • QF022459
    Febuxostat Impurity 33
    CAS# NA
    M.F.: C17H18N2O3S
    M.W.: 330.40
  • QF022458
    Febuxostat Impurity 32
    CAS# 2418591-43-0
    M.F.: C16H16N2O3S
    M.W.: 316.37
  • QF022457
    Febuxostat Impurity 31
    CAS# NA
    M.F.: C18H20N2O3S
    M.W.: 344.43
  • QF022456
    Febuxostat Impurity 30
    CAS# NA
    M.F.: C18H20N2O3S
    M.W.: 344.43
  • QF022454
    Febuxostat Impurity 28
    CAS# NA
    M.F.: C15H17NO2S
    M.W.: 275.37
  • QF022453
    Febuxostat Impurity 27
    CAS# NA
    M.F.: C15H18N2O2S
    M.W.: 290.38
  • QF022450
    Febuxostat Impurity 24
    CAS# 1350352-70-3
    M.F.: C16H18N2O4S
    M.W.: 334.39
  • QC201819
    Cetirizine Impurity 19
    CAS# 1016-78-0
    M.F.: C13H9ClO
    M.W.: 216.66
  • QC132401
    Cefmenoxime Impurity 1
    CAS# 84994-24-1
    M.F.: C13H10N4O3S2
    M.W.: 334.37
  • QO022014
    Obeticholic Acid Impurity N
    CAS# NA
    M.F.: C26H44O4
    M.W.: 420.63
  • QO022013
    Obeticholic Acid Impurity M
    CAS# NA
    M.F.: C24H40O4
    M.W.: 392.57
  • QO022012
    Obeticholic Acid Impurity L
    CAS# NA
    M.F.: C26H44O4
    M.W.: 420.63
  • QO022011
    Obeticholic Acid Impurity K
    CAS# NA
    M.F.: C26H44O4
    M.W.: 420.63
  • QO022010
    Obeticholic Acid Impurity J
    CAS# NA
    M.F.: C26H42O4
    M.W.: 418.61
  • QO022009
    Obeticholic Acid Impurity I
    CAS# 915038-26-5
    M.F.: C26H42O4
    M.W.: 418.61
  • QO022008
    Obeticholic Acid Impurity H
    CAS# NA
    M.F.: C26H40O4
    M.W.: 416.59
  • QC061714
    Cefoperazone Impurity N
    CAS# NA
    M.F.: C23H25N5O8S2
    M.W.: 563.60
  • QC061711
    Cefoperazone Impurity K
    CAS# NA
    M.F.: C25H29N9O9S2
    M.W.: 663.68
  • QC061710
    Cefoperazone Impurity J
    CAS# 24209-38-9
    M.F.: C10H12N6O3S2
    M.W.: 328.37
  • QC061709
    Cefoperazone Impurity I
    CAS# NA
    M.F.: C23H25N5O9S
    M.W.: 547.54
  • QC140600
    Coniferyl ferulate
    CAS# 63644-62-2
    M.F.: C20H20O6
    M.W.: 356.37
  • QP020331
    Palbociclib Impurity 5
    CAS# 1082876-26-3
    M.F.: C9H14N4
    M.W.: 178.23
  • QG140905
    Ganciclovir EP Impurity E
    CAS# 86357-09-7
    M.F.: C9H13N5O4
    M.W.: 255.23
  • QG140904
    Ganciclovir EP Impurity D
    CAS# 1346598-14-8
    M.F.: C10H15N5O5
    M.W.: 285.26
  • QG140903
    Ganciclovir EP Impurity C;
    Valganciclovir EP Impurity I

    CAS# 108436-36-8
    M.F.: C9H12ClN5O3
    M.W.: 273.68
  • QG140902
    Ganciclovir EP Impurity B;
    Valganciclovir EP Impurity J

    CAS# 194159-18-7
    M.F.: C12H17N5O5
    M.W.: 311.29
  • QG140901
    Ganciclovir EP Impurity A
    CAS# 1797982-93-4
    M.F.: C9H10ClN5O2
    M.W.: 255.66
  • QL191631
    Lansoprazole Impurity 5
    CAS# 103577-61-3
    M.F.: C9H10F3NO2
    M.W.: 221.18
  • QD240907
    Dexmedetomidine Impurity 7
    CAS# 2240179-65-9
    M.F.: C23H28N2
    M.W.: 332.48
  • QD240906
    Controlled Substance
    (Dexmedetomidine Impurity 6)

    CAS# 60907-90-6
    M.F.: C10H14O
    M.W.: 150.22
  • QL221518
    Levonorgestrel EP Impurity R
    CAS# 2322-77-2
    M.F.: C20H28O2
    M.W.: 300.44
  • QL221517
    Levonorgestrel EP Impurity Q
    CAS# 14507-49-4
    M.F.: C20H30O2
    M.W.: 302.45
  • QL221516
    Levonorgestrel EP Impurity P
    CAS# 100021-05-4
    M.F.: C21H28O2
    M.W.: 312.45
  • QL221514
    Levonorgestrel EP Impurity N
    CAS# 4222-96-2
    M.F.: C19H26O2
    M.W.: 286.41
  • QL221512
    Levonorgestrel EP Impurity L
    CAS# 21800-83-9
    M.F.: C19H26O2
    M.W.: 286.41
  • QL221510
    Levonorgestrel EP Impurity J
    CAS# 1175109-63-3
    M.F.: C21H26O3
    M.W.: 326.43
  • QL221509
    Levonorgestrel EP Impurity I
    CAS# 20402-62-4;21508-50-9
    M.F.: C21H28O3
    M.W.: 328.45
  • QL221507
    Levonorgestrel EP Impurity G
    CAS# 87585-03-3
    M.F.: C21H28O3
    M.W.: 328.45
  • QL221504
    Levonorgestrel EP Impurity D
    CAS# 32419-58-2
    M.F.: C21H30O
    M.W.: 298.46
  • QL221503
    Levonorgestrel EP Impurity C
    CAS# 1337972-89-0
    M.F.: C23H28O
    M.W.: 320.47
  • QL221502
    Levonorgestrel EP Impurity B
    CAS# 19914-67-1
    M.F.: C21H28O2
    M.W.: 312.45
  • QA202262
    Atorvastatin Impurity 12
    CAS# 196085-85-5
    M.F.: C14H23NO4
    M.W.: 269.34
  • QP202222
    Pitavastatin Impurity V
    CAS# NA
    M.F.: C50H46CaF2N2O8
    M.W.: 880.98
  • QA164808
    Axitinib Impurity H
    CAS# 1428728-83-9
    M.F.: C44H36N8O2S2
    M.W.: 772.94
  • QP812519
    Paclitaxel Impurity S
    CAS# NA
    M.F.: C47H51NO14
    M.W.: 853.91
  • QG120309
    Gliclazide Impurity I
    CAS# 38173-52-3
    M.F.: C15H19N3O5S
    M.W.: 353.39
  • QC-A130910
    Zinc acexamate EP Impurity B;
    6-aminohexanoic acid

    CAS# 60-32-2
    M.F.: C6H13NO2
    M.W.: 131.17
  • QC120424
    Clindamycin Phosphate EP Impurity B
    CAS# 54887-31-9
    M.F.: C17H32ClN2O8PS
    M.W.: 490.94
  • QF120103
    Flutamide EP Impurity C
    CAS# 13312-12-4
    M.F.: C10H9F3N2O3
    M.W.: 262.19
  • QA011404
    7-ANCA Impurity D
    CAS# NA
    M.F.: C7H8N2O3S
    M.W.: 200.22
  • QA011407
    7-ANCA Impurity G
    CAS# NA
    M.F.: C14H14N4O5S2
    M.W.: 382.41
  • QA011405
    7-ANCA Impurity E
    CAS# NA
    M.F.: C6H8N2OS
    M.W.: 156.21
  • QA011403
    7-ANCA Impurity C
    CAS# 68403-70-3
    M.F.: C7H10N2O4S
    M.W.: 218.23
  • QA011402
    7-ANCA Impurity B
    CAS# NA
    M.F.: C7H8N2O4S
    M.W.: 216.21
  • QA202250
    Atorvastatin Impurity Z
    CAS# 196085-84-4
    M.F.: C14H23NO4
    M.W.: 269.34
  • QP201637
    Pantoprazole Sodium Impurity 11
    CAS# NA
    M.F.: C7H8ClNO2
    M.W.: 173.60
  • QP201632
    Pantoprazole Sodium Impurity 6
    CAS# NA
    M.F.: C8H11NO3
    M.W.: 169.18
  • QP201631
    Pantoprazole Sodium Impurity 5
    CAS# NA
    M.F.: C8H11NO3
    M.W.: 169.18
  • QP201629
    Pantoprazole Sodium Impurity 3
    CAS# NA
    M.F.: C9H13NO3
    M.W.: 183.20
  • QP201628
    Pantoprazole Sodium Impurity 2
    CAS# 957470-59-6
    M.F.: C24H24F2N4O6S
    M.W.: 534.53
  • QP201627
    Pantoprazole Sodium Impurity 1
    CAS# NA
    M.F.: C16H15F2N3O3S
    M.W.: 367.37
  • QP201626
    Pantoprazole Sodium Impurity Z
    CAS# NA
    M.F.: C15H11F2N3O5
    M.W.: 351.26
  • QT120838
    Trelagliptin Impurity 12
    CAS# 31737-09-4
    M.F.: C5H5ClN2O2
    M.W.: 160.56
  • QT120834
    Trelagliptin Impurity 8
    CAS# 147754-12-9
    M.F.: C8H6FN
    M.W.: 135.14
  • QL142619
    Linezolid Impurity S
    CAS# 5394-50-3
    M.F.: C16H16N2O4
    M.W.: 300.31
  • QE131609
    Empagliflozin Impurity I
    CAS# NA
    M.F.: C46H52Cl2O14
    M.W.: 899.80
  • QC160802
    Cephalothin Impurity B;Cefalotin sodium EP Impurity A
    CAS# 34691-02-6
    M.F.: C14H14N2O4S2
    M.W.: 338.40
  • QT251954
    Thymalfasin Impurity D-Ser9
    CAS# NA
    M.F.: C129H215O55N33
    M.W.: 3108.34
  • QT251953
    Thymalfasin Impurity D-Ser8
    CAS# NA
    M.F.: C129H215O55N33
    M.W.: 3108.34
  • QT251952
    Thymalfasin Impurity Des-Asn28
    CAS# NA
    M.F.: C125H209O53N31
    M.W.: 2994.24
  • QT251946
    Thymalfasin Impurity Des-Val23
    CAS# NA
    M.F.: C124H206O54N32
    M.W.: 3009.21
  • QC121204
    Cholecalciferol EP Impurity D;iso-Tachysterol 3
    CAS# 22350-43-2
    M.F.: C27H44O
    M.W.: 384.64
  • QI192106
    Isoflurane EP Impurity F
    CAS# NA
    M.F.: C4H8
    M.W.: 56.11
  • QI192105
    Isoflurane EP Impurity E
    CAS# 32778-09-9
    M.F.: C3Cl3F5O
    M.W.: 253.38
  • QI192103
    Isoflurane EP Impurity C
    CAS# 32778-08-8
    M.F.: C3HCl2F5O
    M.W.: 218.94
  • QI192100
    Isoflurane
    CAS# 26675-46-7
    M.F.: C3H2ClF5O
    M.W.: 184.49
  • QL191808
    Lesinurad Impurity H
    CAS# NA
    M.F.: C19H18BrN3O2S
    M.W.: 432.33
  • QL191807
    Lesinurad Impurity G
    CAS# NA
    M.F.: C17H15N3O3S
    M.W.: 341.38
  • QL191806
    Lesinurad Impurity F
    CAS# NA
    M.F.: C17H15N3O2S
    M.W.: 325.38
  • QL191804
    Lesinurad Impurity D
    CAS# NA
    M.F.: C17H14ClN3O2S
    M.W.: 359.83
  • QL191803
    Lesinurad Impurity C
    CAS# NA
    M.F.: C17H13Br2N3O2S
    M.W.: 483.18
  • QL191802
    Lesinurad Impurity B
    CAS# NA
    M.F.: C17H14BrN3O4S
    M.W.: 436.28
  • QC121203
    Cholecalciferol EP Impurity C;Lumisterol 3
    CAS# 5226-01-7
    M.F.: C27H44O
    M.W.: 384.64
  • QB162227
    Bupivacaine N-Oxide
    CAS# 1346597-81-6;1796927-05-3(HCl salt)
    M.F.: C18H28N2O2
    M.W.: 304.43
  • QT251941
    Thymalfasin Impurity Des-Glu18
    CAS# NA
    M.F.: C124H208O52N32
    M.W.: 2979.22
  • QT251963
    Thymalfasin Impurity Des-Lys17
    CAS# NA
    M.F.: C123H203O54N31
    M.W.: 2980.16
  • QT251924
    Thymalfasin Impurity Des-Thr13
    CAS# NA
    M.F.: C125H208O53N32
    M.W.: 3007.23
  • QT251923
    Thymalfasin Impurity Des-Thr12
    CAS# NA
    M.F.: C125H208O53N32
    M.W.: 3007.23
  • QT251914
    Thymalfasin Impurity Des-Asp2
    CAS# NA
    M.F.: C125H210O52N32
    M.W.: 2993.25
  • QT251913
    Thymalfasin Impurity Des-Ser1
    CAS# NA
    M.F.: C126H210O53N32
    M.W.: 3021.26
  • QD072406
    Digoxin EP Impurity F;Digoxigenin bisdigitoxoside
    CAS# 5297-05-2
    M.F.: C35H54O11
    M.W.: 650.80
  • QD072404
    Digoxin EP Impurity D;Digoxigenin monodigitoxoside
    CAS# 5352-63-6
    M.F.: C29H44O8
    M.W.: 520.65
  • QC182501
    Canagliflozin Impurity A
    CAS# 842133-16-8
    M.F.: C24H26O5S
    M.W.: 426.53
  • QT041215
    Tadalafil Impurity O;Tryptophan;N-Acetyltryptophan EP Impurity A
    CAS# 73-22-3
    M.F.: C11H12N2O2
    M.W.: 204.23
  • QF122106
    Fluorouracil EP Impurity F
    CAS# 56177-80-1
    M.F.: C6H7FN2O2
    M.W.: 158.13
  • QF122105
    Fluorouracil EP Impurity E
    CAS# 1820-81-1
    M.F.: C4H3ClN2O2
    M.W.: 146.53
  • QF122104
    Fluorouracil EP Impurity D 
    CAS# 6623-81-0
    M.F.: C5H6N2O3
    M.W.: 142.11
  • QF122102
    Fluorouracil EP Impurity B
    CAS# 496-76-4
    M.F.: C4H4N2O3
    M.W.: 128.09
  • QF122101
    Fluorouracil EP Impurity A
    CAS# 67-52-7
    M.F.: C4H4N2O3
    M.W.: 128.09
  • QL142617
    Linezolid Impurity 17
    CAS# 15708-41-5
    M.F.: C10H12FeN2NaO8
    M.W.: 367.05
  • QI140410
    Indometacin EP Impurity J
    CAS# 402849-25-6
    M.F.: C33H27Cl2N3O5
    M.W.: 616.49
  • QI140409
    Indometacin EP Impurity I
    CAS# 16401-99-3
    M.F.: C21H20ClNO4
    M.W.: 385.84
  • QI140408
    Indometacin EP Impurity H
    CAS# 1601-18-9
    M.F.: C20H18ClNO4
    M.W.: 371.81
  • QI140407
    Indometacin EP Impurity G
    CAS# 402849-26-7
    M.F.: C19H15Cl2NO4
    M.W.: 392.23
  • QI140405
    Indometacin EP Impurity E
    CAS# 807614-94-4
    M.F.: C19H16ClNO4
    M.W.: 357.79
  • QI140404
    Indometacin EP Impurity D
    CAS# NA
    M.F.: C19H16ClNO4
    M.W.: 357.79
  • QI140402
    Indometacin EP Impurity B
    CAS# 2882-15-7
    M.F.: C12H13NO3
    M.W.: 219.24
  • QL142221
    Lenvatinib Impurity U
    CAS# NA
    M.F.: C19H16ClN3O5
    M.W.: 401.80
  • QL142220
    Lenvatinib Impurity T
    CAS# 417719-51-8
    M.F.: C18H15ClN4O4
    M.W.: 386.79
  • QL142217
    Lenvatinib Impurity Q
    CAS# 2110414-05-4
    M.F.: C11H10N2O3
    M.W.: 218.21
  • QL142216
    Lenvatinib Impurity P
    CAS# 2143930-77-0
    M.F.: C13H14N2O3
    M.W.: 246.26
  • QL142215
    Lenvatinib Impurity O
    CAS# 2143930-76-9
    M.F.: C20H19ClN4O4
    M.W.: 414.84
  • QL052013
    Levetiracetam Impurity M
    CAS# NA
    M.F.: C8H17N3O2
    M.W.: 187.24
  • QP020323
    Palbociclib Impurity W
    CAS# NA
    M.F.: C27H34ClN7O3
    M.W.: 540.06
  • QP020322
    Palbociclib Impurity V
    CAS# 1941177-45-2
    M.F.: C29H37N7O3
    M.W.: 531.65
  • QP020321
    Palbociclib Impurity U
    CAS# 2270982-31-3
    M.F.: C28H37N7O2
    M.W.: 503.64
  • QP020327
    Palbociclib Impurity 1
    CAS# 2206135-30-8
    M.F.: C41H55N11O5
    M.W.: 781.95
  • QF121906
    Fulvestrant EP Impurity F;6-Keto Fulvestrant
    CAS# NA
    M.F.: C32H45F5O4S
    M.W.: 620.75
  • QF121903
    Fulvestrant EP Impurity C
    CAS# 2482852-42-4
    M.F.: C41H65F5O4S2
    M.W.: 781.07
  • QF121901
    Fulvestrant EP Impurity A
    CAS# 407577-53-1
    M.F.: C32H47F5O3S
    M.W.: 606.77
  • QP020328
    Palbociclib Impurity 2
    CAS# 2204863-06-7
    M.F.: C24H29N7O
    M.W.: 431.53
  • QC060504
    Cefradine EP Impurity D
    CAS# NA
    M.F.: C16H19N3O5S
    M.W.: 365.40
  • QL040310
    Lidocaine EP Impurity J
    CAS# 857570-37-7;1012864-23-1(HCl salt)
    M.F.: C14H22N2O
    M.W.: 234.34
  • QL040309
    Lidocaine EP Impurity I
    CAS# 17289-53-1;17289-54-2(HCl salt)
    M.F.: C14H22N2O
    M.W.: 234.34
  • QL040307
    Lidocaine EP Impurity G
    CAS# 42459-30-3;35891-87-3(HCl salt)
    M.F.: C13H20N2O
    M.W.: 220.31
  • QL040306
    Lidocaine EP Impurity F
    CAS#  142713-08-4;857170-72-0(HCl salt)
    M.F.: C14H22N2O
    M.W.: 234.34
  • QA181620
    Aripiprazole Impurity 20
    CAS# NA
    M.F.: C18H27Cl3N2O
    M.W.: 393.78
  • QL040305
    Lidocaine EP Impurity E
    CAS# 745798-07-6;1135231-62-7(HCl salt)
    M.F.: C20H25N3O2
    M.W.: 339.43
  • QC-T180903
    1H-1,2,4-triazol-3-amine;Trapidil EP Impurity B
    CAS# 61-82-5
    M.F.: C2H4N4
    M.W.: 84.08
  • QC241308
    Cefixime Impurity H
    CAS# 79349-82-9
    M.F.: C9H10N2O3S
    M.W.: 226.25
  • QA261230
    Azelastine EP Impurity D
    CAS# 53242-88-9
    M.F.: C15H11ClN2O
    M.W.: 270.71
  • QG062006
    Gefitinib Impurity F
    CAS# 1502829-45-9(free base)
    M.F.: C29H37ClFN5O4.3HCl
    M.W.: 574.09 3*36.46
  • QL050310
    Lercanidipine Impurity J
    CAS# NA
    M.F.: C36H39N3O7
    M.W.: 625.71
  • QI041628
    Indapamide EP Impurity B
    CAS# 63968-75-2
    M.F.: C16H14ClN3O3S
    M.W.: 363.82
  • QS161808
    Sulpiride Impurity 8
    CAS# NA
    M.F.: C14H21N3O5S
    M.W.: 343.4
  • QE131607
    Empagliflozin Impurity G
    CAS# 1620758-33-9
    M.F.: C23H27ClO7
    M.W.: 450.91
  • QC-C081204
    2-chlorobenzoic acid;Mesalazine EP
    Impurity L;Mefenamic Acid EP Impurity C;
    Tolfenamic acid EP Impurity A

    CAS# 118-91-2
    M.F.: C7H5ClO2
    M.W.: 156.57
  • QC132637
    Cefmetazole Impurity 11
    CAS# 56796-16-8
    M.F.: C15H17N3O7S2
    M.W.: 415.44
  • QA041430
    Adrenaline EP Impurity D
    CAS# 317351-40-9
    M.F.: C16H19NO3
    M.W.: 273.33
  • QC062429
    Ceftriaxone Impurity 3
    CAS# 6938-68-7
    M.F.: C2H7N3S
    M.W.: 105.16
  • QC162631
    Cefprozil Impurity 5
    CAS# 1000980-59-5
    M.F.: C18H19N3O5S
    M.W.: 389.43
  • QG130333
    Gemcitabine EP Impurity C
    CAS# 114248-23-6
    M.F.: C9H10F2N2O5
    M.W.: 264.18
  • QC201838
    (S)-Cetirizine
    CAS# 130018-76-7;163837-48-7(2HCl salt)
    M.F.: C21H25ClN2O3
    M.W.: 388.89
  • QP151427
    Prostaglandin E1-d3
    CAS# 745-65-3 (non-labelled)
    M.F.: C20H31D3O5
    M.W.: 357.50
  • QA161830
    Aprepitant Impurity 1
    CAS# 638990-20-2
    M.F.: C22H24N2O5
    M.W.: 396.44
  • QL142631
    Linezolid Impurity 31
    CAS# NA
    M.F.: C21H29FN4O6
    M.W.: 452.48
  • QA200331
    Cisatracurium Besylate EP Impurity K
    CAS# NA
    M.F.: C66H84N2O18S2
    M.W.: 1257.51
  • QL221523
    Levonorgestrel EP Impurity W
    CAS# 155683-59-3
    M.F.: C21H24O2
    M.W.: 308.41
  • QL221508
    Levonorgestrel EP Impurity H
    CAS# 55555-97-0
    M.F.: C21H28O3
    M.W.: 328.45
  • QL221501
    Levonorgestrel EP Impurity A
    CAS# 1260525-53-8
    M.F.: C21H26O2
    M.W.: 310.43
  • QA120715
    Alogliptin Impurity O
    CAS# 655-63-0
    M.F.: C8H5Br2N
    M.W.: 274.94
  • QC081229
    Chlorpromazine EP Impurity D
    CAS# 3953-65-9(HCl salt)
    M.F.: C16H17ClN2S
    M.W.: 304.84
  • QD240905
    Dexmedetomidine Impurity 5
    CAS# 1021949-47-2
    M.F.: C13H14N2
    M.W.: 198.26
  • QF141911
    Finasteride Impurity K
    CAS# NA
    M.F.: C23H32N2O2
    M.W.: 368.51
  • QE200335
    Entecavir Impurity 9
    CAS# NA
    M.F.: C15H19N5O5
    M.W.: 349.34
  • QE200334
    Entecavir Impurity 8
    CAS# NA
    M.F.: C15H19N5O5
    M.W.: 349.34
  • QE200333
    Entecavir Impurity 7
    CAS# NA
    M.F.: C15H19N5O5
    M.W.: 349.34
  • QE200332
    Entecavir Impurity 6
    CAS# NA
    M.F.: C15H19N5O5
    M.W.: 349.34
  • QT140623
    Tenofovir Impurity W
    CAS# NA
    M.F.: C13H23N5O8P2
    M.W.: 439.30
  • QE151308
    Esomeprazole Impurity H
    CAS# NA
    M.F.: C8H7NO2S
    M.W.: 181.21
  • QL140306
    Lincomycin Hydrochloride EP Impurity F
    CAS# 14810-93-6
    M.F.: C9H19NO5S
    M.W.: 253.32
  • QL140303
    Lincomycin Hydrochloride EP impurity C
    CAS# 14600-41-0;2256-16-8(free base)
    M.F.: C17H33ClN2O6S
    M.W.: 428.97
  • QL140328
    Lincomycin B Hydrochloride
    CAS# 11021-35-5;2520-24-3(free base)
    M.F.: C17H32N2O6S.HCl
    M.W.: 392.51 36.46
  • QL140327
    Lincomycin Hydrochloride EP Impurity A
    CAS# NA
    M.F.: C18H34N2O6S
    M.W.: 406.54
  • QA120714
    Alogliptin Impurity N
    CAS# NA
    M.F.: C20H26N4O4
    M.W.: 386.44
  • QL121929
    Lansoprazole Impurity 3
    CAS# 1083100-27-9
    M.F.: C25H22F6N4O2S
    M.W.: 556.52
  • QV141677
    Vonoprazan Impurity 40
    CAS# 1421640-34-7
    M.F.: C6H7NO3S
    M.W.: 173.19
  • QT120832
    Trelagliptin Impurity 6
    CAS# 1938080-42-2
    M.F.: C13H10FN3O3
    M.W.: 275.24
  • QB031214
    Bicalutamide EP Impurity M
    CAS# 151262-57-6
    M.F.: C10H11FO5S
    M.W.: 262.25
  • QO022030
    Obeticholic Acid
    CAS# 459789-99-2
    M.F.: C26H44O4
    M.W.: 420.63
  • QE151318
    Esomeprazole Impurity 9
    CAS# 695-98-7
    M.F.: C8H11N
    M.W.: 121.18
  • QI040128
    Indacaterol Impurity 2
    CAS# 435273-75-9
    M.F.: C31H34N2O3
    M.W.: 482.61
  • QC132634
    Cefmetazole Impurity 8;
    7-MAC

    CAS# 56610-72-1
    M.F.: C24H24N6O4S2
    M.W.: 524.62
  • QC132632
    Cefmetazole Impurity 6
    CAS# NA
    M.F.: C15H17N7O6S3
    M.W.: 487.53
  • QC132633
    Cefmetazole Impurity 7
    CAS# NA
    M.F.: C15H19N7O6S3
    M.W.: 489.55
  • QC-M200824
    Trelagliptin Impurity 24
    CAS# NA
    M.F.: C12H9BrClFN2O2
    M.W.: 347.57
  • QA163000
    Apremilast Impurity T
    CAS# 2096492-41-8
    M.F.: C22H26N2O8S
    M.W.: 478.52
  • QA162999
    Apremilast Impurity S
    CAS# 1809170-71-5
    M.F.: C22H26N2O8S
    M.W.: 478.52
  • QG062003
    Gefitinib Impurity C
    CAS# 199327-61-2
    M.F.: C16H21N3O4
    M.W.: 319.36
  • QT192019
    Telmisartan Impurity S
    CAS# 4760-34-3
    M.F.: C7H10N2
    M.W.: 122.17
  • QA181630
    Aripiprazole EP Impurity D
    CAS# 203395-82-8
    M.F.: C23H28ClN3O2
    M.W.: 413.95
  • QC121904
    Cilastatin EP Impurity D
    CAS# 141-79-7
    M.F.: C6H10O
    M.W.: 98.14
  • QC062431
    Ceftriaxone Oxidation Impurity
    CAS# NA
    M.F.: C18H18N8O8S3
    M.W.: 570.58
  • QE151325
    Esomeprazole Sodium Impurity 9
    CAS# NA
    M.F.: C26H30N4O3S
    M.W.: 478.61
  • QC132628
    Cefmetazole Impurity 2
    CAS# NA
    M.F.: C15H16N7NaO6S3
    M.W.: 509.52
  • QF181932
    Furosemide Impurity 6
    CAS# 4795-29-3
    M.F.: C5H11NO
    M.W.: 101.15
  • QE262031
    Ezetimibe Impurity 5
    CAS# 1612153-32-8
    M.F.: C20H20FNO4
    M.W.: 357.38
  • QT251910
    Des-Ser1-Asp15-Tal
    CAS# NA
    M.F.: C66H113N17O25
    M.W.: 1544.74
  • QT251906
    Des-Ser1-Asp2-Tal
    CAS# NA
    M.F.: C120H203N31O49
    M.W.: 2864.13
  • QT260227
    Tazobactam Impurity 1
    CAS# 89789-07-1
    M.F.: C23H22N4O5S
    M.W.: 466.51
  • QF181931
    Furosemide Impurity 5
    CAS# 98-00-0
    M.F.: C5H6O2
    M.W.: 98.10
  • QD180904
    Dirithromycin EP Impurity D
    CAS# NA
    M.F.: C41H76N2O14
    M.W.: 821.05
  • QF181928
    Furosemide Impurity 2
    CAS# 41332-59-6
    M.F.: C7H4Cl2O5S
    M.W.: 271.07
  • QL142630
    (R)-Linezolid
    CAS# 872992-20-6
    M.F.: C16H20FN3O4
    M.W.: 337.35
  • QC120101
    Clavulanic Acid Imidazole Derivative-d3
    CAS# NA
    M.F.: C10H10D3N3O3
    M.W.: 226.25
  • QT180630
    Tirofiban Impurity 4
    CAS# NA
    M.F.: C9H19NO2
    M.W.: 173.25
  • QC-A140901
    Aniline;Mesalazine EP Impurity K;
    Fentanyl EP Impurity F;
    Sodium Cyclamate EP Impurity B;
    Trimethoprim EP Impurity K;
    4-Aminobenzoic acid EP Impurity C

    CAS# 62-53-3;142-04-1(HCl salt)
    M.F.: C6H7N
    M.W.: 93.13
  • QI131602
    Imipenem EP Impurity B
    CAS# 1197869-90-1
    M.F.: C12H19N3O5S
    M.W.: 317.36
  • QD190628
    Doxofylline Impurity 2
    CAS# NA
    M.F.: C10H14N4O5
    M.W.: 270.24
  • QE200345
    Entecavir Impurity 45
    CAS# 142217-81-0
    M.F.: C26H27N5O3
    M.W.: 457.52
  • QT090303
    Thioctic Acid Impurity C
    CAS# 916746-61-7
    M.F.: C12H23NO4S2
    M.W.: 309.45
  • QP201618
    Pantoprazole Impurity R
    CAS#  172282-50-7
    M.F.: C7H8F2N2O
    M.W.: 174.15
  • QP201617
    Pantoprazole Impurity Q
    CAS# 97963-76-3
    M.F.: C7H6F2N2O3
    M.W.: 204.13
  • QD031232
    Daclatasvir Impurity 6
    CAS# 1417333-58-4
    M.F.: C40H50N8O6
    M.W.: 738.88
  • QD031231
    Daclatasvir Impurity 5
    CAS# 1009117-26-3
    M.F.: C40H50N8O6
    M.W.: 738.88
  • QL052229
    Levocetirizine Impurity 3
    CAS# NA
    M.F.: C21H25ClN2O3[C2H4]n
    M.W.: 388.90[44.05]n
  • QG121621
    Glipizide Impurity U
    CAS# NA
    M.F.: C14H20N2O6S
    M.W.: 344.38
  • QG121619
    Glipizide Impurity S
    CAS# NA
    M.F.: C12H17N3O
    M.W.: 219.28
  • QG121618
    Glipizide Impurity R
    CAS# NA
    M.F.: C8H8N2O4
    M.W.: 196.16
  • QG121610
    Glipizide Impurity 1 HCl
    CAS# 1428553-61-0;2015-16-9(free base)
    M.F.: C15H23N3O3S.HCl
    M.W.: 325.43 36.46
  • QB200102
    Betamethasone Dipropionate EP Impurity B
    CAS# 5534-13-4
    M.F.: C25H33FO6
    M.W.: 448.52
  • QL121928
    Lansoprazole Impurity 2
    CAS# NA
    M.F.: C16H14F3N3O2
    M.W.: 337.30
  • QL141239
    Linagliptin Impurity 39
    CAS# 88203-04-7
    M.F.: C10H10N2O
    M.W.: 174.20
  • QA131501
    N-Desethyl Amodiaquine DiHCl
    CAS# 79352-78-6(free base)
    M.F.: C18H20Cl3N3O
    M.W.: 400.73
  • QA181619
    Aripiprazole Impurity 19
    CAS# 889443-20-3
    M.F.: C13H17NO3
    M.W.: 235.28
  • QD031229
    Daclatasvir Impurity 29
    CAS# NA
    M.F.: C29H32N6O3
    M.W.: 512.60
  • QD130927
    Demiditraz Impurity 1
    CAS# 944263-08-5
    M.F.: C13H16N2
    M.W.: 200.28
  • QC251927
    Cystine Impurity 1
    CAS# 32854-09-4;1069-29-0(free base)
    M.F.: C8H16N2O4S2.2HCl
    M.W.: 268.35 72.92
  • QC120313
    Celecoxib Impurity M
    CAS# 41472-49-5
    M.F.: C10H14N2O3S
    M.W.: 242.29
  • QG121629
    Glipizide Impurity 3
    CAS# 933705-21-6
    M.F.: C8H12N2O2S
    M.W.: 200.26
  • QG121628
    Glipizide Impurity 2
    CAS# 73631-58-0
    M.F.: C8H11NO3S
    M.W.: 201.24
  • QG121627
    Glipizide Impurity 1
    CAS# 877-95-2
    M.F.: C10H13NO
    M.W.: 163.22
  • QA041404
    rac-Adrenaline EP Impurity D HCl
    CAS# 1095714-91-2 (free base)
    M.F.: C16H20ClNO3
    M.W.: 309.79
  • QA041406
    rac-Adrenaline EP Impurity F
    CAS#  26405-77-6
    M.F.: C9H13NO5S
    M.W.: 247.27
  • QP122412
    Plerixafor Impurity L
    CAS# NA
    M.F.: C70H90N8O12S6
    M.W.: 1427.90
  • QP122411
    Plerixafor Impurity K
    CAS# 104395-69-9
    M.F.: C31H42N4O6S3
    M.W.: 662.88
  • QC202627
    Ceftizoxime Impurity 1
    CAS# NA
    M.F.: C13H15N5O6S2
    M.W.: 401.42
  • QD241305
    Dexamethasone Acetate EP Impurity E
    CAS# 1524-94-3
    M.F.: C24H33FO6
    M.W.: 436.51
  • QT180629
    Tirofiban Impurity 3
    CAS# NA
    M.F.: C20H24N2O4
    M.W.: 356.42
  • QG140927
    Ganciclovir EP Impurity H
    CAS#  84222-50-4
    M.F.: C9H13N5O4
    M.W.: 255.23
  • QT142090
    Teneligliptin (2S,4R)-Isomer Impurity
    CAS# 1404559-15-4
    M.F.: C22H30N6OS
    M.W.: 426.58
  • QO241810
    Oxiracetam Impurity J
    CAS# NA
    M.F.: C6H8N2O2
    M.W.: 140.14
  • QL162007
    Lapatinib Impurity 7
    CAS# 1026818-86-9
    M.F.: C29H26ClFN4O4S
    M.W.: 581.06
  • QL162003
    Lapatinib Impurity 3
    CAS# 1360431-86-2
    M.F.: C29H26ClFN4O5S
    M.W.: 597.06
  • QL162002
    Lapatinib Impurity 2
    CAS# 320337-48-2
    M.F.: C26H19ClFN3O3
    M.W.: 475.90
  • QG140909
    Ganciclovir EP Impurity I
    CAS# 86357-20-2
    M.F.: C15H21N5O6
    M.W.: 367.36
  • QT060359
    Tofacitinib Impurity 33
    CAS# NA
    M.F.: C13H19N5
    M.W.: 245.32
  • QP121827
    Palonosetron Impurity 27
    CAS# 135729-78-1
    M.F.: C18H24N2O
    M.W.: 284.40
  • QC-M200805
    Bisoctrizole
    CAS# 103597-45-1
    M.F.: C41H50N6O2
    M.W.: 658.87
  • QT132014
    Trimetazidine Impurity N
    CAS# 69471-05-2
    M.F.: C9H10O4
    M.W.: 182.17
  • QH042401
    Hydroxychloroquine sulfate EP Impurity A
    CAS# 1449223-88-4
    M.F.: C18H26ClN3O2
    M.W.: 351.87
  • QH042403
    Hydroxychloroquine sulfate EP Impurity C
    CAS# 4298-15-1
    M.F.: C16H22ClN3O
    M.W.: 307.82
  • QT161828
    Topiroxostat Impurity 2
    CAS# 38634-05-8
    M.F.: C12H10N6
    M.W.: 238.25
  • QC161306
    Cefepime EP Impurity F
    CAS# NA
    M.F.: C32H42N9O7S3
    M.W.: 760.93
  • QC161302
    Cefepime EP Impurity B
    CAS# NA
    M.F.: C25H29N9O7S3
    M.W.: 663.75
  • QC160732
    Clopidogrel Impurity 6
    CAS# 212838-70-5
    M.F.: C9H11Cl2NO2
    M.W.: 236.10
  • QP182004
    Paracetamol EP Impurity D
    CAS# 103-84-4
    M.F.: C8H9NO
    M.W.: 135.16
  • QC551801
    Clenbuterol EP Impurity A
    CAS# 62909-66-4
    M.F.: C7H5Cl2NO
    M.W.: 190.03
  • QL091630
    Lipoic Acid Impurity 4
    CAS# NA
    M.F.: C8H14O4S2
    M.W.: 238.32
  • QL091629
    Lipoic Acid Impurity 3
    CAS# 108015-78-7
    M.F.: C8H14O3S2
    M.W.: 222.32
  • QL091628
    Lipoic Acid Impurity 2
    CAS# 462-20-4
    M.F.: C8H16O2S2
    M.W.: 208.34
  • QL091600
    Lipoic Acid
    CAS# 1077-28-7;2319-84-8(Na salt)
    M.F.: C8H14O2S2
    M.W.: 206.33
  • QT060372
    Tofacitinib Impurity 72
    CAS# NA
    M.F.: C16H20N6O
    M.W.: 312.37
  • QC010606
    Caffeine EP Impurity F
    CAS# 611-59-6
    M.F.: C7H8N4O2
    M.W.: 180.16
  • QA202267
    Atorvastatin Impurity 17
    CAS# 425408-16-8
    M.F.: C53H58ClFN4O9
    M.W.: 949.50
  • QA202266
    Atorvastatin Impurity 16
    CAS# 1821498-27-4
    M.F.: C27H30FNO6
    M.W.: 483.53
  • QT140657
    Tenofovir Impurity 31
    CAS# NA
    M.F.: C21H29N6O5P
    M.W.: 476.47
  • QT201608
    Tiotropium Bromide EP Impurity H
    CAS# 845870-40-8
    M.F.: C9H16BrNO2
    M.W.: 250.13
  • QI041529
    Indobufen Impurity 3
    CAS# 21762-22-1
    M.F.: C10H11NO4
    M.W.: 209.20
  • QL141202
    Lenalidomide Impurity B
    CAS# 1218910-61-2
    M.F.: C9H8ClNO4
    M.W.: 229.62
  • QE160930
    Epinastine Impurity 4
    CAS# NA
    M.F.: C15H13NO
    M.W.: 223.27
  • QD031227
    Daclatasvir Dihydrochloride
    CAS# 1009119-65-6
    M.F.: C40H50N8O6.2HCl
    M.W.: 738.89 72.92
  • QP180104
    Piracetam EP Impurity D
    CAS# 53934-76-2
    M.F.: C6H9NO3
    M.W.: 143.14
  • QP180101
    Piracetam EP Impurity A
    CAS# 616-45-5
    M.F.: C4H7NO
    M.W.: 85.10
  • QP122410
    Plerixafor Impurity J
    CAS# NA
    M.F.: C18H32N4
    M.W.: 304.47
  • QT060371
    Tofacitinib Impurity 71
    CAS# NA
    M.F.: C14H22N2O
    M.W.: 234.34
  • QT060369
    Tofacitinib Impurity 69
    CAS# NA
    M.F.: C14H21N5
    M.W.: 259.35
  • QE160929
    Epinastine Impurity 3
    CAS# NA
    M.F.: C15H12N2O
    M.W.: 236.27
  • QE160928
    Epinastine Impurity 2
    CAS# NA
    M.F.: C16H16N2
    M.W.: 236.31
  • QE200347
    Entecavir Impurity 47
    CAS# NA
    M.F.: C13H17N5O4
    M.W.: 307.31
  • QP122409
    Plerixafor Impurity I
    CAS# NA
    M.F.: C17H30N4O2S
    M.W.: 354.51
  • QT180626
    Tirofiban Impurity Z
    CAS# 102878-73-9
    M.F.: C9H11NO2
    M.W.: 165.19
  • QT180621
    Tirofiban Impurity U
    CAS# 2374-68-7
    M.F.: C6H14O3S
    M.W.: 166.24
  • QT180620
    Tirofiban Impurity T
    CAS# NA
    M.F.: C22H30N2O5S
    M.W.: 434.55
  • QT180619
    Tirofiban Impurity S
    CAS# NA
    M.F.: C36H62N4O3
    M.W.: 598.90
  • QT180617
    Tirofiban Impurity Q
    CAS# NA
    M.F.: C27H47Cl2N3O3
    M.W.: 532.59
  • QT180616
    Tirofiban Impurity P
    CAS# NA
    M.F.: C27H33N3O3
    M.W.: 447.57
  • QT180614
    Tirofiban Impurity N
    CAS# NA
    M.F.: C18H22N2O3
    M.W.: 314.38
  • QT180612
    Tirofiban Impurity L
    CAS# NA
    M.F.: C18H22N2O3
    M.W.: 314.38
  • QT180600
    Tirofiban HCl
    CAS# 142373-60-2;150915-40-5(HCl monohydrate)
    M.F.: C22H36N2O5S.HCl
    M.W.: 440.60 36.46
  • QT180610
    Tirofiban Impurity J
    CAS# NA
    M.F.: C31H49Cl2N3O5S
    M.W.: 646.71
  • QT180604
    Tirofiban Impurity D
    CAS# 149490-61-9
    M.F.: C22H30N2O5S
    M.W.: 434.55
  • QT180603
    Tirofiban Impurity C
    CAS# NA
    M.F.: C31H43Cl2N3O5S
    M.W.: 640.66
  • QT251938
    Thymalfasin Impurity Des-Glu21---Asn28-Tal
    CAS# NA
    M.F.: C92H158O38N24
    M.W.: 2208.42
  • QT251929
    Thymalfasin Impurity Des-Asn28-Tal
    CAS# NA
    M.F.: C125H209O53N31
    M.W.: 2994.24
  • QP136046
    Pidotimod Impurity 20
    CAS# NA
    M.F.: C10H16N2O3S2
    M.W.: 276.38
  • QP136045
    Pidotimod Impurity 19
    CAS# NA
    M.F.: C8H12N2O4S
    M.W.: 232.26
  • QP136044
    Pidotimod Impurity 18
    CAS# NA
    M.F.: C13H19N3O6S2
    M.W.: 377.44
  • QG200609
    Gatifloxacin Impurity I
    CAS# 103460-89-5
    M.F.: C18H19F2N3O3
    M.W.: 363.36
  • QU121600
    Ulipristal Acetate
    CAS# 126784-99-4
    M.F.: C30H37NO4
    M.W.: 475.62
  • QU121608
    Ulipristal acetate Impurity H
    CAS# NA
    M.F.: C30H37NO4
    M.W.: 475.62
  • QU121607
    Ulipristal acetate Impurity G
    CAS# NA
    M.F.: C28H35NO3
    M.W.: 433.58
  • QU121606
    Ulipristal acetate Impurity F
    CAS# NA
    M.F.: C29H35NO4
    M.W.: 461.59
  • QC062009
    Cefathiamidine Impurity I
    CAS# NA
    M.F.: C19H28N4O7S2
    M.W.: 488.58
  • QA150927
    Atomoxetine EP Impurity F
    CAS# 2727370-25-2
    M.F.: C17H20FNO
    M.W.: 273.35
  • QP191627
    Phosphocreatine Disodium Salt Impurity 1
    CAS# NA
    M.F.: C7H16N3O5P
    M.W.: 253.19
  • QL142627
    Linezolid Impurity 27
    CAS# 10389-51-2
    M.F.: C10H12N2O3
    M.W.: 208.21
  • QL142626
    Linezolid Impurity 26
    CAS# 348626-43-7
    M.F.: C18H20N2O3
    M.W.: 312.36
  • QL142625
    Linezolid Impurity 25
    CAS# 212325-40-1
    M.F.: C12H15FN2O3
    M.W.: 254.26
  • QL142624
    Linezolid Impurity 24
    CAS# 1138458-15-7
    M.F.: C13H14ClFN2O3
    M.W.: 300.71
  • QP160527
    Prednisolone Dicarbonate
    CAS# NA
    M.F.: C26H34O9
    M.W.: 490.54
  • QI091613
    (S)-Ipratropium EP Impurity E
    CAS# 183626-76-8
    M.F.: C19H27NO3
    M.W.: 317.42
  • QA070243
    Argatroban Impurity 17
    CAS# 188659-43-0
    M.F.: C22H34N4O5S
    M.W.: 466.59
  • QT090906
    Thiamine EP Impurity F
    CAS# 6309-04-2;10593-44-9(free base);3505-34-8(Cl-)
    M.F.: C13H20Br2N4OS
    M.W.: 440.20
  • QT090905
    Thiamine EP Impurity E
    CAS# 299-35-4
    M.F.: C12H16N4OS2
    M.W.: 296.41
  • QT090903
    Thiamine EP Impurity C
    CAS# 7275-24-3
    M.F.: C12H16Cl2N4S.HCl
    M.W.: 319.25 36.46
  • QT090901
    Thiamine EP Impurity A
    CAS# 2380-61-2
    M.F.: C12H16N4O4S2
    M.W.: 344.41
  • QC121305
    Clotrimazole EP Impurity E
    CAS# 5162-03-8
    M.F.: C13H9ClO
    M.W.: 216.66
  • QP132032
    Pemetrexed Impurity 6
    CAS# NA
    M.F.: C25H28N6O9
    M.W.: 556.52
  • QB082431
    Bromhexine Impurity V
    CAS# 1797894-71-3
    M.F.: C14H16Br2N2O
    M.W.: 388.10
  • QT251940
    Thymalfasin Impurity Glu-Asn-OH
    CAS# NA
    M.F.: C9H15N3O6
    M.W.: 261.24
  • QT251937
    Thymalfasin Impurity Des-Ser1---Glu18-Tal
    CAS# NA
    M.F.: C51H85O21N13
    M.W.: 1216.32
  • QT251936
    Thymalfasin Impurity Ac-Ser1---Glu18-OH
    CAS# NA
    M.F.: C80H134O36N20
    M.W.: 1952.07
  • QT251935
    Thymalfasin Impurity Des-Ser1---Lys17-Tal
    CAS# NA
    M.F.: C56H92O24N14
    M.W.: 1345.44
  • QT251934
    Thymalfasin Impurity Ac-Ser1---Lys17-OH
    CAS# NA
    M.F.: C75H127O33N19
    M.W.: 1822.96
  • QL040304
    Lidocaine EP Impurity D
    CAS# 7728-40-7;7729-94-4(HCl salt)
    M.F.: C12H18N2O
    M.W.: 206.28
  • QC-D091501
    Piperonylic Acid
    CAS# 94-53-1
    M.F.: C8H6O4
    M.W.: 166.13
  • QF191616
    Fosaprepitant Impurity P
    CAS# 538-86-3
    M.F.: C8H10O
    M.W.: 122.16
  • QF191614
    Fosaprepitant Impurity N
    CAS# 1623-08-1
    M.F.: C14H15O4P
    M.W.: 278.24
  • QF191610
    Fosaprepitant Impurity J
    CAS# NA
    M.F.: C23H23F6N4O6P 2C7H17NO5
    M.W.: 596.42 390.42
  • QF191609
    Fosaprepitant Impurity I
    CAS# NA
    M.F.: C23H23F6N4O6P 2C7H17NO5
    M.W.: 596.42 390.42
  • QP132031
    Pemetrexed Impurity 5
    CAS# 1802552-09-5
    M.F.: C22H25N5O6
    M.W.: 455.46
  • QL201523
    Letrozole Impurity 23
    CAS# NA
    M.F.: C17H12N4O2
    M.W.: 304.30
  • QL142213
    Lenvatinib Impurity M
    CAS# 1788901-86-9
    M.F.: C21H19ClN4O5
    M.W.: 442.85
  • QC120440
    Clindamycin Hydrochloride EP Impurity E
    CAS# NA
    M.F.: C18H31ClN2O5S
    M.W.: 422.97
  • QD162433
    Dapoxetine Impurity 7
    CAS# NA
    M.F.: C19H17N3O
    M.W.: 303.36
  • QD162430
    Dapoxetine Impurity 4
    CAS# NA
    M.F.: C21H23NO
    M.W.: 305.41
  • QP180206
    Pregabalin Impurity F
    CAS# NA
    M.F.: C16H30N2O2
    M.W.: 282.42
  • QP180205
    Pregabalin Impurity E
    CAS# 1083246-65-4
    M.F.: C16H32N2O3
    M.W.: 300.44
  • QP202244
    Pitavastatin Impurity 44
    CAS# NA
    M.F.: C25H22FNO4
    M.W.: 419.44
  • QC062725
    Cefazolin EP Impurity I
    CAS# NA
    M.F.: C14H16N8O5S3
    M.W.: 472.52
  • QC062724
    Cefazolin Impurity 24
    CAS# NA
    M.F.: C11H12N6O5S
    M.W.: 340.32
  • QC131405
    Cefminox Sodium impurity 5
    CAS# NA
    M.F.: C14H18N3NaO8S2
    M.W.: 443.43
  • QP180730
    Pregabalin Impurity 4
    CAS# NA
    M.F.: C14H25NO6
    M.W.: 303.35
  • QP180729
    Pregabalin Impurity 3
    CAS# NA
    M.F.: C20H35NO11
    M.W.: 465.49
  • QP180728
    Pregabalin Impurity 2
    CAS# 501665-88-9
    M.F.: C20H35NO11
    M.W.: 465.49
  • QC062723
    Cefazolin Impurity 23
    CAS# NA
    M.F.: C14H14N8O4S3
    M.W.: 454.51
  • QC062722
    Cefazolin Impurity 22
    CAS# NA
    M.F.: C14H14N8O4S3
    M.W.: 454.51
  • QC201837
    Cetirizine Impurity 37;
    USP Glyceryl ester of cetirizine

    CAS# 1243652-36-9
    M.F.: C24H31ClN2O5
    M.W.: 462.97
  • QC201836
    Cetirizine Impurity 36;
    USP Propylene glycol ester of cetirizine

    CAS# 2705552-48-1
    M.F.: C24H31ClN2O4
    M.W.: 446.97
  • QF181906
    Furosemide EP Impurity F
    CAS# 4793-38-8
    M.F.: C12H15ClN2O5S
    M.W.: 334.78
  • QF181905
    Furosemide EP Impurity E
    CAS# 50-84-0
    M.F.: C7H4Cl2O2
    M.W.: 191.01
  • QF181903
    Furosemide EP Impurity C
    CAS# 3086-91-7
    M.F.: C7H7ClN2O4S
    M.W.: 250.66
  • QF181902
    Furosemide EP Impurity B
    CAS# 2736-23-4
    M.F.: C7H5Cl2NO4S
    M.W.: 270.09
  • QE151334
    Esomeprazole Impurity 17
    CAS# 91219-90-8
    M.F.: C11H15NO3
    M.W.: 209.24
  • QE151332
    Esomeprazole Impurity 15
    CAS# 102-51-2;59548-39-9(2HCl salt)
    M.F.: C7H10N2O
    M.W.: 138.17
  • QP140828
    Penehyclidine Impurity 2
    CAS# NA
    M.F.: C14H20O2
    M.W.: 220.31
  • QP140827
    Penehyclidine Impurity 1
    CAS# 151673-91-5
    M.F.: C13H18O2
    M.W.: 206.28
  • QD020747
    Dabigatran Impurity 18
    CAS# 1854074-40-0
    M.F.: C28H30N6O4
    M.W.: 514.58
  • QD020746
    Dabigatran Impurity 17
    CAS# 1408238-39-0
    M.F.: C33H38N6O6
    M.W.: 614.69
  • QD020744
    Dabigatran Impurity 15
    CAS# 771459-37-1
    M.F.: C26H27N7O3
    M.W.: 485.54
  • QD020743
    Dabigatran Impurity 14
    CAS# 1422435-39-9;1408238-41-4(free base)
    M.F.: C19H22ClN5O2
    M.W.: 387.86
  • QD020742
    Dabigatran Impurity 13
    CAS# 1427571-33-2
    M.F.: C21H25ClN4O3
    M.W.: 416.90
  • QC030344
    Cinacalcet Impurity 13
    CAS# NA
    M.F.: C17H17F3O3S
    M.W.: 358.38
  • QC030343
    Cinacalcet Impurity 12
    CAS# NA
    M.F.: C28H25F3N2O4S
    M.W.: 542.57
  • QC030342
    Cinacalcet Impurity 11
    CAS# NA
    M.F.: C18H16N2O4S
    M.W.: 356.40
  • QP181604
    Pramipexole EP Impurity D
    CAS# 104632-27-1
    M.F.: C10H19Cl2N3S
    M.W.: 284.25
  • QA162998
    Apremilast Impurity R
    CAS# NA
    M.F.: C20H24N2O7S
    M.W.: 436.48
  • QA162997
    Apremilast Impurity Q
    CAS# 1831833-38-5
    M.F.: C12H16O4S
    M.W.: 256.32
  • QA162994
    Apremilast Impurity N
    CAS# 1384439-79-5
    M.F.: C19H18N2O7S
    M.W.: 418.42
  • QA162990
    Apremilast Impurity J
    CAS# NA
    M.F.: C23H26N2O7S
    M.W.: 474.53
  • QA162989
    Apremilast Impurity I
    CAS# NA
    M.F.: C22H24N2O7S
    M.W.: 460.50
  • QA162986
    Apremilast Impurity F
    CAS# NA
    M.F.: C34H43N3O11S2
    M.W.: 733.85
  • QA178203
    Artemisinin Impurity 29
    CAS# 82596-30-3
    M.F.: C15H22O4
    M.W.: 266.33
  • QC120435
    Clindamycin Impurity 8
    CAS# 22431-46-5
    M.F.: C18H33ClN2O6S
    M.W.: 440.98
  • QC120434
    Clindamycin Impurity 7
    CAS# 22965-79-3
    M.F.: C9H18ClNO4S
    M.W.: 271.76
  • QL140305
    Lincomycin Hydrochloride EP Impurity E
    CAS# 6734-79-8;13380-36-4(free base)
    M.F.: C9H17NO2.HCl
    M.W.: 171.24 36.46
  • QC062401
    Ceftriaxone EP Impurity A
    CAS# 92143-31-2;97164-54-0(2Na salt)
    M.F.: C18H18N8O7S3
    M.W.: 554.58
  • QC062405
    Ceftriaxone EP Impurity E
    CAS# 58909-56-1;131257-07-3(Na salt)
    M.F.: C12H13N5O5S2
    M.W.: 371.39
  • QC120433
    Clindamycin Phosphate EP Impurity H;
    Clindamycin 2,3-Bisphosphate

    CAS# NA
    M.F.: C18H35ClN2O11P2S
    M.W.: 584.94
  • QC120432
    Clindamycin Phosphate EP Impurity K
    CAS# NA
    M.F.: C36H66Cl2N4O15P2S2
    M.W.: 991.91
  • QC120429
    Clindamycin Phosphate EP Impurity I
    CAS# 1309048-48-3
    M.F.: C18H35ClN2O11P2S
    M.W.: 584.94
  • QC120428
    Clindamycin Phosphate EP Impurity G
    CAS# NA
    M.F.: C18H33N2O8PS
    M.W.: 468.50
  • QC120427
    Clindamycin Phosphate EP Impurity A;
    Clindamycin Hydrochloride EP Impurity A;
    Lincomycin

    CAS# 154-21-2;859-18-7(HCl salt);
    7179-49-9(hydrochloride monohydrate)
    M.F.: C18H34N2O6S
    M.W.: 406.54
  • QC062404
    Ceftriaxone EP Impurity D
    CAS# 80756-85-0
    M.F.: C13H10N4O2S3
    M.W.: 350.44
  • QC062403
    Ceftriaxone EP Impurity C
    CAS# 58909-39-0
    M.F.: C4H5N3O2S
    M.W.: 159.17
  • QC160731
    Clopidogrel EP Impurity F
    CAS# 141109-20-8
    M.F.: C15H16ClNO2S
    M.W.: 309.81
  • QA202263
    Atorvastatin Impurity 13
    CAS# 1316291-19-6 (Na salt);873950-17-5
    M.F.: C33H35FN2O7
    M.W.: 590.64
  • QC160719
    Clopidogrel Amide Racemate
    CAS# 90055-68-8 (free base)
    M.F.: C15H16Cl2N2OS
    M.W.: 343.27
  • QI132033
    Imatinib Impurity 33
    CAS# 581076-64-4
    M.F.: C8H12N4
    M.W.: 164.21
  • QL220106
    Levalbuterol USP Related Compound F
    CAS# 174607-68-2
    M.F.: C20H27NO3
    M.W.: 329.43
  • QL220101
    Levalbuterol USP Related Compound A
    CAS# 1823256-56-9
    M.F.: C13H21NO2
    M.W.: 223.31
  • QA164109
    Avanafil Impurity I
    CAS# 1452128-53-8
    M.F.: C18H17ClN6O3
    M.W.: 400.82
  • QP160454
    Paliperidone Impurity 28
    CAS# 1138463-56-5
    M.F.: C11H13ClN2O2
    M.W.: 240.69
  • QE201805
    Emtricitabine Impurity E
    CAS# NA
    M.F.: C8H9FN2O4S
    M.W.: 248.23
  • QE200341
    Entecavir Impurity 41
    CAS# NA
    M.F.: C12H15N5O4
    M.W.: 293.28
  • QP020317
    Palbociclib Impurity Q
    CAS# 827022-35-5
    M.F.: C33H45N7O4
    M.W.: 603.75
  • QP202241
    Pitavastatin Impurity 41
    CAS# 1611499-16-1;2276678-27-2(Na salt)
    M.F.: C25H24FNO5
    M.W.: 437.46
  • QE192016
    Escitalopram EP Impurity L oxalate
    CAS# 1093072-86-6;1026009-77-7(free base)
    M.F.: C20H22N2O.C2H2O4
    M.W.: 306.40 90.03
  • QE192015
    Escitalopram Impurity P
    CAS# NA
    M.F.: C20H21FN2O.C2H2O4
    M.W.: 324.40 90.03
  • QV010337
    Valaciclovir Impurity K
    CAS# NA
    M.F.: C13H21ClN6O4
    M.W.: 360.80
  • QT130203
    Trimebutine Impurity C
    CAS# NA
    M.F.: C10H11NO
    M.W.: 161.08
  • QA121803
    Allura Red Impurity 3
    CAS# 61551-82-4
    M.F.: C20H12Na2O7S2
    M.W.: 474.41
  • QA121802
    Allura Red Impurity 2
    CAS# 6471-78-9
    M.F.: C8H11NO4S
    M.W.: 217.24
  • QA121801
    Allura Red Impurity 1
    CAS# 135-76-2;93-01-6(free base)
    M.F.: C10H7NaO4S
    M.W.: 246.21
  • QP190333
    Posaconazole Impurity 2
    CAS# NA
    M.F.: C47H52N8O5
    M.W.: 808.97
  • QE221329
    Everolimus Impurity 29
    CAS# 1708118-13-1
    M.F.: C53H83NO14
    M.W.: 958.22
  • QC242020
    Cefoxitin Impurity 20
    CAS# NA
    M.F.: C16H17N3O7S2
    M.W.: 427.45
  • QD170600
    Diquafosol sodium
    CAS# 211427-08-6
    M.F.: C18H22N4Na4O23P4
    M.W.: 878.23
  • QC031232
    Cefaclor Impurity 6
    CAS# NA
    M.F.: C15H14ClN3O5S
    M.W.: 383.81
  • QP180736
    Pregabalin Impurity 10
    CAS# 181289-34-9
    M.F.: C9H17NO3
    M.W.: 187.24
  • QB151429
    Bromfenac Impurity 3
    CAS# 1644279-16-2
    M.F.: C30H18Br2N2O3
    M.W.: 614.28
  • QB151431
    Bromfenac Impurity 5 Sodium Salt
    CAS# 1391052-54-2;241825-87-6(free base)
    M.F.: C15H9BrNNaO4
    M.W.: 370.13
  • QB151430
    Bromfenac Impurity 4 Sodium salt
    CAS#  241496-82-2 (free base)
    M.F.: C14H9BrNNaO3
    M.W.: 342.12
  • QC202437
    Cefotaxime Impurity 11
    CAS# NA
    M.F.: C32H34N10O14S4
    M.W.: 910.93
  • QC202435
    Cefotaxime Impurity 9
    CAS# NA
    M.F.: C15H19N5O6S2
    M.W.: 429.47
  • QC202434
    Cefotaxime Impurity 8
    CAS# NA
    M.F.: C16H19N5O8S2
    M.W.: 473.48
  • QC202431
    Cefotaxime Impurity 5
    CAS# 64485-89-8
    M.F.: C27H25N3O3S
    M.W.: 471.57
  • QC202430
    Cefotaxime Impurity 4
    CAS# 64485-88-7
    M.F.: C8H11N3O3S
    M.W.: 229.26
  • QC202429
    Cefotaxime Impurity 3
    CAS# NA
    M.F.: C7H10BrNO4
    M.W.: 252.06
  • QC202428
    Cefotaxime Impurity 2
    CAS# 66340-86-1
    M.F.: C7H11NO4
    M.W.: 173.17
  • QT060367
    Tofacitinib Impurity 67
    CAS# 2459302-87-3
    M.F.: C26H26Cl2N8
    M.W.: 521.44
  • QE201803
    Emtricitabine Impurity C
    CAS# NA
    M.F.: C8H9FN2O5S
    M.W.: 264.23
  • QS061902
    Sulfasalazine EP Impurity B
    CAS# 1391062-49-9
    M.F.: C29H22N8O7S2
    M.W.: 658.66
  • QT060366
    Tofacitinib Impurity 66
    CAS# 10132-07-7
    M.F.: C4H3Cl2N3
    M.W.: 163.99
  • QA261933
    Azilsartan
    CAS# 147403-03-0
    M.F.: C25H20N4O5
    M.W.: 456.45
  • QT140654
    Tenofovir Impurity 27
    CAS# NA
    M.F.: C12H20N5O4P
    M.W.: 329.29
  • QT140652
    Tenofovir Impurity 25
    CAS# 2488598-61-2
    M.F.: C15H18N5O4P
    M.W.: 363.31
  • QT140647
    Tenofovir Impurity 21
    CAS# NA
    M.F.: C6H13NO2
    M.W.: 131.17
  • QT140646
    Tenofovir Impurity 20
    CAS# 147127-19-3
    M.F.: C9H14N5O4P
    M.W.: 287.21
  • QP812518
    Paclitaxel EP Impurity R
    CAS# 158948-96-0
    M.F.: C45H55NO14
    M.W.: 833.92
  • QP812517
    Paclitaxel EP Impurity Q
    CAS# 2243233-98-7
    M.F.: C46H55NO14
    M.W.: 845.93
  • QP812516
    Paclitaxel EP Impurity P
    CAS# 173101-56-9
    M.F.: C48H53NO14
    M.W.: 867.93
  • QP812515
    Paclitaxel EP Impurity O;
    N-cinnamoyl-N-debenzoylpaclitaxel

    CAS# 219783-77-4
    M.F.: C49H53NO14
    M.W.: 879.94
  • QP812514
    Paclitaxel EP Impurity N;Baccatin III
    CAS# 27548-93-2
    M.F.: C31H38O11
    M.W.: 586.63
  • QP812513
    Paclitaxel EP Impurity M
    CAS# NA
    M.F.: C47H53NO15
    M.W.: 871.92
  • QP812512
    Paclitaxel EP Impurity L
    CAS# 92950-39-5
    M.F.: C49H53NO15
    M.W.: 895.94
  • QP812511
    Paclitaxel EP Impurity K
    CAS# 148930-55-6
    M.F.: C53H65NO14Si
    M.W.: 968.17
  • QP812510
    Paclitaxel EP Impurity J
    CAS# 2757197-26-3
    M.F.: C49H53NO15
    M.W.: 895.94
  • QP812509
    Paclitaxel EP Impurity I
    CAS# 2157462-42-3
    M.F.: C61H62N2O16
    M.W.: 1079.15
  • QP812504
    Paclitaxel EP Impurity D;7-epi-Cephalomannine
    CAS# 150547-36-7
    M.F.: C45H53NO14
    M.W.: 831.90
  • QP812503
    Paclitaxel EP Impurity C;Paclitaxel C
    CAS# 153415-45-3
    M.F.: C46H57NO14
    M.W.: 847.94
  • QP812502
    Paclitaxel EP Impurity B;
    Cephalomannine

    CAS# 71610-00-9
    M.F.: C45H53NO14
    M.W.: 831.90
  • QP812501
    Paclitaxel EP Impurity A
    CAS# 173101-54-7
    M.F.: C45H53NO14
    M.W.: 831.90
  • QP812500
    Paclitaxel;
    Docetaxel EP Impurity F

    CAS# 33069-62-4
    M.F.: C47H51NO14
    M.W.: 853.91
  • QE122029
    Erlotinib Impurity 3
    CAS# 183320-15-2
    M.F.: C23H23N3O5
    M.W.: 421.45
  • QE122028
    Erlotinib Impurity 2
    CAS# 2512209-22-0;2712530-31-7(HCl salt)
    M.F.: C15H23NO6
    M.W.: 313.35
  • QE122027
    Erlotinib Impurity 1
    CAS# 183322-21-6
    M.F.: C12H11Cl3N2O2
    M.W.: 321.59
  • QI220226
    Ivabradine N-Oxide
    CAS# 2511244-97-4
    M.F.: C27H36N2O6
    M.W.: 484.58
  • QA202261
    Atorvastatin Impurity 11
    CAS# NA
    M.F.: C44H56FN3O8
    M.W.: 773.93
  • QA202234
    Atorvastatin Impurity O
    CAS# NA
    M.F.: C37H42F2N2O5
    M.W.: 632.74
  • QA202249
    Atorvastatin Impurity Ⅵ
    CAS# NA
    M.F.: C37H44N2O5
    M.W.: 596.76
  • QA202247
    Atorvastatin Impurity Ⅳ
    CAS# 693793-87-2
    M.F.: C40H46F2N2O5
    M.W.: 672.80
  • QA202244
    Atorvastatin Impurity Ⅲ
    CAS# 1105067-91-1
    M.F.: C40H48N2O5
    M.W.: 636.82
  • QA202243
    Atorvastatin Impurity Ⅱ
    CAS# 125995-13-3
    M.F.: C14H27NO4
    M.W.: 273.37
  • QA202242
    Atorvastatin Impurity Ⅰ
    CAS# 125971-96-2
    M.F.: C26H24FNO3
    M.W.: 417.47
  • QA202260
    Atorvastatin Impurity 10
    CAS# 2088732-01-6
    M.F.: C14H27NO4
    M.W.: 273.37
  • QA202258
    Atorvastatin Impurity 8
    CAS# 947586-93-8
    M.F.: C14H27NO4
    M.W.: 273.37
  • QA202257
    Atorvastatin Impurity 7
    CAS# 125971-94-0
    M.F.: C14H23NO4
    M.W.: 269.34
  • QA202254
    Atorvastatin Impurity 4
    CAS# 444577-70-2
    M.F.: C26H25NO3
    M.W.: 399.48
  • QA202252
    Atorvastatin Impurity 2
    CAS# 125971-57-5
    M.F.: C19H19NO2
    M.W.: 293.36
  • QA202251
    Atorvastatin Impurity 1
    CAS# 124401-38-3
    M.F.: C12H15NO2
    M.W.: 205.25
  • QC-P131201
    Pimelic acid;Adipic acid EP Impurity C
    CAS# 111-16-0
    M.F.: C7H12O4
    M.W.: 160.17
  • QL091627
    Lipoic Acid Impurity 1
    CAS# NA
    M.F.: C18H32N2O2S4
    M.W.: 436.72
  • QP190336
    Posaconazole Impurity 36
    CAS# 213381-02-3
    M.F.: C37H42F2N8O4
    M.W.: 700.78
  • QP190342
    Posaconazole Impurity 42
    CAS# 2243785-96-6
    M.F.: C37H42F2N8O4
    M.W.: 700.78
  • QF140207
    Fenofibrate EP Impurity G
    CAS# 217636-48-1
    M.F.: C24H27ClO6
    M.W.: 446.92
  • QF140201
    Fenofibrate EP Impurity A
    CAS# 42019-78-3
    M.F.: C13H9ClO2
    M.W.: 232.66
  • QP190334
    Posaconazole Impurity 34
    CAS# 2173414-68-9
    M.F.: C13H20N2O2
    M.W.: 236.31
  • QP190332
    Posaconazole Impurity 19
    CAS# NA
    M.F.: C20H18ClF2N3O4S
    M.W.: 469.89
  • QP190331
    Posaconazole Impurity 16
    CAS# 2243786-07-2
    M.F.: C20H18ClF2N3O4S
    M.W.: 469.89
  • QP190330
    Posaconazole Impurity 15
    CAS# 2423024-27-3
    M.F.: C20H18ClF2N3O4S
    M.W.: 469.89
  • QC061229
    Cephalexin Impurity 3
    CAS# NA
    M.F.: C16H19N3O5S
    M.W.: 365.40
  • QC061228
    Cephalexin Impurity 2 
    CAS# 6485-67-2
    M.F.: C8H10N2O
    M.W.: 150.18
  • QC061226
    Cephalexin Impurity 1
    CAS# 19883-41-1;24461-61-8(free base)
    M.F.: C9H11NO2.HCl
    M.W.: 165.19 36.46
  • QC221210
    Clavulanate Potassium EP Impurity A
    CAS# 4744-51-8
    M.F.: C8H12N2O2
    M.W.: 168.19
  • QC242006
    Cefoxitin Sodium EP Impurity F (S-methoxy cefoxitin)
    CAS# NA
    M.F.: C17H19N3O8S2
    M.W.: 457.48
  • QC242010
    Cefoxitin Sodium EP Impurity E (R-methoxy cefoxitin)
    CAS# NA
    M.F.: C17H19N3O8S2
    M.W.: 457.48
  • QL062415
    Levofloxacin Impurity I
    CAS# 431058-46-7
    M.F.: C15H14FNO4
    M.W.: 291.27
  • QC081331
    Calcitriol EP Impurity A
    CAS# 73837-24-8
    M.F.: C27H44O3
    M.W.: 416.65
  • QC061851
    Cefuroxime Impurity 10
    CAS# NA
    M.F.: C16H15N4NaO9S
    M.W.: 462.37
  • QT060358
    Tofacitinib Impurity 32
    CAS# NA
    M.F.: C20H24ClN5
    M.W.: 369.89
  • QT060357
    Tofacitinib Impurity 31
    CAS# NA
    M.F.: C20H24ClN5
    M.W.: 369.89
  • QT060356
    Tofacitinib Impurity 30
    CAS# NA
    M.F.: C20H24ClN5
    M.W.: 369.89
  • QL052228
    Levocetirizine Impurity 2
    CAS# 300543-56-0
    M.F.:  C17H19ClN2
    M.W.: 286.81
  • QG130306
    Gemcitabine Impurity E
    CAS# NA
    M.F.: C23H19F2N3O6
    M.W.: 471.41
  • QG130307
    Gemcitabine Impurity G
    CAS# NA
    M.F.: C16H16ClF2N3O5
    M.W.: 403.77
  • QG130331
    Gemcitabine EP Impurity B
    CAS# 95058-85-8;122111-05-1 (HCl salt)
    M.F.: C9H11F2N3O4
    M.W.: 263.20
  • QG130329
    Gemcitabine Impurity 3
    CAS# 1173824-58-2
    M.F.: C19H16F2O6
    M.W.: 378.32
  • QG130328
    Gemcitabine Impurity 2
    CAS# 134877-43-3
    M.F.: C20H18F2O8S
    M.W.: 456.41
  • QG130327
    Gemcitabine Impurity 1
    CAS# 134877-42-2
    M.F.: C20H18F2O8S
    M.W.: 456.41
  • QC061849
    Cefuroxime Impurity 8
    CAS# NA
    M.F.: C8H10N2O4S
    M.W.: 230.24
  • QF141928
    Finasteride Impurity 2
    CAS# 2760543-46-0
    M.F.: C23H36N2O3
    M.W.: 388.54
  • QC071203
    Carglumic Acid Impurity 3
    CAS# NA
    M.F.: C7H11N3O6
    M.W.: 233.18
  • QC071202
    Carglumic Acid Impurity 2
    CAS# NA
    M.F.: C11H17N3O8
    M.W.: 319.27
  • QC071201
    Carglumic Acid Impurity 1
    CAS# NA
    M.F.: C12H18N4O9
    M.W.: 362.29
  • QH042407
    Hydroxychloroquine O-Acetate
    CAS#  47493-14-1
    M.F.: C20H28ClN3O2
    M.W.: 377.92
  • QT060355
    Tofacitinib Impurity 29
    CAS# 2504210-38-0
    M.F.: C19H22N8
    M.W.: 362.43
  • QT060354
    Tofacitinib Impurity 28
    CAS# NA
    M.F.: C23H31N7O3
    M.W.: 453.54
  • QT060353
    Tofacitinib Impurity 27
    CAS# 2227199-31-5
    M.F.: C20H29N5O3
    M.W.: 387.48
  • QA070231
    Argatroban Impurity 5
    CAS# 20668-20-6
    M.F.: C10H13N
    M.W.: 147.22
  • QE022002
    Ebastine EP Impurity B
    CAS# 943-27-1
    M.F.: C12H16O
    M.W.: 176.25
  • QA122210
    Alvimopan (2R, 3S, 4S)-Isomer
    CAS# NA
    M.F.: C25H32N2O4
    M.W.: 424.53
  • QC160718
    2-Oxo Clopidogrel Hydrochloride
    CAS# 1219432-42-4 ;109904-27-0(free base)
    M.F.: C16H17Cl2NO3S
    M.W.: 374.28
  • QT261841
    Tazarotenic Acid Sulfoxide
    CAS# 603952-64-3
    M.F.: C19H17NO3S
    M.W.:  339.42
  • QD031230
    Daclatasvir Impurity 30
    CAS# NA
    M.F.: C38H48N8O4
    M.W.: 680.84
  • QD031235
    Daclatasvir Impurity 35
    CAS# NA
    M.F.: C41H52N8O6
    M.W.: 752.90
  • QC031208
    Cefaclor EP Impurity H
    CAS# NA
    M.F.: C23H21ClN4O5S
    M.W.: 500.95
  • QA201804
    Aztreonam USP Impurity D
    CAS# 102579-59-9 (free base)
    M.F.: C13H17N5O5S.C2HF3O2
    M.W.: 355.37 114.02
  • QA040628
    Adefovir Impurity 1
    CAS# NA
    M.F.: C26H42N5O10P
    M.W.: 615.61
  • QA040627
    Adefovir Dipivoxil Intermediate
    CAS# 116384-53-3
    M.F.: C12H20N5O4P
    M.W.: 329.29
  • QD122040
    Dolutegravir
    CAS# 1051375-16-6;1051375-19-9(Na salt)
    M.F.: C20H19F2N3O5
    M.W.: 419.38
  • QD020739
    Dabigatran Impurity 10
    CAS# 1610758-19-4
    M.F.: C35H43N7O5
    M.W.: 641.76
  • QD020736
    Dabigatran Impurity 7
    CAS# NA
    M.F.: C10H14N2O2
    M.W.: 194.23
  • QS180609
    Sorafenib tosylate Impurity I
    CAS# 1129683-83-5
    M.F.: C14H10ClF3N2O2
    M.W.: 330.69
  • QA070227
    Argatroban Impurity 1
    CAS# 153886-69-2
    M.F.: C10H9NO3S
    M.W.: 223.25
  • QA200328
    Atracurium Besylate Impurity 2
    CAS# NA
    M.F.: C58H74N2O15S
    M.W.: 1071.28
  • QL220327
    Levocarnitine Impurity 27
    CAS# 2788-28-5
    M.F.: C7H15ClN2O
    M.W.: 178.66
  • QT260422
    Trazodone hydrochloride Impurity V
    CAS# NA
    M.F.: C13H18Cl2N4O
    M.W.: 317.21
  • QT260419
    Trazodone hydrochloride Impurity S
    CAS# NA
    M.F.: C19H22ClN5O2
    M.W.: 387.86
  • QT260418
    Trazodone hydrochloride EP Impurity J;
    Trazodone hydrochloride Impurity R

    CAS# 1263358-12-8;1263278-79-0(HCl salt)
    M.F.: C19H21Cl2N5O
    M.W.: 406.31
  • QT260417
    Trazodone hydrochloride Impurity Q
    CAS# 1346603-99-3
    M.F.: C19H22ClN5O3
    M.W.: 403.86
  • QT260413
    Trazodone hydrochloride Impurity M
    CAS# NA
    M.F.: C14H21Cl2N3
    M.W.: 302.24
  • QT260412
    Trazodone hydrochloride EP Impurity I;
    Trazodone hydrochloride Impurity L

    CAS# 32229-98-4
    M.F.: C13H19ClN2O
    M.W.: 254.76
  • QT260411
    Trazodone hydrochloride Impurity K
    CAS# NA
    M.F.: C10H14Cl2N2
    M.W.: 233.14
  • QT260409
    Trazodone hydrochloride Impurity I
    CAS# NA
    M.F.: C15H14N6O2
    M.W.: 310.31
  • QT260408
    Trazodone hydrochloride EP Impurity H
    CAS# 6323-09-7;2408971-27-5(2HCl salt)
    M.F.: C23H30Cl2N4
    M.W.: 433.42
  • QT260407
    Trazodone hydrochloride EP Impurity G
    CAS# 2470436-00-9;2470441-00-8(HCl salt)
    M.F.: C17H27ClN2O
    M.W.: 310.86
  • QT260405
    Trazodone hydrochloride EP Impurity E
    CAS# 1346599-35-6
    M.F.: C21H26ClN5O
    M.W.: 399.92
  • QT260403
    Trazodone hydrochloride EP Impurity C
    CAS# 157072-19-0;1263278-77-8(HCl salt)
    M.F.: C19H22ClN5O
    M.W.: 371.86
  • QT260402
    Trazodone hydrochloride EP Impurity B
    CAS# 62337-66-0
    M.F.: C19H23N5O
    M.W.: 337.42
  • QE151331
    Esomeprazole Impurity 14
    CAS# 1227380-90-6;2227107-89-1(NH4+ salt)
    M.F.: C16H15N3O4
    M.W.: 313.31
  • QI220224
    Ivabradine Impurity 5
    CAS# 304464-98-0
    M.F.: C26H34N2O5
    M.W.: 454.56
  • QB031431
    Bucinnazine hydrochloride Impurity 5
    CAS# NA
    M.F.: C9H18N2O
    M.W.: 170.25
  • QB031429
    Bucinnazine hydrochloride Impurity 3
    CAS# NA
    M.F.: C13H18N2O
    M.W.: 218.29
  • QB031428
    Bucinnazine hydrochloride Impurity 2
    CAS# NA
    M.F.: C14H18N2O
    M.W.: 230.31
  • QB031427
    Bucinnazine hydrochloride Impurity 1
    CAS# NA
    M.F.: C5H10N2O
    M.W.: 114.15
  • QA070241
    Argatroban Impurity 15
    CAS# NA
    M.F.: C11H11NO3S
    M.W.: 237.27
  • QA070240
    Argatroban Impurity 14
    CAS# NA
    M.F.: C12H13NO3S
    M.W.: 251.30
  • QA070237
    Argatroban Impurity 11
    CAS# 2423016-01-5
    M.F.: C23H35N5O6S
    M.W.: 509.62
  • QL040327
    Lidocaine Impurity 1
    CAS# 294852-91-8
    M.F.: C18H22N2O
    M.W.: 282.38
  • QC030340
    Cinacalcet Impurity 9
    CAS# NA
    M.F.: C22H23ClF3NO
    M.W.: 409.87
  • QC030339
    Cinacalcet Impurity 8
    CAS# 1224568-02-8;1273259-50-9(HCl)
    M.F.: C22H22F3NO
    M.W.: 373.41
  • QC120430
    Clindamycin Phosphate EP Impurity D;
    Clindamycin 4-Phosphate

    CAS# 54887-30-8
    M.F.: C18H34ClN2O8PS
    M.W.: 504.96
  • QC182534
    1-Methoxy Canagliflozin
    CAS# 1358581-37-9
    M.F.: C25H27FO6S
    M.W.: 474.54
  • QC060427
    Cefodizime Impurity 1
    CAS# 120533-30-4
    M.F.: C20H20N6O7S4
    M.W.: 584.67
  • QB201438
    Bortezomib Impurity 12
    CAS# NA
    M.F.: C24H38BClN2O3
    M.W.: 448.83
  • QB201436
    Bortezomib Impurity 10
    CAS# NA
    M.F.: C24H38BClN2O3
    M.W.: 448.83
  • QP182446
    Paroxetine Impurity 8
    CAS# NA
    M.F.: C14H21NO2
    M.W.: 235.32
  • QP182445
    Paroxetine Impurity 7
    CAS# NA
    M.F.: C13H19NO
    M.W.: 205.30
  • QP136040
    Pidotimod Impurity 14
    CAS# NA
    M.F.: C10H12N2O4S
    M.W.: 256.28
  • QP180631
    Pirfenidone Impurity 5
    CAS# NA
    M.F.: C13H13N3O2
    M.W.: 243.26
  • QP180630
    Pirfenidone Impurity 4
    CAS# NA
    M.F.: C25H21N5O4
    M.W.: 455.47
  • QP180628
    Pirfenidone Impurity 2
    CAS# 284462-78-8
    M.F.: C13H13N3O2
    M.W.: 243.26
  • QP180627
    Pirfenidone Impurity 1
    CAS# 1153328-25-6
    M.F.: C13H13N3O2
    M.W.: 243.26
  • QF132009
    Formoterol EP Impurity I
    CAS# 532414-36-1
    M.F.: C19H24N2O4
    M.W.: 344.40
  • QP081815
    Phloroglucinol EP Impurity O
    CAS# 137-19-9
    M.F.: C6H4Cl2O2
    M.W.: 179.00
  • QP081812
    Phloroglucinol EP Impurity L
    CAS# 626-43-7
    M.F.: C6H5Cl2N
    M.W.: 162.02
  • QP081809
    Phloroglucinol EP Impurity I
    CAS# 87-65-0
    M.F.: C6H4Cl2O
    M.W.: 163.00
  • QP081805
    Phloroglucinol EP Impurity E
    CAS# 533-73-3
    M.F.: C6H6O3
    M.W.: 126.11
  • QP081804
    Phloroglucinol EP Impurity D
    CAS# 491-45-2
    M.F.: C12H10O5
    M.W.: 234.20
  • QP081801
    Phloroglucinol EP Impurity A
    CAS# 87-66-1
    M.F.: C6H6O3
    M.W.: 126.11
  • QC202600
    Ceftizoxime sodium
    CAS# 68401-82-1
    M.F.: C13H12N5NaO5S2
    M.W.: 405.38
  • QP156507
    Progesterone EP Impurity G 
    CAS# 2257421-79-5
    M.F.: C27H38O2
    M.W.: 394.59
  • QP156503
    Progesterone EP Impurity C 
    CAS# 145-15-3
    M.F.: C21H32O2
    M.W.: 316.49
  • QP156501
    Progesterone EP Impurity A 
    CAS# 24377-08-0
    M.F.: C21H28O2
    M.W.: 312.45
  • QD241332
    Dexamethasone Acetate EP Impurity I
    CAS# 3949-26-6
    M.F.: C26H33FO7
    M.W.: 476.53
  • QD241309
    Dexamethasone EP Impurity I
    CAS# 14622-47-0
    M.F.: C22H28O5
    M.W.: 372.45
  • QP131215
    Pomalidomide Impurity O
    CAS# 50-35-1
    M.F.: C13H10N2O4
    M.W.: 258.23
  • QP131206
    Pomalidomide Impurity F
    CAS# 191732-76-0
    M.F.: C13H11N3O4
    M.W.: 273.24
  • QP131213
    Pomalidomide Impurity M
    CAS# 5434-20-8;6946-22-1(HCl salt);1852533-96-0(HCl dihydrate)
    M.F.: C8H7NO4
    M.W.: 181.15
  • QP131205
    Pomalidomide Impurity E
    CAS# 19171-18-7
    M.F.: C13H9N3O6
    M.W.: 303.23
  • QP131203
    Pomalidomide Impurity C
    CAS# 918314-45-1
    M.F.: C13H13N3O5
    M.W.: 291.26
  • QP131210
    Pomalidomide Impurity J
    CAS# 2635-64-5
    M.F.: C13H13N3O5
    M.W.: 291.26
  • QP131202
    Pomalidomide Impurity B
    CAS# 497147-11-2
    M.F.: C13H11N3O5
    M.W.: 289.24
  • QF030333
    Famciclovir Impurity 7
    CAS# 127205-22-5
    M.F.: C10H15N5O3
    M.W.:  253.26
  • QB131600
    Bimatoprost Acid
    CAS# 38344-08-0
    M.F.: C23H32O5
    M.W.: 388.50
  • QB131627
    Bimatoprost Impurity 1;
    (15R)-Bimatoprost

    CAS# 1163135-92-9
    M.F.: C25H37NO4
    M.W.: 415.57
  • QT060352
    Tofacitinib Impurity 26
    CAS# 1812890-23-5
    M.F.: C13H21N5
    M.W.: 247.34
  • QT060351
    Tofacitinib Impurity 25
    CAS# NA
    M.F.: C16H20N6O2
    M.W.: 328.37
  • QT060350
    Tofacitinib Impurity 24
    CAS# 2459302-85-1
    M.F.: C21H27N7O3
    M.W.: 425.48
  • QT060348
    Tofacitinib Impurity 22
    CAS# 1640972-35-5;1809002-40-1(citrate salt)
    M.F.: C16H22N6O
    M.W.: 314.39
  • QA120712
    Alogliptin Impurity L
    CAS# NA
    M.F.: C18H22N4O4
    M.W.: 358.39
  • QA120711
    Alogliptin Impurity K
    CAS# 865758-98-1
    M.F.: C17H19N5O2
    M.W.: 325.37
  • QA120710
    Alogliptin Impurity J
    CAS# 2089611-85-6
    M.F.: C18H21N5O2
    M.W.: 339.39
  • QL050318
    Lercanidipine Impurity 4
    CAS# 1119226-97-9
    M.F.: C35H37N3O6
    M.W.: 595.68
  • QT120200
    Tulobuterol Hydrochloride
    CAS# 56776-01-3;41570-61-0(free base)
    M.F.: C12H19Cl2NO
    M.W.: 264.19
  • QA070203
    Argatroban Impurity C
    CAS# 951130-92-0
    M.F.: C23H32N6O5S
    M.W.: 504.60
  • QA070201
    Argatroban Impurity A
    CAS# 1448301-07-2
    M.F.: C23H35N7O7S
    M.W.: 553.63
  • QC030337
    Cinacalcet Impurity 7
    CAS# NA
    M.F.: C23H25ClF3N
    M.W.: 407.90
  • QC030336
    Cinacalcet Impurity 6
    CAS# 1020414-33-8 ;802918-35-0(free base)
    M.F.: C22H25ClF3N
    M.W.: 395.89
  • QC030335
    Cinacalcet Impurity 5
    CAS# NA
    M.F.: C13H15N
    M.W.: 185.26
  • QC030334
    Cinacalcet Impurity 4
    CAS# NA
    M.F.: C12H16ClN
    M.W.: 209.72
  • QC030332
    Cinacalcet Impurity 2
    CAS# NA
    M.F.: C12H18ClN
    M.W.: 211.73
  • QD020735
    Dabigatran Etexilate Impurity 6
    CAS# NA
    M.F.: C13H14N4O
    M.W.: 242.28
  • QD020734
    Dabigatran Etexilate Impurity 5
    CAS# NA
    M.F.: C11H14N2O4
    M.W.: 238.24
  • QD020733
    Dabigatran Etexilate Impurity 4
    CAS# 104961-64-0
    M.F.: C8H10N2O2
    M.W.: 166.18
  • QD020732
    Dabigatran Etexilate Impurity 3
    CAS# 89-41-8
    M.F.: C8H7NO5
    M.W.: 197.14
  • QD020730
    Dabigatran Etexilate Impurity 1
    CAS# 36242-50-9
    M.F.: C9H10N2O4
    M.W.: 210.19
  • QH042430
    Hydroxychloroquine sulfate EP Impurity G
    CAS# 86-98-6
    M.F.: C9H5Cl2N
    M.W.: 198.05
  • QH042429
    Hydroxychloroquine sulfate Impurity 3
    CAS# 86-99-7
    M.F.: C9H6ClNO
    M.W.: 179.60
  • QH042428
    Hydroxychloroquine sulfate Impurity 2
    CAS# 5891-21-4
    M.F.: C5H9ClO
    M.W.: 120.58
  • QH042427
    Hydroxychloroquine sulfate Impurity 1
    CAS# 21617-18-5
    M.F.: C9H5Cl2N
    M.W.: 198.05
  • QC182533
    Canagliflozin Impurity 7
    CAS# NA
    M.F.: C24H25FO5S
    M.W.: 444.52
  • QE200331
    Entecavir EP Impurity F
    CAS# 649761-24-0
    M.F.: C27H31N5O2Si
    M.W.: 485.65
  • QP080504
    Phenytoin Sodium EP Impurity D
    CAS# 5157-15-3
    M.F.: C16H14N4O2
    M.W.: 294.32
  • QT041243
    Tadalafil Impurity 21
    CAS# NA
    M.F.: C19H17ClN2O4
    M.W.: 372.80
  • QT022001
    Terbutaline EP Impurity A
    CAS# 99-10-5
    M.F.: C7H6O4
    M.W.: 154.12
  • QT060347
    Tofacitinib Impurity 21
    CAS# NA
    M.F.: C23H26N6O3S
    M.W.: 466.56
  • QE131927
    Exemestane Impurity 1
    CAS# NA
    M.F.: C19H26O2
    M.W.: 286.41
  • QO022031
    Obeticholic Acid Impurity 5
    CAS# 1537866-49-1
    M.F.: C26H46O3
    M.W.: 406.65
  • QO022029
    Obeticholic Acid Impurity 3
    CAS# 1908444-28-9
    M.F.: C52H86O7
    M.W.: 823.24
  • QO022027
    Obeticholic Acid Impurity 1
    CAS# 1708092-13-0
    M.F.: C26H44O4
    M.W.: 420.63
  • QO022028
    Obeticholic Acid Impurity 2
    CAS# 915038-27-6
    M.F.: C26H44O4
    M.W.: 420.63
  • QL191833
    Lesinurad Impurity 13
    CAS# NA
    M.F.: C17H13Br2N3O2S
    M.W.: 483.18
  • QL191832
    Lesinurad Impurity 12
    CAS# NA
    M.F.: C17H12Br3N3O2S
    M.W.: 562.07
  • QL191831
    Lesinurad Impurity 11
    CAS# NA
    M.F.: C17H14BrN3O2S
    M.W.: 404.28
  • QL191824
    Lesinurad Impurity 4
    CAS# 1533519-97-9
    M.F.: C17H14BrN3O2S
    M.W.: 404.28
  • QL191830
    Lesinurad Impurity 10
    CAS# NA
    M.F.: C16H14BrN3O2S
    M.W.: 392.27
  • QL191828
    Lesinurad Impurity 8
    CAS# 1158970-49-0
    M.F.: C15H12BrN3O2S
    M.W.: 378.25
  • QG131814
    Gimeracil Impurity 14
    CAS# 89942-45-0
    M.F.: C8H7NO
    M.W.: 133.15
  • QH042406
    Hydroxychloroquine sulfate EP Impurity F
    CAS# 6281-58-9
    M.F.: C14H15ClN2
    M.W.: 246.74
  • QH042405
    Hydroxychloroquine sulfate EP Impurity E
    CAS# 10500-64-8
    M.F.: C14H17ClN2O
    M.W.: 264.75
  • QC182532
    Canagliflozin Impurity 6
    CAS# 542-69-8
    M.F.: C4H9I
    M.W.: 184.02
  • QC182531
    Canagliflozin Impurity 5
    CAS# NA
    M.F.: C24H25FO5S
    M.W.: 444.52
  • QC182530
    Canagliflozin Impurity 4
    CAS# 2005454-69-1
    M.F.: C18H15FS
    M.W.: 282.38
  • QC182529
    Canagliflozin Impurity 3
    CAS# 2338840-88-1
    M.F.: C18H15FOS
    M.W.: 298.37
  • QC182528
    Canagliflozin Impurity 2
    CAS# NA
    M.F.: C24H27FO6S
    M.W.: 462.53
  • QA261930
    Azilsartan Impurity 2
    CAS# 147403-52-9
    M.F.: C26H22N4O5
    M.W.: 470.48
  • QE201927
    LCZ696
    CAS# 936623-90-4
    M.F.: C48H55N6Na3O8.5/2H2O
    M.W.: 912.96 45.05
  • QA261929
    Azilsartan Impurity 1
    CAS# 1403474-70-3
    M.F.: C27H24N4O5
    M.W.: 484.50
  • QI071832
    Iguratimod Impurity 6
    CAS# 76838-72-7
    M.F.: C13H13NO2
    M.W.: 215.25
  • QI071831
    Iguratimod Impurity 5
    CAS# 84594-95-6
    M.F.: C13H11NO4
    M.W.: 245.24
  • QI071827
    Iguratimod Impurity 1
    CAS# 16156-59-5
    M.F.: C7H8O3S
    M.W.: 172.20
  • QE151330
    Esomeprazole Impurity 13
    CAS# 615-05-4;614-94-8(2HCl salt)
    M.F.: C7H10N2O
    M.W.: 138.17
  • QE151328
    Esomeprazole Impurity 11
    CAS# 610-81-1
    M.F.: C6H6N2O3
    M.W.: 154.12
  • QC160729
    Clopidogrel Impurity 29
    CAS# 53885-64-6
    M.F.: C14H11Cl2NS
    M.W.: 296.21
  • QT140688
    Tenofovir Impurity 54
    CAS# 390409-27-5
    M.F.: C19H25N6O5P
    M.W.: 448.41
  • QT140687
    Tenofovir Impurity 53
    CAS# NA
    M.F.: C21H29N6O5P
    M.W.: 476.47
  • QT140684
    Tenofovir Impurity 50
    CAS# NA
    M.F.: C16H20N5O4P
    M.W.: 377.33
  • QT140683
    Tenofovir Impurity 49
    CAS# NA
    M.F.: C16H20N5O4P
    M.W.: 377.33
  • QT140682
    Tenofovir Impurity 48
    CAS# 383365-04-6
    M.F.: C21H29N6O5P
    M.W.: 476.47
  • QP132610
    Promethazine Sulfone
    CAS# 13754-56-8
    M.F.: C17H20N2O2S
    M.W.: 316.42
  • QC190604
    Caspofungin Impurity D
    CAS# NA
    M.F.: C50H82N8O16
    M.W.: 1051.23
  • QC190602
    Caspofungin Impurity B
    CAS# NA
    M.F.: C52H88N10O15
    M.W.: 1093.31
  • QC190610
    Caspofungin Impurity I
    CAS# 251095-73-5
    M.F.: C52H88N10O15
    M.W.: 1093.31
  • QG021800
    Glibornuride (Mixture of Diastereomers)
    CAS# 26944-48-9
    M.F.: C18H26N2O4S
    M.W.:  366.48
  • QC061848
    Cefuroxime axetil dimer
    CAS# 1202925-10-7
    M.F.: C36H38N8O17S2
    M.W.: 918.86
  • QT182628
    Terazosin EP Impurity N
    CAS# 63074-07-7
    M.F.: C9H16N2O2
    M.W.: 184.24
  • QT182627
    Terazosin Impurity 1
    CAS# 16874-33-2
    M.F.: C5H8O3
    M.W.: 116.12
  • QP136039
    Pidotimod Impurity 13 
    CAS# NA
    M.F.: C8H13NO3S
    M.W.: 203.26
  • QT022010
    Terbutaline Impurity 10
    CAS# 52144-90-8;28924-20-1(HBr salt)
    M.F.: C26H29NO3
    M.W.: 403.51
  • QD171203
    Dequalinium chloride EP Impurity C
    CAS# NA
    M.F.: C50H69I3N6
    M.W.: 1134.84
  • QD171202
    Dequalinium chloride EP Impurity B
    CAS# 171980-52-2(Cl-)
    M.F.: C30H39IN4
    M.W.: 582.56
  • QD030432
    Diclofenac Impurity 32
    CAS# 90798-25-7
    M.F.: C10H9Cl2NO2
    M.W.: 246.09
  • QD030431
    Diclofenac Impurity 31
    CAS# NA
    M.F.: C20H13Cl4NO2
    M.W.: 441.13
  • QD030430
    Diclofenac Impurity 30
    CAS# 123790-84-1
    M.F.: C12H9BrClN
    M.W.: 282.56
  • QD030428
    Diclofenac Impurity 28
    CAS# NA
    M.F.: C22H15Cl4NO4
    M.W.: 499.17
  • QL141236
    Linagliptin Impurity 36
    CAS# NA
    M.F.: C10H6D3BrN4O2
    M.W.: 300.13
  • QF226829
    Fasudil Impurity 3
    CAS# 1423155-03-6
    M.F.: C14H17N3O2S
    M.W.: 291.37
  • QP181328
    Pramipexole Impurity 2
    CAS# 1052691-22-1
    M.F.: C10H19N3S
    M.W.: 213.34
  • QD201927
    5β-Dutasteride Impurity
    CAS# 957229-52-6
    M.F.: C27H30F6N2O2
    M.W.: 528.53
  • QD201908
    Dutasteride EP Impurity G
    CAS# 1430804-85-5
    M.F.: C27H28F6N2O2
    M.W.: 526.51
  • QN140438
    Intedanib Impurity 12
    CAS# 1139453-98-7
    M.F.: C14H20N4O3
    M.W.: 292.33
  • QN140437
    Intedanib Impurity 11
    CAS# 2653-16-9
    M.F.: C9H9ClN2O3
    M.W.: 228.63
  • QN140436
    Intedanib Impurity 10
    CAS# 100-15-2
    M.F.: C7H8N2O2
    M.W.: 152.15
  • QN140435
    Intedanib Impurity 9
    CAS# 98-07-7
    M.F.: C7H5Cl3
    M.W.: 195.47
  • QN140434
    Intedanib Impurity 8
    CAS# 1125-88-8
    M.F.: C9H12O2
    M.W.: 152.19
  • QN140433
    Intedanib Impurity 7;
    Guaiacol EP Impurity E

    CAS# 93-58-3
    M.F.: C8H8O2
    M.W.: 136.15
  • QN140432
    Intedanib Impurity 6
    CAS# 707-07-3
    M.F.: C10H14O3
    M.W.: 182.22
  • QN140431
    Intedanib Impurity 5
    CAS# 40872-87-5
    M.F.: C8H8ClNO2
    M.W.: 185.61
  • QN140430
    Intedanib Impurity 4
    CAS# 2840-28-0
    M.F.: C7H6ClNO2
    M.W.: 171.58
  • QN140429
    Intedanib Impurity 3
    CAS# 1160293-27-5
    M.F.: C13H13NO8
    M.W.: 311.24
  • QN140428
    Intedanib Impurity 2
    CAS# 14719-83-6
    M.F.: C8H6ClNO4
    M.W.: 215.59
  • QN140427
    Intedanib Impurity 1
    CAS# 96-99-1
    M.F.: C7H4ClNO4
    M.W.: 201.56
  • QN032005
    Nicotinic Acid EP Impurity E;
    Isoniazid EP Impurity A

    CAS# 55-22-1
    M.F.: C6H5NO2
    M.W.: 123.11
  • QI210429
    Ibuprofen Impurity 3
    CAS# NA
    M.F.: C15H22O3
    M.W.: 250.33
  • QI210428
    Ibuprofen Impurity 2
    CAS# 623-61-0
    M.F.: C5H10O3
    M.W.: 118.13
  • QP122407
    Plerixafor Impurity G
    CAS# 771464-86-9
    M.F.: C46H84N12
    M.W.: 805.24
  • QP122405
    Plerixafor Impurity E
    CAS# 176252-20-3
    M.F.: C18H32N4O
    M.W.: 320.47
  • QP122404
    Plerixafor Hydrochloride
    CAS# 155148-31-5
    M.F.: C28H54N8
    M.W.: 502.78
  • QI220222
    Ivabradine Impurity 3
    CAS# 1132667-04-9;1204612-29-2(HCl salt)
    M.F.: C12H17NO2
    M.W.: 207.27
  • QE130401
    Emedastine EP Impurity F
    CAS# NA
    M.F.: C15H24N4O
    M.W.: 276.38
  • QP136038
    Pidotimod Impurity 12
    CAS# 4128-37-4
    M.F.: C7H16N2O
    M.W.: 144.21
  • QP136037
    Pidotimod Impurity 11
    CAS# 42258-90-2
    M.F.: C5H9NO2S
    M.W.: 147.20
  • QE042236
    Edaravone Impurity 10
    CAS# 53341-66-5
    M.F.: C11H13NO3
    M.W.: 207.23
  • QE042235
    Edaravone Impurity 9
    CAS# 100-65-2
    M.F.: C6H7NO
    M.W.: 109.13
  • QE042234
    Edaravone Impurity 8
    CAS# NA
    M.F.: C10H12N2O
    M.W.: 176.22
  • QE042233
    Edaravone Impurity 7
    CAS# 92-43-3
    M.F.: C9H10N2O
    M.W.: 162.19
  • QE042230
    Edaravone Impurity 4
    CAS# 177415-76-8
    M.F.: C20H18N4O2
    M.W.: 346.38
  • QD141627
    Donepezil Impurity 1;
    Donepezil EP Impurity B

    CAS# 2107-69-9
    M.F.: C11H12O3
    M.W.: 192.22
  • QC061847
    Cefuroxime Axetil Impurity 7
    CAS# NA
    M.F.: C9H11N3O5S
    M.W.: 273.27
  • QC061846
    Cefuroxime Axetil Impurity 6
    CAS# NA
    M.F.: C15H17N3O8S
    M.W.: 399.38
  • QC061843
    Cefuroxime Axetil Impurity 3
    CAS# 69384-96-9
    M.F.: C7H7NO4
    M.W.: 169.13
  • QC061842
    Cefuroxime Axetil Impurity 2
    CAS# NA
    M.F.: C6H12O3
    M.W.: 132.16
  • QC061841
    Cefuroxime Axetil Impurity 1
    CAS# NA
    M.F.: C4H6Br2O2
    M.W.: 245.90
  • QP202239
    Pitavastatin Impurity 13
    CAS# 2124275-54-1
    M.F.: C13H22O5
    M.W.: 258.31
  • QP202238
    Pitavastatin Impurity 12
    CAS# NA
    M.F.: C13H22O5
    M.W.: 258.31
  • QF226828
    Fasudil Impurity 2
    CAS# NA
    M.F.: C9H7NO3S
    M.W.: 209.22
  • QL130609
    Lamivudine EP Impurity I
    CAS# 145918-75-8
    M.F.: C8H11N3O4
    M.W.: 213.19
  • QD190627
    Doxofylline Impurity 1
    CAS# 1429636-74-7
    M.F.: C10H16N4O3 
    M.W.: 240.26
  • QC180802
    Chlorphenamine EP Impurity B
    CAS# 1202-34-2
    M.F.: C10H9N3
    M.W.: 171.20
  • QC180801
    Chlorphenamine EP Impurity A
    CAS# 1246816-57-8;2575516-39-9(2HCl salt)
    M.F.: C16H24ClN3
    M.W.: 293.83
  • QE151316
    Esomeprazole Impurity 7
    CAS# 727375-13-5
    M.F.: C8H11NO2
    M.W.: 153.18
  • QE151313
    Esomeprazole Impurity 4
    CAS# 73590-93-9
    M.F.: C8H10ClN.HCl
    M.W.: 155.63 36.46
  • QL040302
    Lidocaine EP Impurity B;
    Lidocaine N-oxide

    CAS# 2903-45-9
    M.F.: C14H22N2O2
    M.W.: 250.34
  • QL050315
    Lercanidipine Impurity 1
    CAS# 74936-72-4
    M.F.: C16H16N2O6
    M.W.: 332.31
  • QC121201
    Cholecalciferol EP Impurity A;
    trans-Cholecalciferol;trans-Vitamin D3

    CAS# 22350-41-0
    M.F.: C27H44O
    M.W.: 384.64
  • QI220220
    Ivabradine Impurity 1
    CAS# 2247881-26-9
    M.F.: C26H34N2O5
    M.W.: 454.56
  • QS120716
    Saxagliptin (S,R,S,R)-Isomer
    CAS# 1564266-03-0
    M.F.: C18H25N3O2
    M.W.: 315.41
  • QS120711
    Saxagliptin (S,S,S,R)-Isomer
    CAS# 1564265-93-5
    M.F.: C18H25N3O2
    M.W.: 315.41
  • QA260312
    Azacitidine Impurity L
    CAS# 16352-06-0
    M.F.: C4H6N4O
    M.W.: 126.12
  • QA260310
    Azacitidine Impurity J
    CAS# 1415316-72-1
    M.F.: C12H16N4O7
    M.W.: 328.28
  • QA260309
    Azacitidine Impurity I
    CAS# NA
    M.F.: C10H14N4O6
    M.W.: 286.24
  • QA260308
    Azacitidine Impurity H
    CAS# NA
    M.F.: C9H14N4O5
    M.W.: 258.23
  • QA260313
    Azacitidine Impurity 13
    CAS# 105331-00-8
    M.F.: C8H13N5O5
    M.W.:  259.22
  • QA260307
    Azacitidine Impurity G
    CAS# 504-08-5
    M.F.: C3H5N5
    M.W.: 111.11
  • QS142012
    Sunitinib Ketone Impurity
    CAS# 2411816-47-0
    M.F.: C22H25FN4O3 
    M.W.:  412.47
  • QE151310
    Esomeprazole Impurity 1
    CAS# 862270-90-4
    M.F.: C7H12Cl2N2O
    M.W.: 211.09
  • QC042029
    Cefditoren pivaloyl
    CAS# 878002-84-7
    M.F.: C30H36N6O8S3
    M.W.: 704.84
  • QA261928
    Azilsartan Impurity (U-3)
    CAS# 1417576-00-1
    M.F.: C28H20N4O8
    M.W.: 540.48
  • QC120422
    Clindamycin Hydrochloride EP Impurity B;
    Clindamycin B

    CAS# 18323-43-8
    M.F.: C17H31ClN2O5S
    M.W.:  410.96
  • QP132029
    Pemetrexed Impurity 3
    CAS# 1075-59-8
    M.F.: C5H7N3O3
    M.W.: 157.13
  • QP132028
    Pemetrexed Impurity 2
    CAS# NA
    M.F.: C22H25N5O6
    M.W.: 455.46
  • QP132027
    Pemetrexed Impurity 1;
    DL-Glutamic acid

    CAS# 617-65-2
    M.F.: C5H9NO4
    M.W.: 147.13
  • QC042419
    Cefadroxil Dimer Trifluoroacetate
    CAS# NA
    M.F.: C34H33F3N6O11S2
    M.W.: 822.78
  • QC042417
    N-Phenylglycyl delta-3 cefadroxil
    CAS# NA
    M.F.: C24H24N4O7S
    M.W.: 512.53
  • QC042416
    Cefadroxil ethyl homolog
    CAS# 2243976-70-5
    M.F.: C17H19N3O5S
    M.W.: 377.41
  • QC042406
    Cefadroxil EP Impurity F
    CAS# NA
    M.F.: C24H24N4O7S
    M.W.: 512.53
  • QC042404
    Cefadroxil EP Impurity D;L-Cefadroxil
    CAS# 144790-28-3
    M.F.: C16H17N3O5S
    M.W.: 363.39
  • QC042403
    Cefadroxil EP Impurity C
    CAS# NA
    M.F.: C16H19N3O6S
    M.W.: 381.40
  • QP136036
    Pidotimod Impurity 10
    CAS# NA
    M.F.: C6H11NO3S
    M.W.: 177.22
  • QC160610
    Ciprofloxacin EP Impurity C HCl
    CAS# 528851-31-2
    M.F.: C15H17ClFN3O3
    M.W.: 341.77
  • QP202228
    Pitavastatin Impurity 2
    CAS# 1044518-75-3
    M.F.: C13H22O5
    M.W.: 258.31
  • QT140645
    Tenofovir Impurity 19
    CAS# 2053424-82-9;2055343-42-3(fumarate)
    M.F.: C21H29N6O5P
    M.W.: 476.47
  • QT060345
    Tofacitinib Impurity 20
    CAS# 1092578-48-7+1092578-46-5
    M.F.: C16H20N6O
    M.W.: 312.37
  • QP160414
    Paliperidone hydroxybenzoyl analog
    CAS# 152542-03-5
    M.F.: C23H28FN3O4
    M.W.: 429.48
  • QS120635
    Solifenacin EP Impurity I
    CAS# 180272-28-0
    M.F.: C23H26N2O3
    M.W.: 378.46
  • QS120634
    Solifenacin EP Impurity H
    CAS# 732228-02-3;862207-71-4(succinate salt)
    M.F.: C23H26N2O2
    M.W.: 362.46
  • QS120630
    Solifenacin EP Impurity D
    CAS# 2216750-52-4
    M.F.: C31H28N2O
    M.W.: 444.57
  • QS120629
    Solifenacin EP Impurity C
    CAS# 1534326-81-2
    M.F.: C31H28N2O
    M.W.: 444.57
  • QS120627
    Solifenacin EP Impurity A
    CAS# 118864-75-8
    M.F.: C15H15N
    M.W.: 209.29
  • QP182010
    Paracetamol EP Impurity J
    CAS# 539-03-7
    M.F.: C8H8ClNO
    M.W.: 169.61
  • QP182009
    Paracetamol EP Impurity I
    CAS# 118-93-4
    M.F.: C8H8O2
    M.W.: 136.15
  • QP182008
    Paracetamol EP Impurity H
    CAS# 2623-33-8
    M.F.: C10H11NO3
    M.W.: 193.20
  • QP182007
    Paracetamol EP Impurity G
    CAS# 34523-34-7
    M.F.: C8H9NO2
    M.W.: 151.16
  • QP182005
    Paracetamol EP Impurity E
    CAS# 99-93-4
    M.F.: C8H8O2
    M.W.: 136.15
  • QP182003
    Paracetamol EP Impurity C
    CAS# 3964-54-3
    M.F.: C8H8ClNO2
    M.W.: 185.61
  • QP182002
    Paracetamol EP Impurity B
    CAS# 1693-37-4
    M.F.: C9H11NO2
    M.W.: 165.19
  • QP182001
    Paracetamol EP Impurity A
    CAS# 614-80-2
    M.F.: C8H9NO2
    M.W.: 151.16
  • QT081106
    Trihexyphenidyl Impurity F
    CAS# NA
    M.F.: C20H29N
    M.W.: 283.45
  • QT081101
    Trihexyphenidyl Impurity A
    CAS# 886-06-6 ;73-63-2(free base)
    M.F.: C14H20ClNO
    M.W.: 253.77
  • QL130610
    Lamivudine EP Impurity J
    CAS# 145986-07-8
    M.F.: C8H10N2O4S
    M.W.:  230.24
  • QP182213
    Peramivir Amino acid Impurity
    CAS# NA
    M.F.: C6H9NO2
    M.W.: 127.14
  • QP182212
    Peramivir Methyl Ester Impurity
    CAS# NA
    M.F.: C7H11NO2
    M.W.: 141.17
  • QP182208
    Peramivir Impurity 8
    CAS# 229614-37-3;1352062-19-1(HCl salt)
    M.F.: C14H26N2O4
    M.W.: 286.37
  • QP182207
    Peramivir Impurity 7
    CAS# NA
    M.F.: C15H28N2O4
    M.W.: 300.39
  • QP182210
    Peramivir Impurity 10
    CAS# 316173-29-2
    M.F.: C18H34N2O5
    M.W.: 358.47
  • QP182206
    Peramivir Impurity 6
    CAS# 1988779-15-2
    M.F.: C20H36N2O6
    M.W.: 400.51
  • QP182204
    Peramivir Impurity 4
    CAS# 383910-24-5
    M.F.: C18H30N2O5
    M.W.: 354.44
  • QC160928
    Cefpirome Impurity 2;
    Cefepime EP Impurity C

    CAS# 104301-63-5
    M.F.: C8H10N4O3S
    M.W.: 242.26
  • QP182202
    Peramivir Impurity 2
    CAS# 229613-93-8
    M.F.: C18H30N2O5
    M.W.: 354.44
  • QP182211
    Peramivir Impurity 11
    CAS# NA
    M.F.: C15H28N4O4
    M.W.: 328.41
  • QF120401
    Fluocinonide Impurity A
    CAS# NA
    M.F.: C26H30F2O7
    M.W.: 492.51
  • QL162001
    Lapatinib Impurity 1 (O-De(3-fluorobenzyl) Lapatinib)
    CAS# 1268997-70-1
    M.F.: C22H21ClN4O4S
    M.W.: 472.95
  • QA202202
    Atorvastatin EP Impurity B
    CAS# NA
    M.F.: C33H34FN2O5.1/2Ca
    M.W.: 577.67
  • QC030331
    Cinacalcet USP RC E
    CAS# 78573-45-2
    M.F.: C10H11F3O
    M.W.: 204.19
  • QC030327
    Cinacalcet Impurity 27
    CAS# 21172-43-0
    M.F.: C11H13F3O3S
    M.W.: 282.28
  • QG031902
    Glucosamine EP Impurity B;Fructosazine
    CAS# 13185-73-4
    M.F.: C12H20N2O8
    M.W.: 320.30
  • QC160935
    Cefpirome Impurity 9
    CAS# NA
    M.F.: C22H22N6O6S2
    M.W.: 530.58
  • QC160933
    Cefpirome Impurity 7
    CAS# NA
    M.F.: C22H22N6O5S2
    M.W.: 514.58
  • QC160930
    Cefpirome Impurity 4
    CAS# NA
    M.F.: C22H22N6O5S2
    M.W.: 514.58
  • QI200330
    Irinotecan Impurity 4
    CAS# 176515-52-9
    M.F.: C32H38N4O4
    M.W.: 542.68
  • QI210616
    Ibuprofen EP Impurity P
    CAS# 36039-36-8
    M.F.: C13H20O
    M.W.: 192.30
  • QI210614
    Ibuprofen EP Impurity N
    CAS# 3585-52-2
    M.F.: C11H14O2
    M.W.: 178.23
  • QI210613
    Ibuprofen EP Impurity M
    CAS# 60057-62-7
    M.F.: C13H18O3
    M.W.: 222.28
  • QI210610
    Ibuprofen EP Impurity J
    CAS# 65813-55-0
    M.F.: C13H16O3
    M.W.:  220.27
  • QI210606
    Ibuprofen EP Impurity F
    CAS# 65322-85-2
    M.F.: C13H18O2
    M.W.:  206.29
  • QI210604
    Ibuprofen EP Impurity D
    CAS# 938-94-3
    M.F.: C10H12O2
    M.W.: 164.21
  • QP182444
    Parecoxib Sodium Impurity M
    CAS# 75115-00-3
    M.F.: C16H13NO
    M.W.: 235.28
  • QB201427
    Bortezomib Impurity 1
    CAS# 289472-78-2
    M.F.: C19H24N4O3
    M.W.: 356.42
  • QC120309
    Celecoxib Impurity I
    CAS# 720-94-5
    M.F.: C11H9F3O2
    M.W.: 230.18
  • QL141232
    Lenalidomide Impurity 7
    CAS# NA
    M.F.: C13H16N4O3
    M.W.: 276.29
  • QC060406
    Cefodizime Impurity F
    CAS# NA
    M.F.: C20H20N6O7S4
    M.W.: 584.67
  • QF022452
    Febuxostat Impurity 8
    CAS# 528607-60-5
    M.F.: C12H13NO3
    M.W.: 219.24
  • QF022451
    Febuxostat Impurity 25
    CAS# NA
    M.F.: C16H18N2O4S
    M.W.: 334.39
  • QT060344
    Tofacitinib Impurity 19
    CAS# NA
    M.F.: C14H22N2O
    M.W.: 234.34
  • QL062427
    Levofloxacin Impurity 1;
    Ofloxacin EP Impurity A

    CAS# 82419-35-0
    M.F.: C13H9F2NO4
    M.W.: 281.21
  • QC030804
    Cinchocaine EP Impurity D
    CAS# 10222-61-4
    M.F.: C14H15NO3
    M.W.: 245.27
  • QC030803
    Cinchocaine EP Impurity C 
    CAS# 87864-08-2
    M.F.: C16H21N3O2
    M.W.:  287.36
  • QC030802
    Cinchocaine EP Impurity B
    CAS# 15733-89-8
    M.F.: C10H7NO3
    M.W.: 189.17
  • QC030801
    Cinchocaine EP Impurity A
    CAS# 87864-14-0
    M.F.: C16H20ClN3O
    M.W.: 305.80
  • QL141204
    Lenalidomide Impurity D
    CAS# 295357-66-3
    M.F.: C13H14N2O5
    M.W.: 278.26
  • QC061728
    Cefoperazone Impurity 1
    CAS# 62893-24-7
    M.F.: C15H17N3O6
    M.W.: 335.31
  • QL201522
    Letrozole Impurity 22
    CAS# 123-56-8
    M.F.: C4H5NO2
    M.W.: 99.09
  • QL201513
    Letrozole Impurity 13
    CAS# 128-08-5
    M.F.: C4H4BrNO2
    M.W.: 177.98
  • QL201521
    Letrozole Impurity 21
    CAS# 394-47-8
    M.F.: C7H4FN
    M.W.: 121.11
  • QL201516
    Letrozole Impurity 16
    CAS# 529-19-1
    M.F.: C8H7N
    M.W.: 117.15
  • QL201508
    Letrozole Impurity 8
    CAS# 22115-41-9
    M.F.: C8H6BrN
    M.W.: 196.04
  • QL201505
    Letrozole Impurity 3
    CAS# 28188-41-2
    M.F.: C8H6BrN
    M.W.: 196.04
  • QC132426
    Cefmenoxime Impurity 26
    CAS# 94088-75-2
    M.F.: C13H10N4O2S3
    M.W.: 350.44
  • QC132420
    Cefmenoxime Impurity 20
    CAS# 149-30-4
    M.F.: C7H5NS2
    M.W.: 167.25
  • QC132415
    Cefmenoxime Impurity 15
    CAS# 120-78-5
    M.F.: C14H8N2S4
    M.W.: 332.49
  • QC132413
    Cefmenoxime Impurity 13
    CAS# 126437-69-2
    M.F.: C11H13N5O3S2
    M.W.: 327.38
  • QC132412
    Cefmenoxime Impurity 12
    CAS# 392718-98-8
    M.F.: C4H6N4OS
    M.W.: 158.18
  • QC132408
    Cefmenoxime Impurity 8
    CAS# NA
    M.F.: C12H14N6O4S2
    M.W.: 370.41
  • QC132402
    Cefmenoxime Impurity 2
    CAS# NA
    M.F.: C16H21N7O6S2
    M.W.: 471.51
  • QS161828
    Sulpiride Impurity 2
    CAS# NA
    M.F.: C15H22N2O5S
    M.W.: 342.41
  • QT060343
    Tofacitinib Impurity 18
    CAS# 2028267-73-2
    M.F.: C16H20N6O2
    M.W.: 328.37
  • QP182443
    Parecoxib Impurity 11
    CAS# 181696-12-8
    M.F.: C16H14N2O3S
    M.W.: 314.36
  • QP202233
    Pitavastatin Impurity 7
    CAS# NA
    M.F.: C32H36FNO4
    M.W.: 517.65
  • QP202236
    Pitavastatin Impurity 10
    CAS# NA
    M.F.: C32H36FNO4
    M.W.: 517.65
  • QP202231
    Pitavastatin Impurity 5
    CAS# NA
    M.F.: C32H36FNO4
    M.W.: 517.65
  • QL052020
    Levetiracetam EP Impurity E
    CAS# 3886-69-9
    M.F.: C8H11N
    M.W.: 121.18
  • QI091612
    Ipratropium Bromide Impurity L
    CAS# 3979-14-4
    M.F.: C11H14O3
    M.W.: 194.23
  • QI091611
    Ipratropium Bromide Impurity K
    CAS# 17838-69-6
    M.F.: C11H12O3
    M.W.: 192.21
  • QI091610
    Ipratropium Bromide Impurity J
    CAS# NA
    M.F.: C13H24BrNO2
    M.W.: 306.24
  • QI091609
    Ipratropium Bromide Impurity I
    CAS# 3423-28-7
    M.F.: C10H17NO
    M.W.: 167.25
  • QI091608
    Ipratropium Bromide Impurity H
    CAS# NA
    M.F.: C22H32BrNO4
    M.W.: 454.40
  • QC061313
    Cefotiam Impurity 13
    CAS# NA
    M.F.: C18H25N9O5S3
    M.W.: 543.64
  • QS061904
    Sulfasalazine EP Impurity D
    CAS# 66364-70-3
    M.F.: C17H14N4O3S
    M.W.: 354.39
  • QE201207
    Estriol EP Impurity G
    CAS# 793-89-5
    M.F.: C18H24O3
    M.W.: 288.39
  • QE161229
    Epalrestat Impurity 3
    CAS# 682775-71-9
    M.F.: C17H17NO3S2
    M.W.: 347.45
  • QP132018
    Pemetrexed Impurity F
    CAS# 193281-00-4(free base)
    M.F.: C20H19N5Na2O7
    M.W.: 487.37
  • QV122212
    Valaciclovir EP Impurity L;Aciclovir EP Impurity K
    CAS# 1797131-64-6
    M.F.: C17H22N10O6
    M.W.: 462.42
  • QC120903
    Calcipotriol EP Impurity C;
    (5E)-Calcipotriol

    CAS# 113082-99-8
    M.F.: C27H40O3
    M.W.: 412.62
  • QE161228
    Epalrestat Impurity 2
    CAS# 23176-01-4
    M.F.: C7H9NO3S2
    M.W.: 219.28
  • QE161227
    Epalrestat Impurity 1
    CAS# 82159-06-6
    M.F.: C12H9NO3S2
    M.W.: 279.33
  • QC120450
    Clindamycin B 2-Palmitate HCl
    CAS# 68206-99-5(base)
    M.F.: C33H61ClN2O6S HCl
    M.W.: 649.37 36.46
  • QC120413
    Clindamycin 2-Palmitate HCl
    CAS# 25507-04-4
    M.F.: C34H64Cl2N2O6S
    M.W.: 699.85
  • QC221207
    Clavulanate Potassium EP Impurity G
    CAS# 374816-32-7
    M.F.: C13H15NO6
    M.W.: 281.26
  • QC221206
    Clavulanate Potassium EP Impurity F
    CAS# 1260857-16-6
    M.F.: C13H14N2O5
    M.W.: 278.26
  • QC221205
    Clavulanate Potassium EP Impurity E
    CAS# 1260617-10-4
    M.F.: C16H18N2O10
    M.W.: 398.32
  • QC221204
    Clavulanate Potassium EP Impurity D
    CAS# 404839-11-8
    M.F.: C7H9NO3
    M.W.: 155.15
  • QC221203
    Clavulanate Potassium EP Impurity C
    CAS# 86917-74-0
    M.F.: C10H16N2O2
    M.W.: 196.25
  • QC221202
    Clavulanate Potassium EP Impurity B
    CAS# 96681-85-5
    M.F.: C11H16N2O4
    M.W.: 240.26
  • QP020330
    Palbociclib Impurity 4
    CAS# 1376615-91-6
    M.F.: C24H31N7O2
    M.W.: 449.56
  • QC162635
    Cefprozil Impurity 35
    CAS# NA
    M.F.: C26H26N4O7S
    M.W.: 538.57
  • QF121304
    Flumazenil EP Impurity D
    CAS# 78755-80-3
    M.F.: C10H9FN2O2
    M.W.: 208.19
  • QF121305
    Flumazenil EP Impurity E
    CAS# 78756-03-3
    M.F.: C15H15N3O3
    M.W.: 285.3
  • QC182527
    Canagliflozin Dimer Impurity 1
    CAS# NA
    M.F.: C48H48F2O10S2
    M.W.: 887.02
  • QL141201
    Lenalidomide Impurity A
    CAS# 1198299-72-7
    M.F.: C13H13N3O6
    M.W.: 307.26
  • QR121602
    rac-Lipoic Acid Impurity 2 (S-Oxide)
    CAS# 6992-30-9
    M.F.: C8H14O3S2
    M.W.: 222.33
  • QR121601
    rac-Lipoic Acid Impurity 1 (S-Oxide)
    CAS# 108015-78-7  
    M.F.: C8H14O3S2
    M.W.: 222.33
  • QA262007
    Azathioprine EP Impurity G
    CAS# 5581-52-2
    M.F.: C9H8N8O2S
    M.W.: 292.28
  • QA262005
    Azathioprine EP Impurity E
    CAS# 35681-68-6 (sodium salt)
    M.F.: C4H4N3NaO3
    M.W.: 165.08
  • QA262004
    Azathioprine EP Impurity D
    CAS# 6339-54-4
    M.F.: C4H5N3O2S
    M.W.: 159.17
  • QA262002
    Azathioprine EP Impurity B;
    Mercaptopurine

    CAS# 157930-13-7;6112-76-1(monohydrate)
    M.F.: C5H4N4S
    M.W.: 152.18
  • QA262001
    Azathioprine EP Impurity A
    CAS# 4531-54-8
    M.F.: C4H6N4O2
    M.W.: 142.12
  • QH040310
    Hydrocortisone EP Impurity J
    CAS# 16463-74-4
    M.F.: C23H32O6
    M.W.: 404.50
  • QH040308
    Hydrocortisone EP Impurity H
    CAS# NA
    M.F.: C21H30O6
    M.W.: 378.46
  • QH040305
    Hydrocortisone EP Impurity E
    CAS# 600-99-7
    M.F.: C21H28O5
    M.W.: 360.44
  • QC061429
    Cefdinir Related Compound B
    CAS# 79350-10-0
    M.F.: C14H14N4O4S2
    M.W.: 366.41
  • QC061428
    Cefdinir USP Related Compound A
    CAS# 178422-42-9
    M.F.: C14H15N5O6S2
    M.W.: 413.43
  • QC061427
    Cefdinir Impurity 1
    CAS# NA
    M.F.: C13H13N5O5S2
    M.W.: 383.41
  • QP136032
    Pidotimod Impurity 6
    CAS# NA
    M.F.: C9H12N2O4S
    M.W.: 244.27
  • QP136030
    Pidotimod Impurity 4
    CAS# 1116-22-9
    M.F.: C10H16N2O7
    M.W.: 276.24
  • QA260306
    Azacitidine Impurity F
    CAS# NA
    M.F.: C13H20N4O9
    M.W.: 376.32
  • QC022010
    Cabazitaxel Impurity 10
    CAS# 145514-62-1
    M.F.: C14H19NO5
    M.W.: 281.31
  • QC022015
    Cabazitaxel Impurity 15
    CAS#  859498-34-3
    M.F.: C22H25NO6
    M.W.: 399.44
  • QC022026
    Cabazitaxel Impurity 26
    CAS# 183133-97-3
    M.F.: C30H38O10
    M.W.: 558.62
  • QC202405
    Cefotaxime EP Impurity E;Ceftriaxone EP Impurity B
    CAS# 66340-33-8
    M.F.: C14H13N5O5S2
    M.W.: 395.41
  • QC202404
    Cefotaxime EP Impurity D Sodium Salt 
    CAS# 65715-12-0;63527-53-7(free base)
    M.F.: C16H16N5NaO7S2
    M.W.: 477.45
  • QC202401
    Cefotaxime EP Impurity A 
    CAS# 65052-63-3
    M.F.: C14H15N5O5S2
    M.W.: 397.42
  • QL011307
    Lamotrigine EP Impurity G
    CAS# 38943-76-9
    M.F.: C9H7Cl2N5
    M.W.: 256.09
  • QL011305
    Lamotrigine EP Impurity E
    CAS# 50-45-3
    M.F.: C7H4Cl2O2
    M.W.: 191.01
  • QL011302
    Lamotrigine EP Impurity B
    CAS# 94213-24-8
    M.F.: C9H7Cl2N5
    M.W.: 256.09
  • QC162630
    Cefprozil Impurity 4
    CAS# NA
    M.F.: C36H36N6O9S2
    M.W.: 760.84
  • QC162628
    Cefprozil Impurity 2
    CAS# NA
    M.F.: C18H19N3O5S
    M.W.: 389.43
  • QC162627
    Cefprozil Impurity 1
    CAS# NA
    M.F.: C17H19N3O6S
    M.W.: 393.41
  • QC162614
    Cefprozil EP Impurity N
    CAS# NA
    M.F.: C21H23N3O7S
    M.W.: 461.49
  • QC162613
    Cefprozil EP Impurity M
    CAS# NA
    M.F.: C21H23N3O7S
    M.W.: 461.49
  • QC162611
    Cefprozil EP Impurity K
    CAS# NA
    M.F.: C18H19N3O5S
    M.W.: 389.43
  • QC162610
    Cefprozil EP Impurity J
    CAS# NA
    M.F.: C26H26N4O7S
    M.W.: 538.57
  • QC162609
    Cefprozil EP Impurity I
    CAS# NA
    M.F.: C18H21N3O6S
    M.W.: 407.44
  • QC162608
    Cefprozil EP Impurity H
    CAS# NA
    M.F.: C26H26N4O7S
    M.W.: 538.57
  • QC162607
    Cefprozil EP Impurity G
    CAS# NA
    M.F.: C18H21N3O6S
    M.W.: 407.44
  • QC162605
    Cefprozil EP Impurity E
    CAS# NA
    M.F.: C26H26N4O7S
    M.W.: 538.57
  • QC162604
    Cefprozil EP Impurity D
    CAS# 106447-44-3
    M.F.: C10H12N2O3S
    M.W.: 240.28
  • QC162602
    Cefprozil EP Impurity B;Cefadroxil
    CAS# 50370-12-2;66592-87-8(monohydrate)
    M.F.: C16H17N3O5S
    M.W.: 363.39
  • QL201534
    Letrozole Impurity 7
    CAS# 134521-16-7
    M.F.: C15H10N2O
    M.W.: 234.25
  • QL201533
    Letrozole Impurity D
    CAS# 10466-37-2
    M.F.: C15H10N2
    M.W.: 218.25
  • QL201532
    Letrozole Impurity 6
    CAS# NA
    M.F.: C26H18N6
    M.W.: 414.46
  • QL201531
    Letrozole Impurity 5
    CAS# 1644566-39-1
    M.F.: C17H13N3O4
    M.W.: 323.3
  • QL201530
    Letrozole Impurity 4
    CAS# NA
    M.F.: C18H13N5
    M.W.: 299.33
  • QI591803
    Imidacloprid Guanidine Impurity
    CAS# NA
    M.F.: C9H11ClN4
    M.W.: 210.66
  • QI591802
    Imidacloprid Nitrosimine Impurity
    CAS# NA
    M.F.: C9H10ClN5O
    M.W.: 239.66
  • QI210624
    Ibuprofen Impurity X
    CAS# NA
    M.F.: C22H29NO3
    M.W.: 355.47
  • QO022016
    6-epi-Obeticholic Acid
    CAS# 915038-27-6
    M.F.: C26H44O4
    M.W.: 420.63
  • QK202007
    Ketotifen EP Impurity G
    CAS# 43076-16-0
    M.F.: C19H17NO2S
    M.W.: 323.41
  • QK202005
    Ketotifen EP Impurity E
    CAS# 1346603-71-1
    M.F.: C19H19NOS
    M.W.: 309.43
  • QK202004
    Ketotifen EP Impurity D
    CAS# 88456-70-6
    M.F.: C19H19NO2S
    M.W.: 325.42
  • QK202003
    Ketotifen EP Impurity C
    CAS# 126939-27-3
    M.F.: C19H21NO2S
    M.W.: 327.44
  • QK202001
    Ketotifen EP Impurity A
    CAS# 4673-38-5
    M.F.: C19H19NS
    M.W.: 293.43
  • QD030408
    Diclofenac EP Impurity F
    CAS# 560075-65-2
    M.F.: C14H10Cl3NO
    M.W.: 314.59
  • QF226813
    Fasudil Impurity M
    CAS# NA
    M.F.: C14H18ClN3O2S
    M.W.: 327.83
  • QI200310
    Irinotecan Impurity 10
    CAS# 176515-52-9
    M.F.: C32H38N4O4
    M.W.: 542.67
  • QE201609
    Eletriptan Impurity 9
    CAS# 143322-57-0
    M.F.: C14H17BrN2
    M.W.: 293.21
  • QP181510
    (S)-Propranolol HCl
    CAS# 4199-10-4
    M.F.: C16H21NO2.HCl
    M.W.: 259.35 36.46
  • QA260305
    Azacitidine Impurity E
    CAS# 3530-56-1
    M.F.:  C9H13N3O5
    M.W.: 243.22
  • QC160316
    Capecitabine Impurity 16
    CAS# NA
    M.F.: C13H16FN3O6
    M.W.: 329.28
  • QC160313
    Capecitabine EP Impurity C
    CAS# 161599-46-8
    M.F.: C13H16FN3O6
    M.W.: 329.28
  • QC160308
    Capecitabine Impurity 8
    CAS# 1262133-64-1
    M.F.: C20H30FN3O9
    M.W.: 475.48
  • QA032030
    Acotiamide Impurity 4
    CAS# NA
    M.F.: C13H14N2O4S
    M.W.: 294.33
  • QC181310
    Clarithromycin EP Impurity M
    CAS# 127182-43-8
    M.F.: C37H68N2O13
    M.W.: 748.94
  • QC031903
    Cyclophosphamide USP RC C
    CAS# 1071-28-9
    M.F.: C3H10NO4P
    M.W.: 155.09
  • QC181300
    Clarithromycin
    CAS# 81103-11-9
    M.F.: C38H69NO13
    M.W.: 747.95
  • QC181318
    Clarithromycin Impurity R;
    Erythromycin EP Impurity B;
    3″-N-Demethylerythromycin A

    CAS# 992-62-1
    M.F.: C36H65NO13
    M.W.: 719.90
  • QC181306
    Clarithromycin EP Impurity F
    CAS# 128940-83-0
    M.F.: C39H71NO13
    M.W.: 761.98
  • QC181305
    Clarithromycin EP Impurity E;
    6,11-di-O-methylerythromycin A

    CAS# 81103-14-2
    M.F.: C39H71NO13
    M.W.: 761.98
  • QP136028
    Pidotimod Impurity 2
    CAS# NA
    M.F.: C9H12N2O5S
    M.W.: 260.27
  • QT130202
    Trimebutine Impurity B
    CAS# 144095-19-2
    M.F.: C10H14N2O
    M.W.: 178.23
  • QT130201
    Trimebutine Impurity A
    CAS# 298689-33-5
    M.F.: C10H13ClN2
    M.W.: 196.68
  • QC031207
    Cefaclor EP Impurity G
    CAS# NA
    M.F.: C16H17N3O4S
    M.W.: 347.40
  • QC062007
    Cefathiamidine Impurity G
    CAS# 1417570-09-2
    M.F.: C17H26N4O4S2
    M.W.: 414.54
  • QL201504
    Letrozole Impurity 2
    CAS# [NA]
    M.F.: C17H11N5
    M.W.: 285.30
  • QC160717
    Clopidogrel N-Methyl Impurity I HCl
    CAS# 1346605-15-9 (free base)
    M.F.: C16H19Cl2NO2S
    M.W.: 360.3
  • QC160716
    Clopidogrel Ethyl Ester Sulfate
    CAS# 1332612-57-3
    M.F.: C17H20ClNO6S2
    M.W.: 433.93
  • QE200330
    Entecavir EP Impurity D
    CAS# 1367369-80-9
    M.F.: C12H15N5O3
    M.W.: 277.29
  • QD121819
    USP Desloratadine Related Compound A
    CAS# 117796-50-6
    M.F.: C19H19BrN2
    M.W.: 355.27
  • QU190409
    Ursodeoxycholic Acid EP Impurity I
    CAS# 130593-75-8
    M.F.:  C24H42O3
    M.W.: 378.60
  • QU190407
    Ursodeoxycholic Acid EP Impurity G;
    Chenodeoxycholic acid EP Impurity G

    CAS# 10538-55-3
    M.F.: C25H42O4
    M.W.: 406.60
  • QU190408
    Ursodeoxycholic Acid EP Impurity H
    CAS# 78919-26-3
    M.F.: C24H40O4
    M.W.:  392.58
  • QU190406
    Ursodeoxycholic Acid EP Impurity F;
    Chenodeoxycholic acid EP Impurity F

    CAS# 4651-67-6
    M.F.: C24H38O4
    M.W.: 390.56
  • QU190405
    Ursodeoxycholic Acid EP Impurity E;
    Chenodeoxycholic acid EP Impurity E;
    Deoxycholic acid

    CAS# 83-44-3;302-95-4(Na salt)
    M.F.: C24H40O4
    M.W.: 392.57
  • QU190404
    Ursodeoxycholic Acid EP Impurity D;
    Chenodeoxycholic acid EP Impurity D

    CAS# 2955-27-3
    M.F.: C24H40O5
    M.W.: 408.58
  • QU190403
    Ursodeoxycholic Acid EP Impurity C;
    Chenodeoxycholic acid EP Impurity C;
    Lithocholic acid

    CAS# 434-13-9
    M.F.: C24H40O3
    M.W.: 376.57
  • QU190402
    Ursodeoxycholic Acid EP Impurity B;
    Chenodeoxycholic acid EP Impurity B

    CAS# 81-25-4
    M.F.: C24H40O5
    M.W.: 408.57
  • QU190401
    Ursodeoxycholic Acid EP Impurity A ;
    Chenodeoxycholic acid

    CAS# 474-25-9
    M.F.: C24H40O4
    M.W.: 392.57
  • QF226812
    Fasudil Impurity L
    CAS# NA
    M.F.: C14H17N3O3S
    M.W.: 307.37
  • QC031231
    Cefaclor Impurity 5
    CAS# NA
    M.F.: C30H26Cl2N6O7S2
    M.W.: 717.59
  • QC031230
    Cefaclor Impurity 4
    CAS# NA
    M.F.: C23H21ClN4O5S
    M.W.: 500.95
  • QC031229
    Cefaclor Impurity 3
    CAS# NA
    M.F.: C23H21ClN4O5S
    M.W.: 500.95
  • QC031228
    Cefaclor Impurity 2
    CAS# NA
    M.F.: C15H16ClN3O4S
    M.W.: 369.82
  • QD141616
    Donepezil Impurity P
    CAS# NA
    M.F.: C24H31NO2
    M.W.: 365.51
  • QD141615
    Donepezil Impurity O
    CAS# 120014-07-5
    M.F.:  C24H27NO3
    M.W.: 377.49
  • QL142623
    Linezolid Impurity N;rac-Linezolid
    CAS# 224323-50-6
    M.F.: C16H20FN3O4
    M.W.: 337.35
  • QL040308
    Lidocaine EP Impurity H
    CAS# 1131-01-7
    M.F.:  C10H12ClNO
    M.W.: 197.67
  • QL040303
    Lidocaine EP Impurity C
    CAS# 2198-53-0
    M.F.:  C10H13NO
    M.W.: 163.22
  • QD192400
    Desoximetasone;
    Dexamethasone EP Impurity F

    CAS# 382-67-2
    M.F.: C22H29FO4
    M.W.: 376.46
  • QL040301
    Lidocaine EP Impurity A;Xylazine EP Impurity A;
    Ropivacaine EP Impurity H;Bupivacaine EP Impurity F;
    Mepivacaine EP Impurity A

    CAS#  87-62-7;21436-98-6(HCl salt)
    M.F.: C8H11N
    M.W.: 121.18
  • QC121801
    Chloroquine Impurity A
    CAS# 6281-58-9
    M.F.: C14H15ClN2
    M.W.: 246.74
  • QE200210
    Eltrombopag Dimer Impurity
    CAS# NA
    M.F.:  C50H42N8O8
    M.W.: 882.94
  • QE201600
    Eletriptan
    CAS# 143322-58-1;177834-92-3(HBr salt)
    M.F.: C22H26N2O2S
    M.W.: 382.52
  • QE201620
    Eletriptan N-Oxide
    CAS# 1217641-89-8
    M.F.: C22H26N2O3S
    M.W.: 398.52
  • QC031610
    E-Cefcapene Pivoxil
    CAS# NA
    M.F.: C23H29N5O8S2
    M.W.: 567.64
  • QC202406
    Cefotaxime EP Impurity F
    CAS# 175032-97-0
    M.F.: C30H30N10O12S4
    M.W.: 850.88
  • QB031211
    Bicalutamide EP Impurity F
    CAS# 1080647-26-2
    M.F.: C18H14F4N2O3S
    M.W.: 414.37
  • QE181410
    Eplerenone Impurity J (11α-Hydroxy Canrenone)
    CAS# NA
    M.F.: C22H28O4
    M.W.: 356.46
  • QE181408
    Eplerenone EP Impurity D
    CAS# 209253-82-7
    M.F.: C23H28O6
    M.W.: 400.46
  • QE181407
    Eplerenone EP Impurity C
    CAS# NA
    M.F.: C24H30O5
    M.W.: 398.49
  • QB162228
    (R)-Bupivacaine HCl
    CAS# 27262-46-0;27262-45-9(free base)
    M.F.: C18H28N2O.HCl
    M.W.: 288.44 36.46
  • QC061834
    Cefuroxime Axetil EP Impurity D; Cefuroxime Sodium
    CAS# 56238-63-2;55268-75-2(free base)
    M.F.: C16H15N4NaO8S
    M.W.: 446.37
  • QL052011
    Levetiracetam Impurity K
    CAS# NA
    M.F.: C9H16ClNO3
    M.W.: 221.68
  • QL052010
    Levetiracetam Impurity J
    CAS# NA
    M.F.: C8H14ClNO3
    M.W.: 207.65
  • QL052009
    Levetiracetam Impurity I
    CAS# 358629-51-3
    M.F.: C9H15NO3
    M.W.: 185.22
  • QC131404
    Cefminox Sodium impurity 4
    CAS# NA
    M.F.: C16H20N3NaO9S2
    M.W.: 485.46
  • QP160451
    Paliperidone Impurity 25
    CAS# 16867-03-1
    M.F.: C5H6N2O
    M.W.: 110.11
  • QP160446
    Paliperidone Impurity 20
    CAS# 517-23-7
    M.F.: C6H8O3
    M.W.: 128.13
  • QP160437
    Paliperidone Impurity 11
    CAS# 70381-47-4
    M.F.: C11H12N2O2
    M.W.: 204.23
  • QP160436
    Paliperidone Impurity 10
    CAS# 260273-82-3;849727-62-4(HCl salt)
    M.F.: C11H11ClN2O2
    M.W.: 238.67
  • QP160431
    Paliperidone Impurity 5
    CAS# 1008796-22-2
    M.F.: C18H18N2O3
    M.W.: 310.35
  • QP160430
    Paliperidone Impurity 4
    CAS# 147687-17-0
    M.F.: C18H17ClN2O2
    M.W.: 328.79
  • QP160427
    Paliperidone Impurity 1
    CAS# 24016-03-3
    M.F.: C12H12N2O
    M.W.: 200.24
  • QT041241
    Tadalafil Impurity T
    CAS# 629652-40-0
    M.F.: C22H19ClN2O5
    M.W.: 426.85
  • QT041237
    Tadalafil Impurity 15
    CAS# 629652-44-4
    M.F.: C22H19ClN2O5
    M.W.: 426.85
  • QT041239
    Tadalafil Impurity Ⅵ
    CAS# 171596-42-2
    M.F.: C20H18N2O4
    M.W.: 350.37
  • QT041236
    Tadalafil Impurity 7
    CAS# NA
    M.F.: C20H18N2O4
    M.W.: 350.37
  • QP032011
    Procaterol Impurity 11
    CAS# 68304-21-2
    M.F.: C10H7NO3
    M.W.: 189.17
  • QC-P221900
    Pravastatin Sodium Salt
    CAS# 81131-70-6;81093-37-0(free base)
    M.F.: C23H35NaO7
    M.W.: 446.51
  • QE061404
    Efinaconazole Impurity D
    CAS# 241479-73-2
    M.F.: C12H11F2N3O
    M.W.: 251.23
  • QE061403
    Efinaconazole Impurity C
    CAS# NA
    M.F.: C12H11F2N3O
    M.W.: 251.23
  • QE061401
    Efinaconazole Impurity A
    CAS# NA
    M.F.: C12H13F2N3O2
    M.W.: 269.25
  • QC132602
    Cefmetazole Impurity B
    CAS# NA
    M.F.: C15H17N7O5S3
    M.W.: 471.53
  • QP136017
    Pidotimod Impurity Q
    CAS# NA
    M.F.: C11H16N2O4S
    M.W.: 272.32
  • QP136015
    Pidotimod Impurity O
    CAS# NA
    M.F.: C11H16N2O4S
    M.W.: 272.32
  • QS221802
    Controlled Substance
    (Suvorexant Impurity B)

    CAS# 1030377-80-0
    M.F.: C23H23ClN6O2
    M.W.: 450.92
  • QS221801
    Suvorexant Impurity A
    CAS# 1276666-19-3
    M.F.: C23H23ClN6O2
    M.W.: 450.92
  • QE042206
    Edaravone Related Compound 
    CAS# 19735-89-8
    M.F.: C10H10N2O
    M.W.: 174.2
  • QD121227
    Diallylacetic Acid
    CAS# 99-67-2
    M.F.: C8H12O2
    M.W.: 140.18
  • QA261914
    Azilsartan Impurity N
    CAS# 1397836-41-7
    M.F.: C26H26N4O4
    M.W.: 458.51
  • QB121414
    Blonanserin Impurity N
    CAS# 132813-14-0
    M.F.: C17H17ClFN
    M.W.: 289.77
  • QC061811
    Cefuroxime Sodium EP Impurity E
    CAS# 97232-97-8
    M.F.: C16H16N4O8S
    M.W.: 424.39
  • QA190206
    Ascorbic Acid EP Impurity F Sodium Salt
    CAS# 6381-77-7
    M.F.: C6H7NaO6
    M.W.: 198.11
  • QP136013
    Pidotimod Impurity M
    CAS# NA
    M.F.: C9H14N2O5S
    M.W.: 262.28
  • QP136012
    Pidotimod Impurity L
    CAS# NA
    M.F.: C9H12N2O4S
    M.W.: 244.27
  • QT081505
    Theophylline EP Impurity E
    CAS# 944-73-0
    M.F.:  C7H8N4O3
    M.W.: 196.16
  • QT081503
    Theophylline EP Impurity C;Caffeine EP Impurity B
    CAS# 7597-60-6
    M.F.: C7H10N4O3
    M.W.: 198.18
  • QC061804
    Cefuroxime Sodium EP Impurity A
    CAS# 56271-94-4
    M.F.: C15H15N3O7S
    M.W.: 381.36
  • QT151604
    Tiopronin Impurity D
    CAS# 21269-37-4
    M.F.: C10H16N2O6S2
    M.W.: 324.37
  • QT151603
    Tiopronin Impurity C
    CAS# 21709-90-0
    M.F.: C5H9NO3
    M.W.: 131.13
  • QF041809
    Fludarabine Phosphate EP Impurity I
    CAS# 7561-54-8
    M.F.: C10H15N6O7P
    M.W.: 362.24
  • QF041808
    Fludarabine Phosphate EP Impurity H
    CAS# 548774-57-8
    M.F.: C10H10FN5O3
    M.W.:  267.22
  • QF041804
    Fludarabine Phosphate EP Impurity D
    CAS# 700-49-2
    M.F.: C5H4FN5
    M.W.: 153.12
  • QC062005
    Cefathiamidine Impurity E
    CAS# 2986-17-6
    M.F.: C7H16N2S
    M.W.: 160.28
  • QC062002
    Cefathiamidine Impurity B
    CAS# NA
    M.F.: C19H28N4O6S2
    M.W.: 472.58
  • QA202241
    Atorvastatin Lactone Diepoxide
    CAS# 1046118-40-4
    M.F.: C33H33FN2O6
    M.W.: 572.62
  • QA161904
    Acetylsalicylic Acid EP Impurity D;
    Carbasalate calcium EP Impurity B;
    DL-Lysine acetylsalicylate EP Impurity L

    CAS# 530-75-6
    M.F.: C16H12O6
    M.W.: 300.27
  • QA161906
    Aspirin Impurity F;
    Acetylsalicylic Acid EP Impurity F;
    Carbasalate calcium EP Impurity A

    CAS# 1466-82-6
    M.F.: C18H14O7
    M.W.: 342.30
  • QA161905
    Aspirin Impurity E;
    Acetylsalicylic Acid EP Impurity E;
    Carbasalate calcium EP Impurity D;
    DL-Lysine acetylsalicylate EP Impurity M

    CAS# 552-94-3
    M.F.: C14H10O5
    M.W.: 258.23
  • QA161902
    Aspirin Impurity B ;Acetylsalicylic Acid EP Impurity B
    CAS# 636-46-4
    M.F.: C8H6O5
    M.W.: 182.13
  • QA161901
    Acetylsalicylic Acid EP Impurity A;
    Propyl Parahydroxybenzoate EP Impurity A;
    Sodium ethyl parahydroxybenzoate EP Impurity A;
    Butyl parahydroxybenzoate EP Impurity A

    CAS# 99-96-7
    M.F.: C7H6O3
    M.W.: 138.12
  • QC061207
    Cefalexin Impurity 7
    CAS# 72820-16-7
    M.F.: C11H14N2O5S
    M.W.: 286.31
  • QC061227
    Cephalexin Diketopiperazine
    CAS#  59865-11-1
    M.F.: C16H17N3O4S
    M.W.: 347.39
  • QT182612
    Terazosin EP Impurity L
    CAS# 40172-95-0
    M.F.: C9H12N2O2
    M.W.: 180.2
  • QC060429
    Cefodizime Impurity 3
    CAS# NA
    M.F.: C20H20N6O9S4
    M.W.: 616.67
  • QB082428
    Bromhexine EP Impurity B
    CAS# 50910-55-9
    M.F.:  C7H5Br2NO
    M.W.: 278.93
  • QB082427
    Bromhexine EP Impurity A
    CAS# 50739-76-9
    M.F.:  C7H7Br2NO
    M.W.: 280.95
  • QF210616
    Flurbiprofen impurity Ⅵ
    CAS# 927-68-4
    M.F.: C4H7BrO2
    M.W.: 167
  • QF210615
    Flurbiprofen impurity Ⅴ
    CAS# 108-05-4
    M.F.: C4H6O2
    M.W.: 86.09
  • QF210611
    Flurbiprofen impurityⅠ
    CAS# 41604-19-7
    M.F.: C12H8BrF
    M.W.: 251.09
  • QT140678
    Tenofovir Alafenamide Impurity 1
    CAS# NA
    M.F.: C27H33N6O6PS
    M.W.: 600.63
  • QG121907
    Granisetron EP Impurity G
    CAS# 34252-44-3
    M.F.: C9H8N2O2
    M.W.: 176.18
  • QI192209
    Isavuconazole Impurity I
    CAS# 2170932-49-5
    M.F.: C13H14F2N4OS
    M.W.: 312.34
  • QT140676
    Tenofovir Disoproxil Impurity 76
    CAS# NA
    M.F.: C19H30N5O10P
    M.W.: 519.45
  • QC061419
    Cefdinir Impurity S
    CAS# 127770-93-8
    M.F.: C16H15N5O6S2
    M.W.: 437.45
  • QA200305
    Atracurium Besylate Impurity 5
    CAS# 1075727-04-6
    M.F.: C24H31NO6
    M.W.: 429.52
  • QA200304
    Cisatracurium Besylate EP Impurity F Iodide
    CAS# NA
    M.F.: C29H42NO7. I
    M.W.: 516.65
  • QI192208
    Isavuconazole Impurity H
    CAS# 219872-85-2
    M.F.: C13H14F2N4O2
    M.W.: 296.27
  • QI192207
    Isavuconazole Impurity G
    CAS# 368421-58-3
    M.F.: C13H14F2N4OS
    M.W.: 312.34
  • QI192206
    Isavuconazole Impurity F
    CAS# 241479-74-3
    M.F.: C13H12F2N4O
    M.W.: 278.26
  • QC141507
    Cinepazide Impurity G
    CAS# 20329-98-0
    M.F.: C12H14O5
    M.W.: 238.24
  • QP136011
    Pidotimod Impurity K
    CAS# NA
    M.F.: C4H7NO3S
    M.W.: 149.17
  • QF041803
    Fludarabine phosphate EP impurity C
    CAS# 548774-53-4
    M.F.: C10H14FN5O10P2
    M.W.: 445.2
  • QF041801
    Fludarabine phosphate EP Impurity A
    CAS# 62314-92-5
    M.F.: C10H14N5O8P
    M.W.: 363.23
  • QB191411
    Bosentan Impurity
    CAS# 1218951-81-5
    M.F.: C35H38N6O6S2
    M.W.: 702.84
  • QM191613
    Mosapride Impurity M
    CAS# 1215825-20-9(free base)
    M.F.: C27H29ClFN3Na2O9
    M.W.: 639.96
  • QM191610
    Mosapride Impurity J
    CAS# 152013-26-8
    M.F.: C14H20ClN3O3
    M.W.: 313.78
  • QD261605
    Diazepam EP Impurity E
    CAS# 20927-53-1
    M.F.: C15H11ClN2O
    M.W.: 270.72
  • QC061415
    Cefdinir Impurity O
    CAS# 178601-89-3
    M.F.: C14H13N5O5S2
    M.W.: 395.41
  • QS060226
    Sofosbuvir Impurity 2
    CAS# 1714114-25-6
    M.F.: C18H17F5NO5P
    M.W.: 453.30
  • QC122200
    Clevidipine
    CAS# 167221-71-8
    M.F.: C21H23Cl2NO6
    M.W.: 456.32
  • QA121200
    Apronal
    CAS# 528-92-7
    M.F.: C9H16N2O2
    M.W.: 184.24
  • QF120370
    Folic Acid Impurity 70
    CAS# 1391194-56-1
    M.F.: C7H6ClN5O
    M.W.: 211.61
  • QF120369
    Folic Acid Impurity 69
    CAS# 35011-47-3
    M.F.: C4H7N5O.H2O4S
    M.W.: 141.13 98.07
  • QI650900
    Inosine; Adenosine EP Impurity G;
    Didanosine EP Impurity B

    CAS# 58-63-9
    M.F.: C10H12N4O5
    M.W.: 268.23
  • QT130200
    Trimebutine
    CAS# 39133-31-8;34140-59-5(maleate)
    M.F.: C22H29NO5
    M.W.: 387.47
  • QD040235
    Disperse Blue 35
    CAS# 12222-75-2
    M.F.: C20H14N2O5
    M.W.: 362.34
  • QS161807
    Sulpiride EP Impurity G
    CAS# 67381-52-6
    M.F.: C14H21N3O4S
    M.W.: 327.40
  • QT081109
    Trihexyphenidyl impurity 9
    CAS# 6853-22-1
    M.F.: C16H25NO
    M.W.: 247.38
  • QT140671
    Tenofovir Impurity 45
    CAS# 1607007-18-0
    M.F.: C18H26N10O7P2
    M.W.: 556.41
  • QD141613
    Donepezil Impurity M
    CAS# 197010-20-1
    M.F.: C24H29NO4
    M.W.: 395.49
  • QM140408
    methyl 2-amino-3,5-dibromobenzoate
    CAS# 606-00-8
    M.F.: C8H7Br2NO2
    M.W.: 308.95
  • QT120601
    Thalifendine
    CAS# 4668-19-3;18207-71-1(free base)
    M.F.: C19H16ClNO4
    M.W.: 357.79
  • QT140663
    Tenofovir disoproxil Impurity 37
    CAS# [NA]
    M.F.: C9H14N5O4P
    M.W.: 287.21
  • QT140649
    Tenofovir disoproxil Impurity 23
    CAS# [NA]
    M.F.: C9H14N5O4P
    M.W.: 287.21
  • QC141502
    Cinepazide Impurity B
    CAS# [NA]
    M.F.: C16H28N4O2
    M.W.: 308.42
  • QC141503
    Cinepazide Impurity C
    CAS# 1227926-25-1
    M.F.: C22H31N3O6
    M.W.: 433.50
  • QI091602
    Ipratropium Bromide EP Impurity B
    CAS# 58073-59-9
    M.F.: C20H30BrNO3
    M.W.: 412.36
  • QV701330
    L-Ascorbic acid
    CAS# 50-81-7
    M.F.: C6H8O6
    M.W.: 176.12
  • QF141903
    Finasteride EP Impurity C
    CAS# 1329611-51-9;1800205-94-0
    M.F.: C23H34N2O2
    M.W.: 370.53
  • QF120367
    Folic Acid EP Impurity E
    CAS# 1391068-26-0
    M.F.: C26H24N12O7
    M.W.: 616.54
  • QF120368
    Folic Acid EP Impurity C;Isofolic acid
    CAS# 47707-78-8
    M.F.: C19H19N7O6
    M.W.: 441.40
  • QF120366
    Folic Acid Isomer
    CAS# [NA]
    M.F.: C19H19N7O6
    M.W.: 441.40
  • QT060341
    Tofacitinib Impurity 16
    CAS# [NA]
    M.F.: C29H38N10O2
    M.W.: 558.68
  • QT050241
    Tofacitinib Impurity 11
    CAS# [NA]
    M.F.: C13H11N3O3S
    M.W.: 289.31
  • QA130301
    Aminocaproic acid Impurity A
    CAS# 2014-58-6
    M.F.: C12H24N2O3
    M.W.: 244.33
  • QP132016
    Pemetrexed EP Impurity E
    CAS# 182009-04-7;937370-10-0(2Na salt)
    M.F.: C20H21N5O6
    M.W.: 427.41
  • QT021407
    Terbinafine Impurity G;
    Terbinafine N-Oxide

    CAS# [NA]
    M.F.: C21H25NO
    M.W.: 307.43
  • QF121306
    Flumazenil EP Impurity A
    CAS# 84378-44-9
    M.F.: C13H10FN3O3
    M.W.: 275.24
  • QT140641
    Tenofovir disoproxil Impurity 15
    CAS# [NA]
    M.F.: C15H26N5O4P
    M.W.: 371.37
  • QF226811
    Fasudil Hydrochloride Impurity K
    CAS# [NA]
    M.F.: C9H7NO3S
    M.W.: 209.22
  • QF226810
    Fasudil Hydrochloride Impurity J
    CAS# [NA]
    M.F.: C9H7NO3S
    M.W.: 209.22
  • QA690320
    Abscisic acid
    CAS# 14375-45-2
    M.F.: C15H20O4
    M.W.: 264.32
  • QB702001
    Butyl acetate;Tributyl Acetylcitrate EP Impurity E
    CAS# 123-86-4
    M.F.: C6H12O2
    M.W.: 116.16
  • QB701400
    1-Butanol;Tri-n-butyl Phosphate EP Impurity C;Tributyl Acetylcitrate EP Impurity D
    CAS# 71-36-3
    M.F.: C4H10O
    M.W.: 74.12
  • QA690345
    (+)-Abscisic acid-D6
    CAS# 721948-65-8
    M.F.: C15H14D6O4
    M.W.: 270.35
  • QT060324
    Tofacitinib Impurity X
    CAS# 1252883-90-1
    M.F.: C20H25N5
    M.W.: 335.45
  • QE200305
    Entecavir Impurity 5
    CAS# [NA]
    M.F.: C13H16N4O3
    M.W.: 276.29
  • QF191606
    Fosaprepitant Impurity F
    CAS# 1242175-34-3
    M.F.: C23H21F7N4O3
    M.W.: 534.43
  • QL091601
    Lipoic Acid Impurity A
    CAS# 728854-75-9
    M.F.: C10H20N2OS2
    M.W.: 248.41
  • QB640900
    Sodium benzoate
    CAS# 532-32-1
    M.F.: C7H5NaO2
    M.W.: 144.10
  • QA690340
    (+)-Abscisic acid
    CAS# 21293-29-8
    M.F.: C15H20O4
    M.W.: 264.32
  • QC242001
    Cefoxitin Sodium EP Impurity A
    CAS# 54333-94-7
    M.F.: C15H16N2O6S2
    M.W.: 384.43
  • QF120304
    Folic Acid EP Impurity D
    CAS# 119-24-4
    M.F.: C14H12N6O3
    M.W.: 312.28
  • QC-L131100
    L(-)-Malic acid
    CAS# 97-67-6
    M.F.: C4H6O5
    M.W.: 134.09
  • QB640302
    Benzoic acid;Glycopyrronium Bromide EP Impurity D;Mefenamic Acid EP Impurity D;Tiaprofenic acid EP Impurity D
    CAS# 65-85-0
    M.F.: C7H6O2
    M.W.: 122.12
  • QF210605
    Flurbiprofen EP Impurity E
    CAS# 137045-30-8
    M.F.: C13H9FO2
    M.W.: 216.21
  • QL050303
    Lercanidipine Impurity C
    CAS# 77888-05-2
    M.F.: C21H26N2O6
    M.W.: 402.45
  • QC061905
    Ceftaroline Fosamil Impurity E
    CAS# 1427207-46-2
    M.F.: C9H8N2S2
    M.W.: 208.31
  • QC061902
    Ceftaroline Fosamil Impurity B
    CAS# 1240196-56-8
    M.F.: C24H22N8O6S4
    M.W.: 646.74
  • QC061901
    Ceftaroline Fosamil Impurity A
    CAS# 1286218-70-9
    M.F.: C22H22N8O6S4
    M.W.: 622.72
  • QE262016
    Ezetimibe Impurity P
    CAS# 1296129-16-2
    M.F.: C33H30F2N2O5
    M.W.: 572.60
  • QL062003
    Lafutidine Sulfone
    CAS# 174583-84-7
    M.F.: C22H29N3O5S
    M.W.: 447.54
  • QI210427
    Ibuprofen Impurity 27
    CAS# 1009-14-9
    M.F.: C11H14O
    M.W.: 162.23
  • QI220213
    Ivabradine Impurity T
    CAS# 1616710-50-9
    M.F.: C27H34N2O6.HCl
    M.W.: 482.58 36.46
  • QT042635
    Tedizolid Pyrophosphate Ester
    CAS# 1239662-48-6
    M.F.: C17H17FN6O9P2
    M.W.: 530.3
  • QP142001
    Pantoprazole Impurity A
    CAS# [NA]
    M.F.: C7H8Cl3NO
    M.W.: 228.5
  • QG130302
    Gemcitabine Impurity B(1’-Epi Gemcitabine 3’,5’-Dibenzoate)
    CAS# 134790-40-2
    M.F.: C23H19F2N3O6
    M.W.: 471.41
  • QT090302
    Thioctic acid Impurity 2
    CAS# 17370-41-1
    M.F.: C8H14O4S2
    M.W.: 238.32
  • QD020725
    Dabigatran Etexilate Impurity Y
    CAS# [NA]
    M.F.: C14H21N3O2
    M.W.: 263.34
  • QD020723
    Dabigatran Etexilate Impurity W
    CAS# 1702936-92-2
    M.F.: C19H20N4O3
    M.W.: 352.39
  • QD170602
    Diquafosol Impurity B
    CAS# 63-39-8 ;19817-92-6(3Na salt);
    116295-90-0 (3Na 2H2O salt)
    M.F.: C9H15N2O15P3
    M.W.: 484.14
  • QL151800
    L-Ornithine;
    Arginine EP Impurity C;
    Lysine acetate EP Impurity E

    CAS# 70-26-8
    M.F.: C5H12N2O2
    M.W.: 132.16
  • QE200900
    Zoledronic acid EP Impurity D
    CAS# 22884-10-2
    M.F.: C5H6N2O2
    M.W.: 126.11
  • QA048203
    Aspartic acid Impurity C
    CAS# 3184-13-2
    M.F.: C5H12N2O2 HCl
    M.W.: 132.16 36.46
  • QA048202
    Aspartic acid Impurity B
    CAS# 42538-31-8
    M.F.: C5H10N2O.HCl
    M.W.: 114.15 36.46
  • QM162004
    Meptazinol Impurity D
    CAS# [NA]
    M.F.: C30H44N2O
    M.W.: 448.68
  • QM162002
    Meptazinol Impurity B
    CAS# [NA]
    M.F.: C15H23N
    M.W.: 217.36
  • QM162001
    Meptazinol Impurity A
    CAS# [NA]
    M.F.: C15H21NO2
    M.W.: 247.34
  • QL140728
    Linagliptin Impurity Z2
    CAS# [NA]
    M.F.: C25H28N8O2
    M.W.: 472.55
  • QE122010
    Erlotinib Hydrochloride Impurity J
    CAS# 1029721-32-1(free base)
    M.F.: C22H24ClN3O4
    M.W.: 429.9
  • QE122009
    Erlotinib Hydrochloride Impurity I
    CAS# 2204518-92-1
    M.F.: C22H24ClN3O4
    M.W.: 429.9
  • QA261913
    Azilsartan Impurity M
    CAS# 1442400-65-8
    M.F.: C24H22N4O3
    M.W.: 414.47
  • QN201127
    Methyl naltrexone bromide D3
    CAS# NA
    M.F.: C21H23D3BrNO4
    M.W.: 439.36
  • QI210432
    (S)-Ibuprofen D3
    CAS# 98649-76-4
    M.F.: C19H26O8
    M.W.: 382.4
  • QI222027
    Hydroxy Itraconazole D8
    CAS# 1217516-26-1
    M.F.: C35H30Cl2D8N8O5
    M.W.: 729.68
  • QG062027
    Gefitinib-d8
    CAS# 857091-32-8
    M.F.: C22H16D8ClFN4O3
    M.W.: 454.96
  • QE262040
    Ezetimibe d4
    CAS# 1093659-90-5
    M.F.: C24H17D4F2NO3
    M.W.: 413.45
  • QF210601
    Flurbiprofen EP Impurity A
    CAS# 6341-72-6
    M.F.: C15H14O2
    M.W.: 226.28
  • QD152427
    Doxylamine-d5
    CAS# 1173020-59-1
    M.F.: C17H17D5N2O
    M.W.: 275.41
  • QC061231
    Cephalexin D5 (Racemic)
    CAS# 23325-78-2 (unlabeled)
    M.F.: C16H12D5N3O4S
    M.W.: 352.42
  • QA150906
    Atomoxetine-d7 HCl (Racemic)
    CAS# NA
    M.F.: C17H15D7ClNO
    M.W.: 298.86
  • QC161818
    Captopril EP Impurity N
    CAS# 65134-74-9
    M.F.: C8H14O4S2
    M.W.: 238.32
  • QC120307
    Celecoxib Impurity G
    CAS# 1061214-06-9
    M.F.: C15H17N3O2S
    M.W.: 303.38
  • QC120306
    Celecoxib Impurity F
    CAS# 915280-81-8
    M.F.: C8H8F3N3O3S
    M.W.: 283.23
  • QD031201
    Daclatasvir Impurity A
    CAS# 1009107-27-0
    M.F.: C40H50N8O6
    M.W.: 738.88
  • QC161817
    Captopril Impurity Q
    CAS# [NA]
    M.F.: C18H28N2O5S2
    M.W.: 416.56
  • QC161802
    Captopril EP Impurity B
    CAS# 80629-35-2
    M.F.: C9H14BrNO3
    M.W.: 264.12
  • QC161816
    Captopril EP Impurity L
    CAS# [NA]
    M.F.: C19H30N2O6S2
    M.W.: 446.58
  • QC161814
    Captopril EP Impurity M
    CAS# [NA]
    M.F.: C13H21NO5S2
    M.W.: 335.44
  • QD033500
    N-Dodecanoyl-L-homoserine lactone
    CAS# 137173-46-7
    M.F.: C16H29NO3
    M.W.: 283.41
  • QD033200
    N-Decanoyl-L-homoserine lactone
    CAS# 177315-87-6
    M.F.: C14H25NO3
    M.W.: 255.35
  • QO003800
    N-Octanoyl-L-homoserine lactone
    CAS# 147852-84-4
    M.F.: C12H21NO3
    M.W.: 227.30
  • QH011100
    N-Hexanoyl-L-homoserine lactone
    CAS# 147852-83-3
    M.F.: C10H17NO3
    M.W.: 199.25
  • QO005900
    N-(3-Oxodecanoyl)-L-homoserine lactone
    CAS# 147795-40-2
    M.F.: C14H23NO4
    M.W.: 269.34
  • QT014700
    N-Tetradecanoyl-DL-homoserine lactone
    CAS# 98206-80-5
    M.F.: C18H33NO3
    M.W.: 311.46
  • QO006000
    N-(3-Oxotetradecanoyl)-L-homoserine lactone
    CAS# 177158-19-9
    M.F.: C18H31NO4
    M.W.: 325.44
  • QF201402
    Controlled Substance
    (Fentanyl EP Impurity K)

    CAS# 1474-02-8
    M.F.: C21H26N2O
    M.W.: 322.44
  • QA162434
    Apixaban Impurity N
    CAS# [NA]
    M.F.: C24H25N5O4
    M.W.: 447.49
  • QD061402
    Diphenoxylate EP Impurity B
    CAS# 4370-12-1
    M.F.: C2H2N2O
    M.W.: 70.05
  • QS010211
    5-Hydroxy Salbutamol (5-Hydroxy Albuterol, Levalbuterol Related Compound G)
    CAS# 182676-90-0
    M.F.: C13H21NO4
    M.W.: 255.31
  • QD032004
    Docetaxel EP Impurity D
    CAS# 162784-72-7
    M.F.: C43H51NO14
    M.W.: 805.86
  • QD032003
    Docetaxel EP Impurity C;
    7-epi-Docetaxel

    CAS# 153381-68-1
    M.F.: C43H53NO14
    M.W.: 807.88
  • QB201413
    Bortezomib Impurity Q
    CAS# [NA]
    M.F.: C10H16BN3O3 
    M.W.:  237.07
  • QB201412
    Bortezomib Impurity P
    CAS# [NA]
    M.F.: C20H26N4O3
    M.W.: 370.46
  • QL140727
    Linagliptin Acetamide
    CAS# 1803079-49-3
    M.F.: C27H30N8O3
    M.W.: 514.58
  • QL140726
    Linagliptin Impurity Z
    CAS# NA
    M.F.: C26H28N8O3
    M.W.: 500.55
  • QF022445
    Febuxostat Impurity Z19
    CAS# 144060-62-8
    M.F.: C16H17NO4S
    M.W.: 319.38
  • QE201301
    Etomidate Impurity A
    CAS# 56649-48-0
    M.F.: C12H12N2O2
    M.W.: 216.24
  • QP150119
    Propylparaben sodium;
    Sodium Propyl Parahydroxybenzoate

    CAS# 35285-69-9;94-13-3(free base)
    M.F.: C10H11NaO3
    M.W.: 202.18
  • QL142612
    Linezolid Impurity D
    CAS# [NA]
    M.F.: C7H12ClNO3
    M.W.: 193.63
  • QD242001
    Controlled Substance
    (Dextromethorphan EP Impurity B)

    CAS# 125-73-5
    M.F.: C17H23NO
    M.W.: 257.38
  • QA162432
    Apixaban Impurity L
    CAS# 4792-57-8
    M.F.: C12H16N2O3
    M.W.: 236.27
  • QA162430
    Apixaban Impurity J
    CAS# 1074549-87-3
    M.F.: C26H27N5O4
    M.W.: 473.52
  • QI191804
    Isradipine EP Impurity D
    CAS# NA
    M.F.: C19H19N3O5
    M.W.: 369.37
  • QI191803
    Isradipine EP Impurity C
    CAS# NA
    M.F.: C17H17N3O5
    M.W.: 343.33
  • QL142211
    Lenvatinib Impurity K
    CAS# 1882873-21-3
    M.F.: C21H17ClN4O3
    M.W.: 408.84
  • QS142003
    Sunitinib Impurity C
    CAS# [NA]
    M.F.: C20H23FN4O2
    M.W.: 370.42
  • QA220311
    Avibactam Impurity K
    CAS# [NA]
    M.F.: C14H17N3O3
    M.W.: 275.30
  • QC061801
    Cefuroxime Impurity 1
    CAS# [NA]
    M.F.: C16H16N4O8S
    M.W.: 424.39
  • QO022007
    Obeticholic Acid Impurity G
    CAS# 865244-30-0
    M.F.: C26H44O4
    M.W.: 420.63
  • QO022006
    Obeticholic Acid Impurity F
    CAS# 1708092-13-0
    M.F.: C26H44O4
    M.W.: 420.63
  • QE262012
    Ezetimibe Impurity L
    CAS# 1700622-08-7
    M.F.: C24H21ClFNO3
    M.W.: 425.88
  • QC061606
    Cefpodoxime Proxetil EP Impurity F
    CAS# 96680-30-7
    M.F.: C22H27N5O10S2
    M.W.: 585.62
  • QC061605
    Cefpodoxime Proxetil EP Impurity E
    CAS# 217803-89-9
    M.F.: C22H27N5O10S2
    M.W.: 585.62
  • QC061604
    Cefpodoxime Proxetil EP Impurity D
    CAS# 947692-13-9
    M.F.: C21H27N5O9S2
    M.W.: 557.61
  • QC061603
    Cefpodoxime Proxetil EP Impurity C
    CAS# 339528-86-8
    M.F.: C21H27N5O9S2
    M.W.: 557.61
  • QC061602
    Cefpodoxime Proxetil EP Impurity B
    CAS# 947692-14-0
    M.F.: C20H25N5O8S2
    M.W.: 527.58
  • QC061601
    Cefpodoxime Proxetil EP Impurity A
    CAS# 80210-62-4
    M.F.: C15H17N5O6S2
    M.W.: 427.46
  • QT021602
    Tebipenem Pivoxil Impurity 2
    CAS# 1391053-29-4
    M.F.: C23H35N3O7S2
    M.W.: 529.67
  • QA165113
    Azithromycin EP Impurity M
    CAS# 765927-71-7
    M.F.: C37H68N2O13
    M.W.: 748.96
  • QB041429
    Budesonide EP Impurity F;
    Desonide

    CAS# 638-94-8
    M.F.: C24H32O6
    M.W.: 416.51
  • QB041427
    Budesonide EP Impurity I
    CAS# 113930-13-5
    M.F.: C25H34O7
    M.W.: 446.53
  • QB041426
    Budesonide EP Impurity J (Mixture of Diastereomers)
    CAS# 313474-59-8
    M.F.: C25H33BrO6
    M.W.: 509.43
  • QB041425
    Budesonide Impurity 1 (Mixture of Diastereomers)
    CAS# NA
    M.F.: C25H32O7
    M.W.: 444.53
  • QB041418
    6-Beta-Hydroxy Budesonide Sulfate
    CAS# NA
    M.F.: C25H34O10S
    M.W.: 526.61
  • QB041413
    Budesonide EP Impurity G
    CAS# 137174-25-5
    M.F.: C25H36O6
    M.W.: 432.55
  • QB041405
    Budesonide (Mixture of Diastereomers)
    CAS# 51333-22-3
    M.F.: C25H34O6
    M.W.: 430.55
  • QV192003
    Valsartan USP RC C
    CAS# 137863-20-8
    M.F.: C31H35N5O3
    M.W.: 525.64
  • QV192001
    Valsartan EP Impurity A
    CAS# 137862-87-4
    M.F.: C24H29N5O3
    M.W.: 435.52
  • QT201605
    Tiotropium EP Impurity E
    CAS# 26447-85-8
    M.F.: C11H10O3S2
    M.W.: 254.33
  • QT201604
    Tiotropium EP Impurity D
    CAS# 136310-66-2
    M.F.: C18H19NO3S2
    M.W.: 361.48
  • QT200304
    Topotecan Acid Sodium Salt
    CAS# 123949-08-6
    M.F.: C23H24N3NaO6
    M.W.: 461.44
  • QT200300H
    Topotecan HCl
    CAS# 119413-54-6
    M.F.: C23H24ClN3O5
    M.W.: 457.91
  • QT192010
    Telmisartan Bromo Acid
    CAS# 150766-86-2
    M.F.: C14H11BrO2
    M.W.: 291.14
  • QT142404
    Tranexamic Acid EP Impurity D
    CAS# 56-91-7
    M.F.: C8H9NO2
    M.W.: 151.16
  • QT142403
    Tranexamic Acid EP Impurity C
    CAS# 330838-52-3;1803601-44-6(HCl salt)
    M.F.: C8H13NO2
    M.W.: 155.19
  • QT142402
    Tranexamic Acid EP Impurity B
    CAS# 1197-17-7;3667-38-7(HCl salt)
    M.F.: C8H15NO2
    M.W.: 157.21
  • QT142401
    Tranexamic Acid EP Impurity A
    CAS# 93940-19-3
    M.F.: C16H27NO4
    M.W.: 297.39
  • QT142400
    Tranexamic Acid
    CAS# 1197-18-8
    M.F.: C8H15NO2
    M.W.: 157.21
  • QT131909
    Tamsulosin EP Impurity I
    CAS# 3259-03-8
    M.F.: C10H13BrO2
    M.W.: 245.11
  • QT131906
    Tamsulosin EP Impurity F
    CAS# 6781-17-5;1051368-80-9(HCl salt)
    M.F.: C10H15NO2
    M.W.: 181.23
  • QT120604
    Tadalafil Desmethylene Impurity
    CAS# 171489-03-5
    M.F.: C21H19N3O4
    M.W.: 377.39
  • QT030300
    Ticarcillin Disodium
    CAS# 4697-14-7
    M.F.: C15H14N2Na2O6S2
    M.W.: 428.38
  • QS132009
    Sumatriptan Hydrazine Impurity
    CAS# 88933-16-8
    M.F.: C8H13N3O2S
    M.W.: 215.27
  • QS132003
    Sumatriptan EP Impurity C
    CAS# 1797905-62-4
    M.F.: C15H23N3O3S
    M.W.: 325.43
  • QS132001
    Sumatriptan EP Impurity A
    CAS# 545338-89-4
    M.F.: C27H37N5O2S
    M.W.: 495.68
  • QR131603
    Ramipril EP Impurity C
    CAS# 99742-35-5
    M.F.: C23H39ClN2O5
    M.W.: 459.02
  • QR131601
    Ramipril EP Impurity A
    CAS# 108313-11-7
    M.F.: C22H30N2O5
    M.W.: 402.48
  • QR131600
    Ramipril
    CAS# 87333-19-5
    M.F.: C23H32N2O5
    M.W.: 416.51
  • QP240300
    Piroxicam
    CAS# 36322-90-4
    M.F.: C15H13N3O4S
    M.W.: 331.35
  • QP202202
    Pitavastatin Ethyl Ester
    CAS# 167073-19-0
    M.F.: C27H28FNO4
    M.W.: 449.51
  • QP201611
    Pantoprazole Sulfide N-Methyl 6-Difluoromethoxy Analog
    CAS# NA
    M.F.: C17H17F2N3O3S
    M.W.: 381.4
  • QO041905
    Ondansetron EP Impurity E;
    Sildenafil EP Impurity E;
    Clotrimazole EP Impurity D;
    Enalapril maleate EP Impurity I;
    Bifonazole EP Impurity C;
    Flutrimazole EP Impurity A

    CAS# 288-32-4
    M.F.: C3H4N2
    M.W.: 68.08
  • QV307743
    Vitamin D3-d3;
    Cholecalciferol-d3

    CAS# 80666-48-4
    M.F.: C27H41D3O
    M.W.: 387.67
  • QS120604
    Solifenacin Impurity D
    CAS# [NA]
    M.F.: C22H18N2O4
    M.W.: 374.39
  • QS120602
    Solifenacin Impurity B
    CAS# 52250-50-7
    M.F.: C15H13N
    M.W.: 207.27
  • QM202607
    Mirtazapine Impurity 7
    CAS# 61338-13-4
    M.F.: C17H19N3O2
    M.W.: 297.35
  • QM202605
    Mirtazapine EP Impurity E
    CAS# 191546-94-8
    M.F.: C17H21N3
    M.W.: 267.37
  • QM202604
    Mirtazapine EP Impurity D
    CAS# 61337-68-6;1188265-41-9(HCl salt)
    M.F.: C16H17N3
    M.W.: 251.33
  • QM202602
    Mirtazapine EP Impurity B
    CAS# 61337-89-1
    M.F.: C17H21N3O
    M.W.: 283.37
  • QM202601
    Mirtazapine EP Impurity A
    CAS# 155172-12-6
    M.F.: C17H19N3O
    M.W.: 281.35
  • QT060317
    Tofacitinib Impurity Q
    CAS# 1092578-47-6;2174011-55-1(Citrate salt)
    M.F.: C16H20N6O
    M.W.: 312.37
  • QT060316
    Tofacitinib Impurity P
    CAS# 1092578-48-7;2174011-54-0(Citrate)
    M.F.: C16H20N6O
    M.W.: 312.37
  • QL162000
    Lapatinib Ditosylate Hydrate
    CAS# 388082-78-8;388082-77-7 (ditosylate salt);231277-92-2 (free base)
    M.F.: C43H44ClFN4O11S3
    M.W.: 943.48
  • QL142609
    Linezolid Desacetamide Phthalimide
    CAS# 168828-89-5
    M.F.: C22H20FN3O5
    M.W.: 425.41
  • QL142607
    Linezolid Descarbonyl Impurity
    CAS# 333753-67-6
    M.F.: C15H22FN3O3
    M.W.: 311.35
  • QL142606
    Linezolid Desacetamide Hydroxy Impurity
    CAS# 168828-82-8
    M.F.: C14H17FN2O4
    M.W.: 296.29
  • QL142604
    Linezolid Desfluoro Impurity
    CAS# 556801-15-1
    M.F.: C16H21N3O4
    M.W.: 319.36
  • QL142601
    Linezolid USP RC A
    CAS# 168828-84-0
    M.F.: C14H16FN5O3
    M.W.: 321.31
  • QL062405
    Levofloxacin EP Impurity C
    CAS# 117678-38-3
    M.F.: C18H20FN3O5
    M.W.: 377.37
  • QL062404
    Levofloxacin EP Impurity A;R-Ofloxacin
    CAS# 100986-86-5
    M.F.: C18H20FN3O4
    M.W.: 361.37
  • QL062403
    Levofloxacin EP Impurity H;
    USP Levofloxacin Related Compound C

    CAS# 177472-30-9
    M.F.: C20H24FN3O4
    M.W.: 389.42
  • QL062402
    Levofloxacin EP Impurity F;
    USP Levofloxacin Related Compound B

    CAS# 100986-89-8
    M.F.: C13H9F2NO4
    M.W.: 281.21
  • QL062401
    Levofloxacin EP Impurity B;
    Levofloxacin USP Related Compound A

    CAS# 117707-40-1;2254176-11-7(HCl salt)
    M.F.: C17H18FN3O4
    M.W.: 347.34
  • QL062001
    Lafutidine Phthalimide Impurity
    CAS# 146447-26-9
    M.F.: C27H29N3O7
    M.W.: 507.54
  • QL061308
    Leflunomide EP Impurity H
    CAS# 24522-30-3
    M.F.: C10H7F3N2O
    M.W.: 228.17
  • QL061307
    Leflunomide EP Impurity G
    CAS# 724429-16-7
    M.F.: C12H12N2O2
    M.W.: 216.24
  • QL061303
    Leflunomide EP Impurity C
    CAS# 61643-23-0
    M.F.: C12H9F3N2O2
    M.W.: 270.21
  • QL061302
    Leflunomide EP Impurity B;Teriflunomide
    CAS# 163451-81-8
    M.F.: C12H9F3N2O2
    M.W.: 270.21
  • QL052008
    Levetiracetam Carboxylic Acid
    CAS# 102849-49-0
    M.F.: C8H13NO3
    M.W.: 171.19
  • QL052003
    Levetiracetam EP Impurity C
    CAS# 142-08-5
    M.F.: C5H5NO
    M.W.: 95.10
  • QL031601
    Levocloperastine Fendizoic Acid Impurity
    CAS# 84627-04-3
    M.F.: C20H14O4
    M.W.: 318.32
  • QL031600H
    Levocloperastine Hydrochloride
    CAS# NA
    M.F.: C20H25Cl2NO
    M.W.: 366.32
  • QL031600F
    Levocloperastine Fendizoate
    CAS# 220329-19-1
    M.F.: C40H38ClNO5
    M.W.: 648.19
  • QK201604
    Ketoprofen EP Impurity D
    CAS# 107257-20-5
    M.F.: C17H16O3
    M.W.: 268.31
  • QK201601
    Ketoprofen EP Impurity A
    CAS# 66067-44-5
    M.F.: C15H12O2
    M.W.: 224.25
  • QI200308
    Irinotecan Acid Sodium Salt
    CAS# NA
    M.F.: C33H39N4NaO7
    M.W.: 626.68
  • QI200303
    Irinotecan EP Impurity E
    CAS# 86639-52-3
    M.F.: C22H20N2O5
    M.W.: 392.4
  • QI200301
    Irinotecan EP Impurity A
    CAS# 103816-16-6
    M.F.: C31H34N4O6
    M.W.: 558.62
  • QI192013
    Irbesartan N1-Trityl Impurity
    CAS# 138402-10-5
    M.F.: C44H42N6O
    M.W.: 670.84
  • QI032611
    Itraconazole Dioxolonyl Impurity
    CAS# 67914-86-7
    M.F.: C14H15Cl2N3O5S
    M.W.: 408.26
  • QI032610
    Itraconazole Methoxy Nitro Impurity
    CAS# NA
    M.F.: C17H21N3O
    M.W.: 283.37
  • QI032604
    Itraconazole EP Impurity D
    CAS# 89848-49-7
    M.F.: C34H36Cl2N8O4
    M.W.: 691.61
  • QH041204
    Hydralazine Triazolo Methyl Impurity
    CAS# 20062-41-3
    M.F.: C10H8N4
    M.W.: 184.2
  • QH032004
    Hydrochlorothiazide 5-Chloro Impurity
    CAS# 5233-42-1
    M.F.: C7H7Cl2N3O4S2
    M.W.: 332.18
  • QH032003
    Hydrochlorothiazide EP Impurity C
    CAS# 402824-96-8
    M.F.: C15H16Cl2N6O8S4
    M.W.: 607.49
  • QH032001
    Hydrochlorothiazide EP Impurity A;
    Chlorothiazide

    CAS# 58-94-6
    M.F.: C7H6ClN3O4S2
    M.W.: 295.72
  • QG200607
    Gatifloxacin Despropylene Impurity
    CAS# 172426-86-7
    M.F.: C16H18FN3O4
    M.W.: 335.33
  • QG200606
    Gatifloxacin Desethylene Impurity
    CAS# 172426-87-8
    M.F.: C17H20FN3O4
    M.W.: 349.36
  • QG121606
    Glipizide EP Impurity F
    CAS# 192118-08-4
    M.F.: C11H16N2O4S
    M.W.: 272.32
  • QG121601
    Glipizide EP Impurity A
    CAS# 33288-71-0
    M.F.: C14H16N4O3S
    M.W.: 320.37
  • QG121308
    Glimepiride EP Impurity H
    CAS# NA
    M.F.: C24H28N4O5S
    M.W.: 484.57
  • QG121305
    Glimepiride EP Impurity E
    CAS# NA
    M.F.: C16H21N3O4S
    M.W.: 351.1253
  • QG121304
    Glimepiride EP Impurity D
    CAS# 791104-62-6
    M.F.: C24H34N4O5S
    M.W.: 490.62
  • QG121303
    Glimepiride EP Impurity C
    CAS# 119018-30-3
    M.F.: C18H23N3O6S
    M.W.: 409.46
  • QG121302
    Glimepiride EP Impurity B
    CAS# 119018-29-0
    M.F.: C16H21N3O4S
    M.W.: 351.42
  • QG121301
    Glimepiride EP Impurity A
    CAS# 684286-46-2
    M.F.: C24H34N4O5S
    M.W.: 490.62
  • QF192007
    Fesoterodine Diol Dimer
    CAS# 1428856-45-4
    M.F.: C44H60N2O3
    M.W.: 664.96
  • QF192006
    Fesoterodine Phenol Aldehyde Impurity
    CAS# NA
    M.F.: C22H29NO2
    M.W.: 339.47
  • QF192005
    Fesoterodine Impurity 5
    CAS# NA
    M.F.: C26H35NO3
    M.W.: 409.57
  • QF192004
    Fesoterodine Fumarate Ester
    CAS# 1254942-29-4
    M.F.: C30H39NO6
    M.W.: 509.63
  • QF192003
    Fesoterodine Diol Fumarate Ester
    CAS# 1428856-47-6
    M.F.: C26H33NO5
    M.W.: 439.54
  • QF192001
    Fesoterodine Fumarate S-Isomer
    CAS# 1431511-18-0;1294517-14-8(free base)
    M.F.: C26H37NO3.C4H4O4
    M.W.: 411.59 116.07
  • QF192000
    Fesoterodine Fumarate
    CAS# 286930-03-8
    M.F.: C26H37NO3.C4H4O4
    M.W.: 411.59 116.07
  • QF191408
    Fosinopril USP RC H
    CAS# NA
    M.F.: C10H15O3P
    M.W.: 214.2
  • QF191407
    Fosinopril USP RC G
    CAS# NA
    M.F.: C12H17O4P
    M.W.: 256.23
  • QF191406
    Fosinopril USP RC B
    CAS# NA
    M.F.: C30H46NO7P
    M.W.: 563.66
  • QF191405
    Fosinopril EP Impurity F
    CAS# NA
    M.F.: C29H44NO7P
    M.W.: 549.64
  • QF191404
    Fosinopril EP Impurity E
    CAS# NA
    M.F.: C30H40NO7P
    M.W.: 557.61
  • QF191403
    Fosinopril EP Impurity D
    CAS# NA
    M.F.: C30H46NO7P
    M.W.: 563.66
  • QF191402
    Fosinopril EP Impurity C
    CAS# NA
    M.F.: C30H46NO7P
    M.W.: 563.66
  • QF191401
    Fosinopril EP Impurity A
    CAS# 95399-71-6
    M.F.: C23H34NO5P
    M.W.: 435.49
  • QF191400NA
    Fosinopril Sodium
    CAS# 88889-14-9
    M.F.: C30H45NNaO7P
    M.W.: 585.64
  • QF190400NA
    Fusidate Sodium
    CAS# 751-94-0
    M.F.: C31H47NaO6
    M.W.: 538.69
  • QF141908
    Finasteride Dehydro Carboxylic Acid Methyl Ester
    CAS# NA
    M.F.: C20H27NO3
    M.W.: 329.43
  • QF141907
    Finasteride Dehydro Carboxylic Acid
    CAS# NA
    M.F.: C19H25NO3
    M.W.: 315.41
  • QF141906
    Finasteride Dihydro Carboxylic Acid Methyl Ester
    CAS# NA
    M.F.: C20H31NO3
    M.W.: 333.47
  • QF141905
    Finasteride Dihydro Carboxylic Acid
    CAS# NA
    M.F.: C19H29NO3
    M.W.: 319.44
  • QF141901
    Finasteride EP Impurity A
    CAS# 98319-24-5
    M.F.: C23H38N2O2
    M.W.: 374.56
  • QF122404
    Fluoxetine R-Isomer HCl
    CAS# 114247-09-5
    M.F.: C17H19ClF3NO
    M.W.: 345.79
  • QF122403
    Fluoxetine EP Impurity C
    CAS# 79088-29-2
    M.F.: C17H19ClF3NO
    M.W.: 345.79
  • QF122011
    Fluticasone Carboxylic Acid
    CAS# 28416-82-2
    M.F.: C21H26F2O5
    M.W.: 396.42
  • QF122010
    Fluticasone USP RC B
    CAS# 219719-95-6
    M.F.: C22H24F2O5S
    M.W.: 438.48
  • QF122009
    Fluticasone Propionate EP Impurity I
    CAS# 960071-64-1
    M.F.: C48H58F4O10S3
    M.W.: 967.16
  • QF122008
    Fluticasone Propionate EP Impurity H
    CAS# 201812-64-8
    M.F.: C48H58F4O10S2
    M.W.: 935.09
  • QF122005
    Fluticasone Propionate EP Impurity E
    CAS# 105613-90-9
    M.F.: C25H33F3O5S
    M.W.: 502.59
  • QF122004
    Fluticasone Propionate EP Impurity D
    CAS# 73205-13-7
    M.F.: C25H32F2O5S
    M.W.: 482.58
  • QF122002
    Fluticasone Propionate EP Impurity B
    CAS# 948566-12-9
    M.F.: C24H30F2O6S
    M.W.: 484.55
  • QF122000P
    Fluticasone Propionate
    CAS# 80474-14-2
    M.F.: C25H31F3O5S
    M.W.: 500.57
  • QF061300
    Fosfomycin Trometamol
    CAS# 78964-85-9
    M.F.: C3H7O4P.C4H11NO3
    M.W.: 138.06 121.14
  • QE200313
    Entacapone EP Impurity C
    CAS# 116313-85-0
    M.F.: C7H5NO5
    M.W.: 183.12
  • QE181406
    Eplerenone delta-9,11-Analog
    CAS# 95716-70-4
    M.F.: C24H30O5
    M.W.: 398.49
  • QE181404
    Eplerenone 6-beta-Hydroxy Analog
    CAS# 209253-80-5
    M.F.: C24H30O7
    M.W.: 430.49
  • QE181403
    Eplerenone Impurity - Canrenone;Spironolactone EP Impurity F
    CAS# 976-71-6
    M.F.: C22H28O3
    M.W.: 340.46
  • QE181402
    Eplerenone Impurity - 11-alpha-Hydroxy Canrenone
    CAS# 192569-17-8
    M.F.: C22H28O4
    M.W.: 356.46
  • QE181401
    Eplerenone Impurity - 9,11-Didehydro Canrenone
    CAS# 95716-71-5
    M.F.: C22H26O3
    M.W.: 338.44
  • QE162002
    Epothilone B
    CAS# 152044-54-7
    M.F.: C27H41NO6S
    M.W.: 507.69
  • QE151303
    Esomeprazole EP Impurity C;Ufiprazole
    CAS# 73590-85-9
    M.F.: C17H19N3O2S
    M.W.: 329.42
  • QE141209
    Enalapril Alanyl Proline Impurity
    CAS# 13485-59-1
    M.F.: C8H14N2O3
    M.W.: 186.21
  • QE141202
    Enalapril maleate EP Impurity B ;
    Quinapril EP Impurity B;
    Ramipril EP Impurity F;
    Spirapril EP Impurity C

    CAS# 82717-96-2
    M.F.: C15H21NO4
    M.W.: 279.33
  • QE141200M
    Enalapril Maleate
    CAS# 76095-16-4
    M.F.: C24H32N2O9
    M.W.: 492.52
  • QE021900NA
    Ecabet Sodium
    CAS# 86408-72-2
    M.F.: C20H27NaO5S
    M.W.: 402.48
  • QD261204
    Dorzolamide EP Impurity D
    CAS# 154154-90-2 (base);164455-27-0 (HCl salt)
    M.F.: C8H13ClN2O4S3
    M.W.: 332.85
  • QD261203
    Dorzolamide EP Impurity C
    CAS# NA
    M.F.: C10H17BN2O6S3
    M.W.: 368.26
  • QD261202
    Dorzolamide EP Impurity B
    CAS# 120279-37-0;120279-90-5(free base)
    M.F.: C10H17ClN2O4S3
    M.W.: 360.9
  • QD261200
    Dorzolamide HCl
    CAS# 130693-82-2
    M.F.: C10H17ClN2O4S3
    M.W.: 360.9
  • QD242607
    Doxazosin EP Impurity G;
    Prazosin EP Impurity C;
    Terazosin EP Impurity C

    CAS# 60547-97-9
    M.F.: C14H19N5O2
    M.W.: 289.33
  • QD242606
    Doxazosin EP Impurity F;
    Prazosin EP Impurity A;
    Terazosin EP Impurity A;
    Alfuzosin EP Impurity B

    CAS# 23680-84-4
    M.F.: C10H10ClN3O2
    M.W.: 239.66
  • QD242605
    Doxazosin EP Impurity E
    CAS# 27631-29-4
    M.F.: C10H8Cl2N2O2
    M.W.: 259.09
  • QD242604
    Doxazosin EP Impurity D
    CAS# 28888-44-0
    M.F.: C10H10N2O4
    M.W.: 222.2
  • QD242603
    Doxazosin EP Impurity C
    CAS# 617677-53-9
    M.F.: C22H22N2O6
    M.W.: 410.42
  • QD242601
    Doxazosin EP Impurity A
    CAS# 3663-80-7
    M.F.: C9H8O4
    M.W.: 180.16
  • QD242600M
    Doxazosin Mesylate
    CAS# 77883-43-3
    M.F.: C24H29N5O8S
    M.W.: 547.58
  • QD241300SP
    Dexamethasone Sodium Phosphate
    CAS# 2392-39-4
    M.F.: C22H28FNa2O8P
    M.W.: 516.4
  • QD221208
    Desvenlafaxine Spiro Impurity
    CAS# NA
    M.F.: C16H23NO2.HCl
    M.W.: 261.37 36.46
  • QD221207
    Desvenlafaxine N-Desmethyl Impurity
    CAS# 135308-74-6
    M.F.: C15H23NO2
    M.W.: 249.35
  • QD221206
    Desvenlafaxine S-Isomer
    CAS# NA
    M.F.: C16H25NO2
    M.W.: 263.38
  • QD221204
    Desvenlafaxine R-Isomer
    CAS# 142761-11-3
    M.F.: C16H25NO2
    M.W.: 263.38
  • QD221202
    Desvenlafaxine N,N-Didesmethyl Impurity
    CAS# 135308-76-8
    M.F.: C14H21NO2.HCl
    M.W.: 235.33 36.46
  • QD221201
    Desvenlafaxine Phenol Impurity
    CAS# 539-15-1;62493-39-4(H2SO4 salt)
    M.F.: C10H15NO
    M.W.: 165.23
  • QD181600
    Doripenem Monohydrate
    CAS# 364622-82-2;148016-81-3(free base)
    M.F.: C15H24N4O6S2.H2O
    M.W.: 420.50 18.02
  • QD180609
    Darifenacin Pyrrolidine Impurity S-Isomer
    CAS# 134002-26-9
    M.F.: C22H26N2O7
    M.W.: 430.45
  • QD180608
    Darifenacin Pyrrolidine Impurity Racemate
    CAS# 103887-32-7
    M.F.: C18H20N2O
    M.W.: 280.36
  • QD180607
    Darifenacin Dimer-2 Impurity
    CAS# NA
    M.F.: C38H40N2O3
    M.W.: 572.74
  • QD180606
    Darifenacin Dimer-1 Impurity
    CAS# NA
    M.F.: C38H40N2O3
    M.W.: 572.74
  • QD180605
    Darifenacin Dehydro Impurity
    CAS# NA
    M.F.: C28H28N2O2
    M.W.: 424.53
  • QD180604
    Darifenacin Cyano Impurity
    CAS# 1159977-31-7
    M.F.: C23H26N2O2
    M.W.: 362.46
  • QD180603
    Darifenacin Carboxylic Acid Impurity
    CAS# 69999-16-2
    M.F.: C10H10O3
    M.W.: 178.18
  • QD180602
    Darifenacin Bromo Impurity
    CAS# 127264-14-6
    M.F.: C10H11BrO
    M.W.: 227.1
  • QD180601
    Darifenacin R-Isomer
    CAS# NA
    M.F.: C28H31BrN2O2
    M.W.: 507.46
  • QD180600H
    Darifenacin HBr
    CAS# 133099-07-7
    M.F.: C28H31BrN2O2
    M.W.: 507.46
  • QD161801
    Dipyridamole EP Impurity A
    CAS# 16982-40-4
    M.F.: C25H40N8O2
    M.W.: 484.64
  • QD160405
    Domperidone EP Impurity E
    CAS# 1346602-50-3
    M.F.: C32H34ClN7O3
    M.W.: 600.11
  • QD160404
    Domperidone EP Impurity D
    CAS# 1614255-34-3
    M.F.: C32H34ClN7O3
    M.W.: 600.11
  • QD160403
    Domperidone Impurity C
    CAS# 118435-03-3
    M.F.: C22H24ClN5O3
    M.W.: 441.91
  • QD160402
    Domperidone EP Impurity B
    CAS# 1346598-11-5
    M.F.: C13H14ClN3O2
    M.W.: 279.72
  • QD160401
    Domperidone EP Impurity A
    CAS# 53786-28-0
    M.F.: C12H14ClN3O
    M.W.: 251.71
  • QD141612
    Donepezil Aldehyde Impurity
    CAS# 22065-85-6
    M.F.: C13H17NO
    M.W.: 203.28
  • QD141611
    Donepezil Keto Acid Impurity
    CAS# NA
    M.F.: C24H29NO5
    M.W.: 411.49
  • QD141610
    Donepezil Hydroxy Acid Impurity
    CAS# NA
    M.F.: C24H31NO5
    M.W.: 413.51
  • QD141609
    Donepezil Pyridine Dihydro Impurity
    CAS# NA
    M.F.: C17H15NO3
    M.W.: 281.31
  • QD141607
    Hydroxy Donepezil
    CAS# 197010-20-1
    M.F.: C24H29NO4
    M.W.: 395.49
  • QD141606
    Donepezil Dihydro Impurity
    CAS# 120012-04-6
    M.F.: C24H31NO3
    M.W.: 381.51
  • QD141605
    Donepezil Desbenzyl Impurity
    CAS# 120013-39-0
    M.F.: C17H23NO3.HCl
    M.W.: 289.38 36.46
  • QD141603
    Donepezil Dehydro Deoxy Impurity
    CAS# 120013-45-8
    M.F.: C24H29NO2
    M.W.: 363.49
  • QD141602
    Donepezil Benzyl Bromide
    CAS# 844694-85-5
    M.F.: C31H36BrNO3
    M.W.: 550.53
  • QD141600
    Donepezil Hydrochloride
    CAS# 120011-70-3;884740-09-4(HCl monohydrate)
    M.F.: C24H29NO3.HCl
    M.W.: 379.50 36.46
  • QD122411
    Duloxetine Impurity 11
    CAS# 132335-44-5
    M.F.: C9H15NOS
    M.W.: 185.29
  • QD122410
    Duloxetine N-Desmethyl Metabolite
    CAS# 178273-35-3
    M.F.: C17H17NOS
    M.W.: 283.39
  • QD122409
    Duloxetine Impurity 9
    CAS# 132335-46-7;132335-47-8(Oxalate)
    M.F.: C19H21NOS
    M.W.: 311.44
  • QD122408
    Duloxetine USP RC H
    CAS# 199191-66-7
    M.F.: C22H23NO4S
    M.W.: 397.49
  • QD122405
    Duloxetine EP Impurity E
    CAS# 1033803-59-6
    M.F.: C18H19NOS
    M.W.: 297.41
  • QD122402
    Duloxetine EP Impurity B
    CAS# 116539-55-0
    M.F.: C8H13NOS
    M.W.: 171.26
  • QD122401
    Duloxetine EP Impurity A
    CAS# 116539-60-7;910138-96-4(HCl salt)
    M.F.: C18H19NOS
    M.W.: 297.41
  • QD122400
    Duloxetine Hydrochloride
    CAS# 136434-34-9;116539-59-4(free base)
    M.F.: C18H20ClNOS
    M.W.: 333.88
  • QD061802
    Aspirin Impurity C;
    Mesalazine EP Impurity H;
    Lamivudine EP Impurity C;
    Acetylsalicylic Acid EP Impurity C;
    Sulfasalazine EP Impurity H;
    Carbasalate calcium EP Impurity C;
    DL-Lysine acetylsalicylate EP Impurity A

    CAS# 69-72-7
    M.F.: C7H6O3
    M.W.: 138.12
  • QD061801
    Deferasirox Benzamide Impurity
    CAS# 65-45-2
    M.F.: C7H7NO2
    M.W.: 137.14
  • QD030410
    Diclofenac Desacetate Impurity
    CAS# 15307-93-4
    M.F.: C12H9Cl2N
    M.W.: 238.11
  • QD030409
    Diclofenac 4-Bromo Analog
    CAS# NA
    M.F.: C19H11BrClN02
    M.W.: 340.6
  • QD030406
    Diclofenac Carboxylic Acid
    CAS# 13625-57-5
    M.F.: C13H9Cl2NO2
    M.W.: 282.12
  • QD030405
    Diclofenac EP Impurity E
    CAS# 59-48-3
    M.F.: C8H7NO
    M.W.: 133.15
  • QD030403
    Diclofenac EP Impurity C
    CAS# 27204-57-5
    M.F.: C13H11Cl2NO
    M.W.: 268.14
  • QD030402
    Diclofenac EP Impurity B
    CAS# 22121-58-0
    M.F.: C13H9Cl2NO
    M.W.: 266.12
  • QD030401
    Diclofenac EP Impurity A
    CAS# 15362-40-0
    M.F.: C14H9Cl2NO
    M.W.: 278.13
  • QC261200NA
    Cefazolin Sodium
    CAS# 27164-46-1;25953-19-9(free base)
    M.F.: C14H13N8NaO4S3
    M.W.: 476.49
  • QC250100M
    Cyamemazine Maleate
    CAS# NA
    M.F.: C19H21N3S C4H4O4
    M.W.: 323.46 116.07
  • QC242000NA
    Cefoxitin Sodium
    CAS# 33564-30-6
    M.F.: C18H16N3NaO7S2
    M.W.: 449.43
  • QC221200
    Clavulanate Potassium
    CAS# 61177-45-5;58001-44-8(free base)
    M.F.: C8H8KNO5
    M.W.: 237.25
  • QC201813
    Cetirizine EP Impurity B Ethyl Ester
    CAS# NA
    M.F.: C21H25ClN2O2
    M.W.: 372.89
  • QC201812
    Cetirizine 4-Chlorobenzophenone Impurity (USP)
    CAS# 134-85-0
    M.F.: C13H9ClO
    M.W.: 216.66
  • QC201811
    Cetirizine 4-Chlorobenzhydrol Impurity (USP);
    Meclizine USP RC A;Meclozine EP Impurity B

    CAS# 119-56-2
    M.F.: C13H11ClO
    M.W.: 218.68
  • QC201803
    Cetirizine EP Impurity C;USP 2-Chlorocetirizine
    CAS# 2702511-37-1;83881-59-8 (free base)
    M.F.: C21H25ClN2O3 2HCl
    M.W.: 388.89 72.92
  • QC200600
    Ceftiofur Sodium
    CAS# 104010-37-9
    M.F.: C19H16N5NaO7S3
    M.W.: 545.54
  • QC192042
    Candesartan Methyl Ester N1-Trityl Methoxy Analog
    CAS# 1246815-58-6
    M.F.: C43H34N6O3
    M.W.: 682.77
  • QC192041
    Candesartan N2-Trityl Methoxy Analog
    CAS# NA
    M.F.: C42H32N6O3
    M.W.: 668.74
  • QC192039
    Candesartan N1-Trityl Methoxy Analog
    CAS# 1246820-94-9
    M.F.: C42H32N6O3
    M.W.: 668.74
  • QC192038
    Candesartan N2-Trityl Impurity
    CAS# NA
    M.F.: C43H34N6O3
    M.W.: 682.77
  • QC192037
    Candesartan Cilexetil N2-Trityl Methoxy Analog
    CAS# NA
    M.F.: C51H46N6O6
    M.W.: 838.95
  • QC192036
    Candesartan Cilexetil Desethyl N2-Trityl Analog
    CAS# NA
    M.F.: C50H44N6O6
    M.W.: 824.92
  • QC192035
    Candesartan Cilexetil Desethyl N1-Trityl Analog
    CAS# 934495-65-5
    M.F.: C50H44N6O6
    M.W.: 824.92
  • QC192034
    Candesartan Methyl Ester N2-Trityl Analog
    CAS# NA
    M.F.: C44H36N6O3
    M.W.: 696.8
  • QC192033
    Candesartan Cilexetil N2-Trityl Analog
    CAS# NA
    M.F.: C52H48N6O6
    M.W.: 852.97
  • QC192032
    Candesartan Cilexetil N1-Trityl Methoxy Analog
    CAS# 1246818-56-3
    M.F.: C51H46N6O6
    M.W.: 838.95
  • QC192030
    Candesartan Ethyl Ester N2-Cilexetil Analog
    CAS# NA
    M.F.: C35H38N6O6
    M.W.: 638.71
  • QC192029
    Candesartan Benzimidazole Methoxy Impurity
    CAS# 1246817-06-0
    M.F.: C10H10N2O3
    M.W.: 206.2
  • QC192028
    Candesartan Ethyl Ester N2-Trityl Analog
    CAS# NA
    M.F.: C45H38N6O3
    M.W.: 710.82
  • QC192027
    Candesartan Methyl Ester N1-Trityl Analog
    CAS# 150058-29-0
    M.F.: C44H36N6O3
    M.W.: 696.8
  • QC192025
    Candesartan Cilexetil Methoxy Analog
    CAS# 1026042-12-5
    M.F.: C32H33ClN6O6
    M.W.: 633.09
  • QC192023
    Candesartan Ethyl Ester N1-Cilexetil Analog
    CAS# NA
    M.F.: C35H38N6O6
    M.W.: 638.71
  • QC192022
    Candesartan Benzimidazole Ethoxy Impurity
    CAS# 150058-27-8
    M.F.: C11H12N2O3
    M.W.: 220.22
  • QC192021
    Candesartan N2-Ethyl Impurity
    CAS# 1246819-02-2
    M.F.: C26H24N6O3
    M.W.: 468.51
  • QC192020
    Candesartan N1-Ethyl Impurity
    CAS# NA
    M.F.: C26H24N6O3
    M.W.: 468.51
  • QC192019
    Candesartan Ethyl Ester Desethyl Analog
    CAS# NA
    M.F.: C24H20N6O3
    M.W.: 440.45
  • QC192018
    Candesartan Methyl Ester Desethyl Analog
    CAS# NA
    M.F.: C23H18N6O3
    M.W.: 426.43
  • QC192017
    Candesartan Ethyl Ester Desethyl N2-Cilexetil Analog
    CAS# NA
    M.F.: C33H34N6O6
    M.W.: 610.66
  • QC192016
    Candesartan Ethyl Ester Desethyl N1-Cilexetil Analog
    CAS# NA
    M.F.: C33H34N6O6
    M.W.: 610.66
  • QC192011
    Candesartan Bromo N1-Trityl Impurity
    CAS# NA
    M.F.: C33H25BrN4
    M.W.: 557.48
  • QC192010
    Candesartan Ethyl Ester N1-Trityl Analog
    CAS# 856414-35-2
    M.F.: C45H38N6O3
    M.W.: 710.82
  • QC192009
    Candesartan Cilexetil EP Impurity I
    CAS# 139481-69-9
    M.F.: C25H22N6O3
    M.W.: 454.48
  • QC192008
    Candesartan Cilexetil EP Impurity H
    CAS# 170791-09-0
    M.F.: C52H48N6O6
    M.W.: 852.97
  • QC192007
    Candesartan Cilexetil EP Impurity G ;
    Candesartan

    CAS# 139481-59-7
    M.F.: C24H20N6O3
    M.W.: 440.45
  • QC192006
    Candesartan Cilexetil EP Impurity F
    CAS# 914613-36-8
    M.F.: C35H38N6O6
    M.W.: 638.71
  • QC192005
    Candesartan Cilexetil EP Impurity E
    CAS# 914613-35-7
    M.F.: C35H38N6O6
    M.W.: 638.71
  • QC192004
    Candesartan Cilexetil EP Impurity D
    CAS# 1185256-03-4
    M.F.: C33H34N6O6
    M.W.: 610.66
  • QC192003
    Candesartan Cilexetil EP Impurity C
    CAS# 1185255-99-5
    M.F.: C33H34N6O6
    M.W.: 610.66
  • QC192002
    Candesartan Cilexetil EP Impurity B
    CAS# 869631-11-8
    M.F.: C31H30N6O6
    M.W.: 582.61
  • QC192001
    Candesartan Cilexetil EP Impurity A
    CAS# 139481-58-6
    M.F.: C26H24N6O3
    M.W.: 468.51
  • QC192000
    Candesartan Cilexetil
    CAS# 145040-37-5
    M.F.: C33H34N6O6
    M.W.: 610.66
  • QC191602
    Cyclosporin B
    CAS# 63775-95-1
    M.F.: C61H109N11O12
    M.W.: 1188.58
  • QC191200
    Cefsulodin Sodium
    CAS# 52152-93-9
    M.F.: C22H19N4NaO8S2
    M.W.: 554.53
  • QC162000
    Camptothecin;Irinotecan EP Impurity D
    CAS# 7689-03-4
    M.F.: C20H16N2O4
    M.W.: 348.35
  • QC161810
    Captopril Ethyl Ester
    CAS# NA
    M.F.: C11H19NO3S
    M.W.: 245.34
  • QC161809
    Captopril EP Impurity J
    CAS# 64838-55-7
    M.F.: C11H17NO4S
    M.W.: 259.32
  • QC161808
    Captopril EP Impurity G
    CAS# 33325-40-5
    M.F.: C6H10O3S
    M.W.: 162.21
  • QC161807
    Captopril EP Impurity F
    CAS# 63250-36-2
    M.F.: C9H15NO3S
    M.W.: 217.29
  • QC161806
    Captopril EP Impurity E
    CAS# 23500-15-4
    M.F.: C9H15NO3
    M.W.: 185.22
  • QC161805
    Captopril EP Impurity D
    CAS# 56970-78-6
    M.F.: C4H7BrO2
    M.W.: 167.00
  • QC161804
    Captopril Acid Amine Salt
    CAS# NA
    M.F.: C18H23NO2S
    M.W.: 317.45
  • QC161803
    Captopril EP Impurity C
    CAS# 26473-47-2
    M.F.: C4H8O2S
    M.W.: 120.17
  • QC161801
    Captopril EP Impurity A
    CAS# 64806-05-9
    M.F.: C18H28N2O6S2
    M.W.: 432.55
  • QC161800
    Captopril
    CAS# 62571-86-2
    M.F.: C9H15NO3S
    M.W.: 217.29
  • QC160700BS
    Clopidogrel Bisulfate
    CAS# 120202-66-6
    M.F.: C16H16ClNO2S . H2SO4
    M.W.: 321.81
  • QC160604
    Ciprofloxacin EP Impurity D
    CAS# 133210-96-5(free base); 526204-10-4
    M.F.: C17H18ClN3O3.HCl
    M.W.: 347.80 36.46
  • QC141805
    Cinnarizine EP Impurity E
    CAS# 216581-01-0;56265-29-3(2HCl salt)
    M.F.: C30H30N2
    M.W.: 418.57
  • QC141804
    Cinnarizine EP Impurity D
    CAS# NA
    M.F.: C35H36N2
    M.W.: 484.67
  • QC141803
    Cinnarizine EP Impurity C
    CAS# 95062-18-3
    M.F.: C35H37ClN2
    M.W.: 521.13
  • QC141802
    Cinnarizine EP Impurity B
    CAS# 750512-44-8
    M.F.: C26H28N2
    M.W.: 368.51
  • QP151426
    13,14-dihydro-16,16-difluoro Prostaglandin E1;15-hydroxy Lubiprostone
    CAS# 475992-30-4
    M.F.: C20H34F2O5
    M.W.: 392.5
  • QC141801
    Cinnarizine EP Impurity A
    CAS# 841-77-0
    M.F.: C17H20N2
    M.W.: 252.35
  • QC132002
    Cimetidine EP Impurity E;Cimetidine Sulfoxide
    CAS# 54237-72-8
    M.F.: C10H16N6OS
    M.W.: 268.34
  • QC130400NA
    Cefamandole Sodium
    CAS# 30034-03-8
    M.F.: C18H17N6NaO5S2
    M.W.: 484.48
  • QC130400N
    Cefamandole Nafate
    CAS# 42540-40-9
    M.F.: C19H17N6NaO6S2
    M.W.: 512.49
  • QC120303
    Celecoxib Carboxylic Acid
    CAS# 170571-01-4
    M.F.: C17H12F3N3O4S
    M.W.: 411.36
  • QC120302
    Celecoxib EP Impurity B
    CAS# 331943-04-5
    M.F.: C17H14F3N3O2S
    M.W.: 381.37
  • QC061205
    Cefalexin EP Impurity E;
    Cefadroxil EP Impurity H;
    Cefradine EP Impurity G

    CAS# 146794-70-9
    M.F.: C13H18N2O4S
    M.W.: 298.36
  • QC061204
    Cefalexin EP Impurity D;
    Cefadroxil EP Impurity G;
    Cefradine EP Impurity F

    CAS# 34876-35-2
    M.F.: C5H6O2S
    M.W.: 130.16
  • QC061203
    Cefalexin EP Impurity C
    CAS# 72528-40-6
    M.F.: C24H24N4O5S
    M.W.: 480.54
  • QC061202
    Cefalexin EP Impurity B;
    Cefadroxil EP Impurity B;
    Cefradine EP Impurity A;
    7-ADCA

    CAS# 22252-43-3
    M.F.: C8H10N2O3S
    M.W.: 214.24
  • QC061201
    Cefalexin EP Impurity A;
    Cefaclor EP Impurity A

    CAS# 875-74-1
    M.F.: C8H9NO2
    M.W.: 151.16
  • QC061200
    Cefalexin Monohydrate
    CAS# 23325-78-2;15686-71-2 (anhydrous)
    M.F.: C16H17N3O4S.H2O
    M.W.: 347.39 18.02
  • QC060600
    Choline Fenofibrate
    CAS# 856676-23-8
    M.F.: C22H28ClNO5
    M.W.: 421.91
  • QC030308
    Cinacalcet N-Oxide
    CAS# 1229224-94-5
    M.F.: C22H22F3NO
    M.W.: 373.41
  • QC030307
    Cinacalcet Impurity F
    CAS# 1271930-12-1 (base)
    M.F.: C22H29ClF3N
    M.W.: 399.92
  • QC030306
    Cinacalcet Impurity E
    CAS# 253337-60-9
    M.F.: C22H25N
    M.W.: 303.44
  • QC030305
    Cinacalcet Impurity D
    CAS# 1271930-15-4(free base)
    M.F.: C32H31F6N.HCl
    M.W.: 543.60 36.46
  • QC030304
    Cinacalcet Impurity C
    CAS# NA
    M.F.: C22H21ClF3N
    M.W.: 391.86
  • QC030303
    Cinacalcet Impurity B
    CAS# NA
    M.F.: C19H20ClN
    M.W.: 297.82
  • QC030301
    Cinacalcet S-Isomer
    CAS# 694495-47-1;1217809-88-5(HCl salt)
    M.F.: C22H22F3N
    M.W.: 357.41
  • QB221400
    Brivanib Alaninate
    CAS# 649735-63-7
    M.F.: C22H24FN5O4
    M.W.: 441.46
  • QB191803
    Benserazide EP Impurity C
    CAS# NA
    M.F.: C10H13N3O5
    M.W.: 255.23
  • QB191802
    Benserazide EP Impurity B
    CAS# 2472968-83-3
    M.F.: C17H21N3O8
    M.W.: 395.36
  • QB191801
    Benserazide EP Impurity A
    CAS# 64616-76-8;55819-71-1(HCl salt)
    M.F.: C3H9N3O2
    M.W.: 119.12
  • QB191618
    Bisoprolol Carboxylic Acid Impurity
    CAS# 72570-70-8;33948-04-8(HCl salt)
    M.F.: C13H19NO4
    M.W.: 253.29
  • QB191617
    Bisoprolol Epoxide Impurity
    CAS# 66722-57-4
    M.F.: C15H22O4
    M.W.: 266.33
  • QB191616
    Bisoprolol Impurity 16
    CAS# 623-05-2
    M.F.: C7H8O2
    M.W.: 124.14
  • QB191615
    Bisoprolol EP Impurity S
    CAS# 123-08-0
    M.F.: C7H6O2
    M.W.: 122.12
  • QB191611
    Bisoprolol Impurity 11
    CAS# 177034-57-0
    M.F.: C12H18O3
    M.W.: 210.27
  • QB191608
    Bisoprolol Impurity 8
    CAS# NA
    M.F.: C15H24O5
    M.W.: 284.35
  • QB191601
    Bisoprolol EP Impurity A
    CAS# 62572-93-4
    M.F.: C13H21NO3
    M.W.: 239.31
  • QB191410
    Bosentan Sulfoxide
    CAS# NA
    M.F.: C27H29N5O5S
    M.W.: 535.61
  • QB191409
    Bosentan Sulfide
    CAS# NA
    M.F.: C27H29N5O4S
    M.W.: 519.62
  • QB191408
    Bosentan O-Desmethyl Impurity
    CAS# 253688-61-8
    M.F.: C26H27N5O6S
    M.W.: 537.59
  • QB191407
    Bosentan Hydroxymethyl O-Desmethyl Impurity
    CAS# 253688-62-9
    M.F.: C26H27N5O7S
    M.W.: 553.59
  • QB191406
    Bosentan Hydroxymethyl Impurity
    CAS# 253688-60-7
    M.F.: C27H29N5O7S
    M.W.: 567.61
  • QB191405
    Bosentan USP RC E
    CAS# 6292-59-7
    M.F.: C10H15NO2S
    M.W.: 213.3
  • QB191404
    Bosentan USP RC D
    CAS# 150728-13-5
    M.F.: C15H10Cl2N4O2
    M.W.: 349.17
  • QB191403
    Bosentan USP RC C
    CAS# 1097263-60-9
    M.F.: C52H52N10O10S2
    M.W.: 1041.16
  • QB191402
    Bosentan USP RC B
    CAS# 174227-14-6
    M.F.: C25H25N5O5S
    M.W.: 507.56
  • QB191401
    Bosentan USP Related Compound A
    CAS# 150727-06-3
    M.F.: C25H24ClN5O4S
    M.W.: 526.01
  • QB161814
    Buspirone N-Oxide (Oxalate)
    CAS# 1797880-63-7;220747-81-9(free base)
    M.F.: C21H31N5O3.C2H2O4
    M.W.: 401.51 90.03
  • QB161813
    Buspirone 6-Hydroxy Metabolite
    CAS# 125481-61-0
    M.F.: C21H31N5O3
    M.W.: 401.5
  • QB161812
    Buspirone 5-Hydroxy Metabolite
    CAS# 105496-33-1
    M.F.: C21H31N5O3
    M.W.: 401.5
  • QB161810
    Buspirone EP Impurity J
    CAS# 2726492-72-2
    M.F.: C34H52N6O5
    M.W.: 624.81
  • QB161809
    Buspirone EP Impurity I
    CAS# 2725354-99-2
    M.F.: C21H30ClN5O2
    M.W.: 419.95
  • QB161808
    Buspirone EP Impurity H
    CAS# 2708578-34-9
    M.F.: C33H50N8O4
    M.W.: 622.81
  • QB161807
    Buspirone EP Impurity G
    CAS# 84746-24-7
    M.F.: C12H14N6
    M.W.: 242.28
  • QB161806
    Buspirone EP Impurity F
    CAS# 2512210-24-9
    M.F.: C33H51N9O3
    M.W.: 621.82
  • QB161805
    Buspirone EP Impurity E
    CAS# 257877-43-3;257877-46-6 (HCl salt)
    M.F.: C21H33N5O3
    M.W.: 403.52
  • QB161804
    Buspirone EP Impurity D
    CAS# 2724726-67-2
    M.F.: C24H38N8O
    M.W.: 454.61
  • QB161803
    Buspirone EP Impurity C
    CAS# 257877-45-5
    M.F.: C20H30N8
    M.W.: 382.51
  • QB161802
    Buspirone EP Impurity B
    CAS# 81461-73-6;179071-85-3(cation form)
    M.F.: C12H19BrN4
    M.W.: 299.21
  • QB161801
    Buspirone EP Impurity A
    CAS# 20980-22-7;78069-54-2(HCl salt)
    M.F.: C8H12N4
    M.W.: 164.21
  • QB161800
    Buspirone HCl
    CAS# 33386-08-2;36505-84-7(free base)
    M.F.: C21H32ClN5O2
    M.W.: 421.96
  • QB161616
    Bupropion ThioMorpholine Acid
    CAS# 1246812-57-6
    M.F.: C12H14ClNO3S
    M.W.: 287.76
  • QB161614
    Bupropion Morpholinol Impurity (HCl Salt)
    CAS# 106083-71-0
    M.F.: C13H19Cl2NO2
    M.W.: 292.2
  • QB161613
    Bupropion Morpholinol Impurity
    CAS# 357399-43-0
    M.F.: C13H18ClNO2
    M.W.: 255.74
  • QB161611
    Bupropion 3',5'-Dichloro Impurity
    CAS# 1193779-48-4;1346603-00-6(HCl salt)
    M.F.: C13H17Cl2NO
    M.W.: 274.19
  • QB161610
    Bupropion 3',4'-Dichloro Impurity
    CAS# 1346598-72-8;1193779-34-8(free base)
    M.F.: C13H17Cl2NO.HCl
    M.W.: 274.19 36.46
  • QB161609
    Bupropion 2-Bromo Impurity
    CAS# 34911-51-8
    M.F.: C9H8BrClO
    M.W.: 247.52
  • QB161608
    Bupropion Des-t-Butylamino Impurity
    CAS# 34841-35-5
    M.F.: C9H9ClO
    M.W.: 168.62
  • QB161607
    Bupropion 2-Chloro Analog
    CAS# 1049718-57-1
    M.F.: C13H19Cl2NO
    M.W.: 276.2
  • QB161606
    Bupropion USP Related Compound F
    CAS# 857233-13-7
    M.F.: C9H9ClO2
    M.W.: 184.62
  • QB161605
    Bupropion Impurity 5
    CAS# 10557-17-2
    M.F.: C9H7ClO2
    M.W.: 182.60
  • QB161604
    Bupropion USP Related Compound D (HCl Salt)
    CAS# 63199-74-6
    M.F.: C13H20ClNO
    M.W.: 241.76
  • QB161603
    Bupropion USP Related Compound C
    CAS# 152943-33-4
    M.F.: C9H9ClO2
    M.W.: 184.62
  • QB161602
    Bupropion USP Related Compound B (HCl Salt)
    CAS# 1049718-43-5;1049974-35-7(free base)
    M.F.: C13H19BrClNO
    M.W.: 320.65
  • QB161601
    Bupropion USP Related Compound A
    CAS# 1049718-72-0
    M.F.: C13H18ClNO.HCl
    M.W.: 239.74 36.46
  • QB161600
    Bupropion Hydrochloride
    CAS# 31677-93-7;34911-55-2(free base)
    M.F.: C13H18ClNO.HCl
    M.W.: 239.74 36.46
  • QB031209
    Bicalutamide S-Isomer
    CAS# 113299-38-0
    M.F.: C18H14F4N2O4S
    M.W.: 430.061
  • QB031202
    Bicalutamide 2-Fluoro Isomer
    CAS# NA
    M.F.: C18H14F4N2O4S
    M.W.: 430.061
  • QA221800
    Alverine Citrate
    CAS# 5560-59-8
    M.F.: C26H35NO7
    M.W.: 473.57
  • QA221301
    Ivermectin
    CAS# 70288-86-7
    M.F.: C48H74O14.C47H72O14
    M.W.: 875.11 861.08
  • QA201401
    Atenolol EP Impurity A
    CAS# 17194-82-0
    M.F.: C8H9NO2
    M.W.: 151.16
  • QA181616
    Aripiprazole Chlorobutoxyquinoline Impurity (USP)
    CAS# 120004-79-7
    M.F.: C13H16ClNO2
    M.W.: 253.72
  • QA181615
    Aripiprazole Hydroxybutyl Impurity
    CAS# 870765-38-1
    M.F.: C14H21Cl3N2O
    M.W.: 339.69
  • QA181614
    Aripiprazole Desethylene Impurity
    CAS# 1216394-63-6
    M.F.: C21H25Cl2N3O2
    M.W.: 422.35
  • QA181613
    Aripiprazole EP Impurity G
    CAS# 1797986-18-5
    M.F.: C48H56Cl4N6O4
    M.W.: 922.81
  • QA181612
    Aripiprazole N,N-Dioxide
    CAS# 573691-13-1
    M.F.: C23H27Cl2N3O4
    M.W.: 480.38
  • QA181609
    Aripiprazole Bromo Impurity
    CAS# 129722-34-5
    M.F.: C13H16BrNO2
    M.W.: 298.18
  • QA181606
    Aripiprazole USP RC H
    CAS# 1796928-63-6
    M.F.: C27H35Cl2N3O3
    M.W.: 520.49
  • QA181605
    Aripiprazole EP Impurity E
    CAS# 129722-25-4
    M.F.: C23H25Cl2N3O2
    M.W.: 446.37
  • QA181604
    Aripiprazole EP Impurity F
    CAS# 573691-09-5
    M.F.: C23H27Cl2N3O3
    M.W.: 464.38
  • QA181603
    Aripiprazole EP Impurity B HCl
    CAS# 119532-26-2;41202-77-1(free base)
    M.F.: C10H12Cl2N2.HCl
    M.W.: 231.12 36.46
  • QA132401
    Amoxicillin EP Impurity A ;
    Ampicillin EP Impurity A;
    Oxacillin sodium monohydrate EP Impurity A

    CAS# 551-16-6
    M.F.: C8H12N2O3S
    M.W.: 216.26
  • QA121631
    Allopurinol Nitrile Impurity
    CAS# 16617-46-2
    M.F.: C4H4N4
    M.W.: 108.1
  • QA121603
    Allopurinol EP Impurity C
    CAS# 1346604-13-4
    M.F.: C6H6N6O
    M.W.: 178.15
  • QT200301
    Tetrahydrofolic Acid
    CAS# 135-16-0
    M.F.: C19H23N7O6
    M.W.: 445.4
  • QA180319
    Adrenic Acid (Solution in ethanol)
    CAS# 28874-58-0
    M.F.: C22H36O2
    M.W.: 332.52
  • QA122206
    Alvimopan Impurity F
    CAS# [NA]
    M.F.: C24H31NO3
    M.W.: 381.51
  • QA122204
    Alvimopan Impurity D
    CAS# [NA]
    M.F.: C24H31NO3
    M.W.: 381.51
  • QA122201
    Alvimopan Impurity A
    CAS# [NA]
    M.F.: C13H19NO
    M.W.: 205.30
  • QA161816
    Aprepitant Impurity P
    CAS# 1242175-34-3
    M.F.: C23H21F7N4O3
    M.W.: 534.43
  • QA161814
    Aprepitant Impurity N
    CAS# 1242175-40-1
    M.F.: C23H21F7N4O3
    M.W.: 534.43
  • QA161812
    Aprepitant Impurity L
    CAS# 172822-28-5
    M.F.: C23H21F7N4O3
    M.W.: 534.43
  • QA161811
    Aprepitant Impurity K
    CAS# 1185502-97-9
    M.F.: C23H21F7N4O3
    M.W.: 534.43
  • QA161809
    Aprepitant Impurity I
    CAS# [NA]
    M.F.: C23H21F7N4O3
    M.W.: 534.43
  • QA161803
    Aprepitant Impurity C
    CAS# 1185503-48-3 (free base)
    M.F.: C20H19ClF7NO2
    M.W.: 473.81
  • QE192010
    Escitalopram Impurity 10
    CAS# NA
    M.F.: C20H23FN2O2
    M.W.: 342.41
  • QP190313
    Posaconazole Impurity M
    CAS# 2243785-99-9
    M.F.: C37H42F2N8O4
    M.W.: 700.78
  • QF022440
    Febuxostat Impurity Z14
    CAS# [NA]
    M.F.: C12H15NO4
    M.W.: 237.25
  • QF022429
    Febuxostat Impurity Z3
    CAS# [NA]
    M.F.: C14H14N2O4S
    M.W.: 306.34
  • QF022427
    Febuxostat Impurity Z1
    CAS# [NA]
    M.F.: C14H15NO5S
    M.W.: 309.34
  • QF022426
    Febuxostat Impurity Z
    CAS# [NA]
    M.F.: C16H19NO5S
    M.W.: 337.39
  • QF022425
    Febuxostat Impurity Y
    CAS# 161798-02-3
    M.F.: C14H12N2O3S
    M.W.: 288.32
  • QF022420
    Febuxostat Impurity T
    CAS# 1657014-33-9
    M.F.: C16H16N2O3S
    M.W.: 316.37
  • QF022417
    Febuxostat Impurity Q
    CAS# [NA]
    M.F.: C12H9NO5S
    M.W.: 279.27
  • QF022416
    Febuxostat Impurity P
    CAS# [NA]
    M.F.: C8H8N2OS2
    M.W.: 212.29
  • QF022414
    Febuxostat Impurity N
    CAS# [NA]
    M.F.: C22H24N2O5S2
    M.W.: 460.57
  • QF022413
    Febuxostat Impurity M
    CAS# 1335202-60-2
    M.F.: C15H16N2OS
    M.W.: 272.37
  • QF022412
    Febuxostat Impurity L
    CAS# [NA]
    M.F.: C18H22N2O4S
    M.W.: 362.44
  • QF022410
    Febuxostat Impurity J
    CAS# 160844-75-7
    M.F.: C18H20N2O3S
    M.W.: 344.43
  • QF022406
    Febuxostat Impurity F
    CAS# 144060-97-9
    M.F.: C17H21NO3S
    M.W.: 319.42
  • QF022405
    Febuxostat Impurity E
    CAS# 1239233-86-3
    M.F.: C16H18N2O4S
    M.W.: 334.39
  • QE261207
    Enzalutamide Impurity G
    CAS# [NA]
    M.F.: C12H16N2O3
    M.W.: 236.27
  • QE261203
    Enzalutamide Impurity C
    CAS# 179232-29-2
    M.F.: C8H6BrFO2
    M.W.: 233.03
  • QE261201
    Enzalutamide Impurity A
    CAS# 112704-79-7
    M.F.: C7H4BrFO2
    M.W.: 219.01
  • QB121410
    Blonanserin Impurity J
    CAS# [NA]
    M.F.: C17H19FN2
    M.W.: 270.34
  • QB121406
    Blonanserin Impurity F
    CAS# [NA]
    M.F.: C7H16N2
    M.W.: 128.22
  • QB121405
    Blonanserin Impurity E
    CAS# [NA]
    M.F.: C17H17ClFNO
    M.W.: 305.77
  • QB121402
    Blonanserin Impurity B
    CAS# 1648791-23-4
    M.F.: C29H43N5
    M.W.: 461.69
  • QC122209
    Clevidipine Impurity I
    CAS# 253597-20-5
    M.F.: C15H15Cl2NO2
    M.W.: 312.19
  • QD160708
    Dapagliflozin Impurity H
    CAS# NA
    M.F.: C21H27ClO7
    M.W.: 426.89
  • QD160707
    Dapagliflozin Impurity G
    CAS# NA
    M.F.: C42H48Cl2O12
    M.W.: 815.73
  • QC201206
     Cetilistat Impurity F
    CAS# [NA]
    M.F.: C11H11NO3
    M.W.: 205.21
  • QC201205
     Cetilistat Impurity E
    CAS# [NA]
    M.F.: C8H7NO2
    M.W.: 149.15
  • QC201201
     Cetilistat Impurity A
    CAS# 2835-98-5
    M.F.: C7H9NO
    M.W.: 123.15
  • QT161809
    Topiroxostat Impurity I
    CAS# 2307-69-9
    M.F.: C10H14O3S
    M.W.: 214.28
  • QT161807
    Topiroxostat Impurity G
    CAS# 80-40-0
    M.F.: C9H12O3S
    M.W.: 200.25
  • QT161805
    Topiroxostat Impurity E
    CAS# 4329-78-6
    M.F.: C12H9N5
    M.W.: 223.23
  • QT161804
    Topiroxostat Impurity D
    CAS# [NA]
    M.F.: C12H8N4O
    M.W.: 224.22
  • QP242008
     Pixantrone maleate Impurity H
    CAS# [NA]
    M.F.: C13H5F2NO2
    M.W.: 245.18
  • QP242007
     Pixantrone maleate Impurity G
    CAS# [NA]
    M.F.: C13H7F2NO3
    M.W.: 263.20
  • QP242006
     Pixantrone maleate Impurity F
    CAS# [NA]
    M.F.: C15H13N3O3
    M.W.: 283.28
  • QP242005
     Pixantrone maleate Impurity E
    CAS# [NA]
    M.F.: C15H14N4O2
    M.W.: 282.30
  • QP242004
     Pixantrone maleate Impurity D
    CAS# [NA]
    M.F.: C15H11N3O3
    M.W.: 281.27
  • QP242003
     Pixantrone maleate Impurity C
    CAS# [NA]
    M.F.: C33H32N8O4
    M.W.: 604.66
  • QP242002
     Pixantrone maleate Impurity B
    CAS# [NA]
    M.F.: C17H17N5O2
    M.W.: 323.35
  • QP242001
     Pixantrone maleate Impurity A
    CAS# [NA]
    M.F.: C15H12FN3O2
    M.W.: 285.27
  • QT132603
    Temozolomide EP Impurity B
    CAS# 113942-30-6
    M.F.: C6H5N5O3
    M.W.: 195.14
  • QD192004
    Dasatinib Impurity D
    CAS# 910297-51-7
    M.F.: C20H22ClN7OS
    M.W.: 443.95
  • QD192002
    Dasatinib Impurity B
    CAS# [NA]
    M.F.: C22H24ClN7O3S
    M.W.: 501.99
  • QD192001
    Dasatinib Impurity A
    CAS# 910297-52-8
    M.F.: C22H26ClN7O3S
    M.W.: 504.00
  • QU121605
    Ulipristal acetate Impurity E
    CAS# [NA]
    M.F.: C30H37NO4
    M.W.: 475.62
  • QU121604
    Ulipristal acetate Impurity D
    CAS# [NA]
    M.F.: C28H33NO4
    M.W.: 447.57
  • QU121603
    Ulipristal acetate Impurity C
    CAS# [NA]
    M.F.: C30H37NO4
    M.W.: 475.62
  • QU121602
    Ulipristal acetate Impurity B
    CAS# 159681-66-0
    M.F.: C29H35NO4
    M.W.: 461.60
  • QU121601
    Ulipristal acetate Impurity A
    CAS# NA
    M.F.: C23H31O5
    M.W.: 387.49
  • QA260304
    Azacitidine Impurity D
    CAS# 645-92-1
    M.F.: C3H5N5O
    M.W.: 127.10
  • QT161803
    Topiroxostat Impurity C
    CAS# [NA]
    M.F.: C13H9N5O2
    M.W.: 267.24
  • QT161802
    Topiroxostat Impurity B
    CAS# 1992028-94-0
    M.F.: C13H10N6O
    M.W.: 266.26
  • QT161801
    Topiroxostat Impurity A
    CAS# [NA]
    M.F.: C13H8N6O
    M.W.: 264.24
  • QF140606
    Fenofibric acid Impurity F;
    Fenofibrate EP Impurity F

    CAS# 154356-96-4
    M.F.: C16H15ClO2
    M.W.: 274.74
  • QF140605
    Fenofibric acid Impurity E;
    Fenofibrate EP Impurity C

    CAS# 217636-47-0
    M.F.: C17H15ClO3
    M.W.: 302.75
  • QF140604
    Fenofibric acid Impurity D
    CAS# 1797121-54-0
    M.F.: C21H21ClO6
    M.W.: 404.84
  • QF140603
    Fenofibric acid Impurity C;
    Fenofibrate EP Impurity E

    CAS# 42019-08-9
    M.F.: C19H19ClO4
    M.W.: 346.80
  • QF140602
    Fenofibric acid;Fenofibrate EP Impurity B
    CAS# 42017-89-0;258834-37-6(Na salt)
    M.F.: C17H15ClO4
    M.W.: 318.75
  • QF140601
    Fenofibric acid Impurity A;
    Fenofibrate EP Impurity D

    CAS# 42019-07-8
    M.F.: C18H17ClO4
    M.W.: 332.78
  • QT060315
    Tofacitinib Impurity O
    CAS# 1092578-46-5;2174011-53-9(Citrate)
    M.F.: C16H20N6O
    M.W.: 312.37
  • QT060309
     Tofacitinib Impurity I
    CAS# [NA]
    M.F.: C13H19N5
    M.W.: 245.32
  • QT060305
     Tofacitinib Impurity E
    CAS# [NA]
    M.F.: C27H31N5O2S
    M.W.: 489.63
  • QT060302
     Tofacitinib Impurity B
    CAS# [NA]
    M.F.: C27H31N5O2S
    M.W.: 489.63
  • QB182605
     Brinzolamide Impurity E
    CAS# [NA]
    M.F.: C13H20N2O7S3
    M.W.: 412.50
  • QB182604
     Brinzolamide Impurity D
    CAS# [NA]
    M.F.: C10H16N2O6S3
    M.W.: 356.44
  • QB182603
     Brinzolamide Impurity C
    CAS# 171273-35-1
    M.F.: C10H14N2O5S3
    M.W.: 338.42
  • QB182602
     Brinzolamide Impurity B
    CAS# [NA]
    M.F.: C11H19N3O5S3
    M.W.: 369.48
  • QB182601
     Brinzolamide Impurity A
    CAS# 154127-19-2
    M.F.: C12H21N3O5S3
    M.W.: 383.51
  • QA261909
    Azilsartan Impurity I
    CAS# 2171316-29-1
    M.F.: C23H19N3O4
    M.W.: 401.41
  • QA261908
    Azilsartan Impurity H
    CAS# 1499167-72-4
    M.F.: C23H20N4O4
    M.W.: 416.43
  • QA261907
    Azilsartan Impurity G
    CAS# 147404-76-0
    M.F.: C25H23N3O4
    M.W.: 429.47
  • QA261905
    Azilsartan Impurity E
    CAS# 2244031-86-3
    M.F.: C22H17N3O4
    M.W.: 387.39
  • QA261903
    Azilsartan Impurity C
    CAS# NA
    M.F.: C22H18N4O4
    M.W.: 402.40
  • QA261901
    Azilsartan Impurity A
    CAS# 1696392-11-6
    M.F.: C24H21N3O4
    M.W.: 415.44
  • QL140706
    Linagliptin Impurity 6
    CAS# [NA]
    M.F.: C25H23F3N8O3
    M.W.: 540.50
  • QL140705
    Linagliptin Impurity 5
    CAS# [NA]
    M.F.: C24H24N8O3
    M.W.: 472.50
  • QL140704
    Linagliptin Impurity 4
    CAS# [NA]
    M.F.: C18H14N6O3
    M.W.: 362.34
  • QL140703
    Linagliptin Impurity 3
    CAS# NA
    M.F.: C15H20N4
    M.W.: 256.35
  • QL140702
    Linagliptin Impurity 2
    CAS# [NA]
    M.F.: C28H32N8O4
    M.W.: 544.60
  • QP181910
    Prasugrel Impurity J
    CAS# 1359829-52-9
    M.F.: C11H10BrFO
    M.W.: 257.10
  • QP181909
    Prasugrel Impurity I
    CAS# 1359829-72-3
    M.F.: C11H10BrFO
    M.W.: 257.10
  • QP181908
    Prasugrel Impurity H
    CAS# 34650-68-5
    M.F.: C11H11BrO
    M.W.: 239.11
  • QP181907
    Prasugrel Hydrochloride EP Impurity G
    CAS# 1391054-37-7
    M.F.: C11H9FO2
    M.W.: 192.19
  • QP181906
    Prasugrel Impurity F
    CAS# [NA]
    M.F.: C20H21BrFNO3S
    M.W.: 454.35
  • QP181904
    Prasugrel Hydrochloride EP Impurity C
    CAS# 1391194-50-5
    M.F.: C20H20FNO3S
    M.W.: 373.44
  • QP181903
    Prasugrel Hydrochloride EP Impurity B
    CAS# 1391194-39-0
    M.F.: C20H20FNO3S
    M.W.: 373.44
  • QP181902
    Prasugrel Hydrochloride EP Impurity A
    CAS# 1391194-45-8;1391053-53-4(HCl salt)
    M.F.: C20H21NO3S
    M.W.: 355.45
  • QL142207
    Lenvatinib Impurity G
    CAS# 417714-14-8
    M.F.: C21H20N4O4
    M.W.: 392.41
  • QL142204
    Lenvatinib Impurity D
    CAS# 417717-04-5
    M.F.: C20H17ClN4O4
    M.W.: 412.83
  • QL142202
    Lenvatinib Impurity B
    CAS# 417721-36-9
    M.F.: C11H9ClN2O2
    M.W.: 236.65
  • QL142201
    Lenvatinib Impurity A
    CAS# 796848-79-8
    M.F.: C10H11ClN2O2
    M.W.: 226.66
  • QD162404
    Dapoxetine Impurity D
    CAS# 2242008-38-2 (HCl salt)
    M.F.: C30H31NO2
    M.W.: 437.57
  • QD162402
    Dapoxetine Impurity B
    CAS# 2414049-30-0;119357-18-5(free base)
    M.F.: C20H21NO.HCl
    M.W.: 291.39 36.46
  • QC122206
    Clevidipine Impurity F
    CAS# 175688-79-6
    M.F.: C21H19Cl2N3O4
    M.W.: 448.30
  • QA120707
    Alogliptin Impurity G
    CAS# NA
    M.F.: C18H21N5O2
    M.W.: 339.39
  • QA120706
    Alogliptin Impurity F
    CAS# 2749281-73-8
    M.F.: C25H25N5O3
    M.W.: 443.50
  • QA120705
    Alogliptin Impurity E
    CAS# [NA]
    M.F.: C23H25N7O4
    M.W.: 463.49
  • QE262006
    Ezetimibe Impurity F
    CAS# 1478664-02-6
    M.F.: C24H21F2NO3
    M.W.: 409.43
  • QE262005
    Ezetimibe Impurity E
    CAS# 1593543-00-0
    M.F.: C24H21F2NO3
    M.W.: 409.43
  • QE262004
    Ezetimibe Impurity D
    CAS# 1478664-18-4
    M.F.: C24H21F2NO3
    M.W.: 409.43
  • QE262003
    Ezetimibe Impurity C
    CAS# 1376614-99-1
    M.F.: C24H21F2NO3
    M.W.: 409.43
  • QT140601
    Tenofovir disoproxil Impurity A
    CAS# 851456-00-3
    M.F.: C15H25N6O5P
    M.W.: 400.37
  • QR182403
    Brexpiprazole Impurity C
    CAS# 2059954-32-2
    M.F.: C17H21Cl2NO2
    M.W.: 342.26
  • QR182402
    Brexpiprazole Impurity B
    CAS# 2116542-19-7
    M.F.: C22H20N2O4
    M.W.: 376.41
  • QR182421
    Brexpiprazole Impurity U
    CAS# 2094559-58-5
    M.F.: C38H40N4O4S
    M.W.: 648.81
  • QR182420
    Brexpiprazole Impurity T
    CAS# 1420987-86-5
    M.F.: C20H18N2S2
    M.W.: 350.50
  • QR182419
    Brexpiprazole Impurity S
    CAS# [NA]
    M.F.: C25H29N3O2S
    M.W.: 435.58
  • QR182418
    Brexpiprazole Impurity R
    CAS# 102-92-1
    M.F.: C9H7ClO
    M.W.: 166.60
  • QR182417
    Brexpiprazole Impurity Q
    CAS# [NA]
    M.F.: C9H5BrO2S
    M.W.: 257.10
  • QR182415
    Brexpiprazole Impurity O
    CAS# [NA]
    M.F.: C33H33N3O2S2
    M.W.: 567.76
  • QR182414
    Brexpiprazole Impurity N
    CAS# 1420987-85-4
    M.F.: C20H20N2S2
    M.W.: 352.52
  • QR182412
    Brexpiprazole Impurity L
    CAS# [NA]
    M.F.: C26H28N2O5
    M.W.: 448.51
  • QR182411
    Brexpiprazole Impurity K
    CAS# 146121-18-8
    M.F.: C12H12ClNO2
    M.W.: 237.68
  • QR182409
    Brexpiprazole Impurity I
    CAS# 1886188-97-1
    M.F.: C13H15NO3
    M.W.: 233.26
  • QR182408
    Brexpiprazole Impurity H
    CAS# 913614-15-0
    M.F.: C16H22N2OS
    M.W.: 290.42
  • QI132008
    Imatinib EP Impurity B
    CAS# 581076-65-5
    M.F.: C21H28N6O
    M.W.: 380.49
  • QI132006
    Imatinib EP Impurity C
    CAS# 404844-02-6
    M.F.: C28H29N7O
    M.W.: 479.58
  • QI132004
    Imatinib EP Impurity J
    CAS# 571186-91-9
    M.F.: C29H31N7O2
    M.W.: 509.60
  • QI132003
    Imatinib Impurity 3
    CAS# 938082-57-6
    M.F.: C29H31N7O2
    M.W.: 509.60
  • QI132002
    Imatinib Impurity 2
    CAS# 571186-93-1
    M.F.: C29H31N7O3
    M.W.: 525.60
  • QI132001
    Imatinib Impurity 1
    CAS# 571186-92-0
    M.F.: C29H31N7O2
    M.W.: 509.60
  • QT120828
    Trelagliptin Impurity Z2
    CAS# [NA]
    M.F.: C17H22FN5O
    M.W.: 331.39
  • QT120827
    Trelagliptin Impurity Z1
    CAS# [NA]
    M.F.: C17H21N5O2
    M.W.: 327.38
  • QT120825
    Trelagliptin Impurity Y
    CAS# [NA]
    M.F.: C15H14FN3O3
    M.W.: 303.29
  • QT120824
    Trelagliptin Impurity X
    CAS# [NA]
    M.F.: C14H12FN3O3
    M.W.: 289.26
  • QT120822
    Trelagliptin Impurity V
    CAS# [NA]
    M.F.: C10H9ClN4O4
    M.W.: 284.66
  • QT120821
    Trelagliptin Impurity U
    CAS# [NA]
    M.F.: C18H24FN5O2
    M.W.: 361.41
  • QT120816
    Trelagliptin Impurity P
    CAS# [NA]
    M.F.: C13H9ClFN3O2
    M.W.: 293.68
  • QT120815
    Trelagliptin Impurity 15
    CAS# [NA]
    M.F.: C18H20FN5O2
    M.W.: 357.38
  • QT120808
    Trelagliptin Impurity H
    CAS# [NA]
    M.F.: C23H24FN7O4
    M.W.: 481.48
  • QT120807
    Trelagliptin Impurity G
    CAS# [NA]
    M.F.: C18H13ClFN5O4
    M.W.: 417.78
  • QC182579
    Canagliflozin Impurity I
    CAS# [NA]
    M.F.: C32H33FO9S
    M.W.: 612.66
  • QC182577
    Canagliflozin Impurity G
    CAS# [NA]
    M.F.: C10H11FS
    M.W.: 182.26
  • QC182574
    Canagliflozin Impurity D
    CAS# [NA]
    M.F.: C24H26O5S
    M.W.: 426.53
  • QK201803
    Ketorolac EP Impurity I
    CAS# 113502-55-9
    M.F.: C14H13NO
    M.W.: 211.26
  • QK201801
    Ketorolac EP Impurity A
    CAS# 154476-25-2
    M.F.: C14H13NO2
    M.W.: 227.26
  • QI161804
    Ipriflavone Impurity D
    CAS# NA
    M.F.: C17H18O3
    M.W.: 270.32
  • QI161803
    Ipriflavone Impurity C
    CAS# NA
    M.F.: C17H14O3
    M.W.: 266.29
  • QI161802
    Ipriflavone Impurity B
    CAS# 13057-72-2
    M.F.: C15H10O3
    M.W.: 238.24
  • QI161801
    Ipriflavone Impurity A
    CAS# NA
    M.F.: C14H12O3
    M.W.: 228.24
  • QP141205
    Phenylephrine EP Impurity E
    CAS# 71786-67-9
    M.F.: C16H17NO2.HCl
    M.W.: 255.31 36.46
  • QP141204
    Phenylephrine EP Impurity D
    CAS# 1367567-95-0(free base)
    M.F.: C16H19NO2.HCl
    M.W.: 257.33 36.46
  • QE044320
    Etoricoxib Impurity T
    CAS# NA
    M.F.: C25H20ClN3O3S
    M.W.: 477.96
  • QK161808
    Kyprolis Impurity H
    CAS# [NA]
    M.F.: C40H57N5O7
    M.W.: 719.91
  • QK161806
    Kyprolis Impurity F
    CAS# [NA]
    M.F.: C26H46N4O6
    M.W.: 510.67
  • QK161804
    Kyprolis Impurity D
    CAS# [NA]
    M.F.: C9H17NO2
    M.W.: 171.24
  • QK161803
    Kyprolis Impurity C
    CAS# [NA]
    M.F.: C9H17NO2
    M.W.: 171.24
  • QK161802
    Kyprolis Impurity B
    CAS# [NA]
    M.F.: C9H17NO2
    M.W.: 171.24
  • QK161801
    Kyprolis Impurity A
    CAS# [NA]
    M.F.: C34H46N4O6
    M.W.: 606.75
  • QP020315
    Palbociclib Impurity O
    CAS# [NA]
    M.F.: C42H61N9O6
    M.W.: 787.99
  • QP020313
    Palbociclib Impurity M
    CAS# [NA]
    M.F.: C23H38N6O4
    M.W.: 462.59
  • QP020311
    Palbociclib Impurity K
    CAS# [NA]
    M.F.: C24H29N7O2
    M.W.: 447.53
  • QP020310
    Palbociclib Impurity J
    CAS# [NA]
    M.F.: C33H45N7O4
    M.W.: 603.75
  • QP020309
    Palbociclib Impurity I
    CAS# [NA]
    M.F.: C27H34BrN7O3
    M.W.: 584.51
  • QP020304
    Palbociclib Impurity D
    CAS# [NA]
    M.F.: C14H20BrN3O2
    M.W.: 342.23
  • QP020303
    Palbociclib Impurity C
    CAS# 153747-97-8
    M.F.: C14H20BrN3O2
    M.W.: 342.23
  • QP020302
    Palbociclib Impurity B
    CAS# 1072-97-5
    M.F.: C5H5BrN2
    M.W.: 173.01
  • QP020301
    Palbociclib Impurity A
    CAS# 39856-50-3
    M.F.: C5H3BrN2O2
    M.W.: 202.99
  • QO022005
    Obeticholic Acid Impurity E
    CAS# 915038-25-4
    M.F.: C26H42O4
    M.W.: 418.61
  • QO022004
    Obeticholic Acid Impurity D
    CAS# NA
    M.F.: C26H42O4
    M.W.: 418.61
  • QO022003
    Obeticholic Acid Impurity C
    CAS# 1908444-28-9
    M.F.: C52H86O7
    M.W.: 823.24
  • QO022002
    Obeticholic Acid Impurity B
    CAS# [NA]
    M.F.: C26H42O4
    M.W.: 418.61
  • QO022001
    Obeticholic Acid Impurity A
    CAS# 865244-30-0
    M.F.: C26H44O4
    M.W.: 420.63
  • QE200304
    Entecavir Impurity 4
    CAS# 188399-46-4
    M.F.: C12H15N5O3
    M.W.: 277.28
  • QE200302
    Entecavir Impurity 2
    CAS# 1367369-76-3
    M.F.: C12H15N5O3
    M.W.: 277.28
  • QA220305
    Avibactam Impurity E
    CAS# 2606850-80-8(free base)
    M.F.: C7H9N3Na2O9S2
    M.W.: 389.27
  • QP180308
    Piperacillin Sodium EP Impurity H;
    Flucloxacillin sodium EP Impurity C;
    Cloxacillin Sodium EP Impurity C;
    Bacampicillin hydrochloride EP Impurity A

    CAS# 551-16-6
    M.F.: C8H12N2O3S
    M.W.: 216.26
  • QP180307
    Piperacillin Sodium EP Impurity G
    CAS# 63422-71-9
    M.F.: C15H17N3O5
    M.W.: 319.32
  • QP180306
    Piperacillin EP Impurity F;
    Piperacillin Sodium EP Impurity F

    CAS# [NA]
    M.F.: C25H31N5O9S
    M.W.: 577.62
  • QP161805
    Piperacillin EP Impurity E ;
    Piperacillin Sodium EP Impurity E

    CAS# 59702-31-7
    M.F.: C6H10N2O2
    M.W.: 142.16
  • QH240300
    Hexanoic acid;Caprylic acid EP Impurity A
    CAS# 142-62-1
    M.F.: C6H12O2
    M.W.: 116.16
  • QH160315
    Heptanoic acid;Caprylic acid EP Impurity B
    CAS# 111-14-8
    M.F.: C7H14O2
    M.W.: 130.18
  • QA250919
    Controlled Substance
    (Amobarbital sodium)

    CAS# 64-43-7;57-43-2(free base)
    M.F.: C11H17N2NaO3
    M.W.: 248.25
  • QT031480
    D-delta-Tocotrienol
    CAS# 25612-59-3
    M.F.: C27H40O2
    M.W.: 396.61
  • QT031470
    D-gamma-Tocotrienol
    CAS# 14101-61-2
    M.F.: C28H42O2
    M.W.: 410.63
  • QT031460
    D-beta-Tocotrienol
    CAS# 490-23-3
    M.F.: C28H42O2
    M.W.: 410.63
  • QT031450
    D-alpha-Tocotrienol
    CAS# 58864-81-6
    M.F.: C29H44O2
    M.W.: 424.67
  • QT031880
    RRR-α-Tocopherol EP Impurity A;
    RRR-δ-tocopherol

    CAS# 119-13-1
    M.F.: C27H46O2
    M.W.: 402.65
  • QT031870
    D-gamma-Tocopherol;
    RRR-α-Tocopherol EP Impurity C

    CAS# 54-28-4
    M.F.: C28H48O2
    M.W.: 416.68
  • QT031860
    D-beta-Tocopherol;
    RRR-α-Tocopherol EP Impurity B

    CAS# 16698-35-4
    M.F.: C28H48O2
    M.W.: 416.68
  • QT201460
    1-Tetradecanol
    CAS# 112-72-1
    M.F.: C14H30O
    M.W.: 214.39
  • QM242000
    Maxacalcitol
    CAS# 103909-75-7
    M.F.: C26H42O4
    M.W.: 418.62
  • QC081332
    Calcitriol EP Impurity B
    CAS# 66791-71-7
    M.F.: C27H44O3
    M.W.: 416.64
  • QH323420
    1-Hydroxy Vitamin D2;Doxercalciferol
    CAS# 54573-75-0
    M.F.: C28H44O2
    M.W.: 412.65
  • QP151330
    Provitamin D3;
    Cholecalciferol EP Impurity B

    CAS# 434-16-2
    M.F.: C27H44O
    M.W.: 384.64
  • QD323370
    1,24-Dihydroxy Vitamin D3;Tacalcitol
    CAS# 57333-96-7;93129-94-3(monohydrate)
    M.F.: C27H44O3
    M.W.: 416.63
  • QD768010
    24,25-Dihydroxy Vitamin D2
    CAS# 58050-55-8
    M.F.: C28H44O3
    M.W.: 428.65
  • QC081330
    1,25-Dihydroxy Vitamin D3;Calcitriol
    CAS# 32222-06-3
    M.F.: C27H44O3
    M.W.: 416.64
  • QC081320
    1,25-Dihydroxy Vitamin D2
    CAS# 60133-18-8
    M.F.: C28H44O3
    M.W.: 428.65
  • QC041330
    25-Hydroxy Vitamin D3
    CAS# 19356-17-3;63283-36-3(monohydrate)
    M.F.: C27H44O2
    M.W.: 400.64
  • QC041320
    25-Hydroxy Vitamin D2
    CAS# 21343-40-8
    M.F.: C28H44O2
    M.W.: 412.65
  • QP885200
    12-oxo Phytodienoic Acid
    CAS# 85551-10-6
    M.F.: C18H28O3
    M.W.: 292.41
  • QT090301
    Thioctic Acid EP Impurity A
    CAS# 1204245-29-3
    M.F.: C8H14O2S3
    M.W.: 238.39
  • QF120365
    Folic Acid-13C11
    CAS# 59-30-3 (unlabeled)
    M.F.: C813C11H19N7O6
    M.W.: 452.32
  • QA048218
    Aspartic acid condensate
    CAS# 60079-22-3
    M.F.: C8H12N2O7
    M.W.: 248.19
  • DISCLAIMER | PRIVACY POLICY | TERMS OF USE
    © QUALITY CONTROL CHEMICALS INC. ALL RIGHTS RESERVED.